F378916

General Info

Members Datasets Scaffolds Average Seq Length
273 179 546 79

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_101801730|Ga0070696_1018017301
Length 94
Sequence VLSAFIRVYLRTMALVDRAARERLKWRSKRGLLELDLVFERFWKSEGARLTEGEGAALEKLLLLPDNDLLDLVMGRAQVREGDVAALVEKLRAV

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
119 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
124 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
125 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 1.1
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_101801730 3300005546 Bacteria 529
2 rootL2_10020475 3300003322 Bacteria 2630
3 Ga0070658_10126597 3300005327 Bacteria 2127
4 Ga0070658_11017174 3300005327 Bacteria 721
5 Ga0070676_10216924 3300005328 Bacteria 1262
6 Ga0070690_100730754 3300005330 Bacteria 763
7 Ga0070670_100876931 3300005331 Bacteria 813
8 Ga0070670_102018172 3300005331 Bacteria 531
9 Ga0070677_10370705 3300005333 Bacteria 747
10 Ga0070677_10529973 3300005333 Bacteria 643
11 Ga0068869_100102080 3300005334 Bacteria 2170
12 Ga0070660_100576285 3300005339 Bacteria 940
13 Ga0070689_100019625 3300005340 Bacteria 5000
14 Ga0070669_100501518 3300005353 Bacteria 1007
15 Ga0070669_101155817 3300005353 Bacteria 668
16 Ga0070675_100000315 3300005354 Bacteria 32531
17 Ga0070675_100036731 3300005354 Bacteria 3988
18 Ga0070671_100415500 3300005355 Bacteria 1152
19 Ga0070674_100019984 3300005356 Bacteria 4267
20 Ga0070674_100700754 3300005356 Bacteria 866
21 Ga0070674_102096983 3300005356 Bacteria 516
22 Ga0070673_100083886 3300005364 Bacteria 2589
23 Ga0070673_100121368 3300005364 Bacteria 2180
24 Ga0070673_100645137 3300005364 Bacteria 969
25 Ga0070688_100162215 3300005365 Bacteria 1536
26 Ga0070688_101329689 3300005365 Bacteria 581
27 Ga0070659_101215767 3300005366 Bacteria 667
28 Ga0070667_101987295 3300005367 Bacteria 548
29 Ga0070709_10938734 3300005434 Bacteria 686
30 Ga0070714_101529822 3300005435 Bacteria 652
31 Ga0070705_100048960 3300005440 Bacteria 2452
32 Ga0070705_100092912 3300005440 Bacteria 1884
33 Ga0070700_101604098 3300005441 Bacteria 556
34 Ga0070694_100083073 3300005444 Bacteria 2231
35 Ga0070678_100307389 3300005456 Bacteria 1349
36 Ga0070678_100514783 3300005456 Bacteria 1058
37 Ga0070678_100806407 3300005456 Bacteria 853
38 Ga0068867_100020082 3300005459 Bacteria 4760
39 Ga0070685_11403941 3300005466 Bacteria 536
40 Ga0070698_100474207 3300005471 Bacteria 1188
41 Ga0070698_101305661 3300005471 Bacteria 676
42 Ga0070698_102060492 3300005471 Bacteria 524
43 Ga0070684_101940421 3300005535 Bacteria 556
44 Ga0070672_100085271 3300005543 Bacteria 2538
45 Ga0070686_101552640 3300005544 Bacteria 559
46 Ga0070695_100348012 3300005545 Bacteria 1109
47 Ga0070693_100148212 3300005547 Bacteria 1483
48 Ga0070693_100885325 3300005547 Bacteria 668
49 Ga0070665_101744129 3300005548 Bacteria 630
50 Ga0070704_101573920 3300005549 Bacteria 605
51 Ga0068857_100102628 3300005577 Bacteria 2567
52 Ga0070702_100021987 3300005615 Bacteria 3365
53 Ga0070702_100111069 3300005615 Bacteria 1699
54 Ga0070702_100557510 3300005615 Bacteria 852
55 Ga0070702_101541803 3300005615 Bacteria 548
56 Ga0068859_100262738 3300005617 Bacteria 1818
57 Ga0068864_100806855 3300005618 Bacteria 923
58 Ga0068861_100743074 3300005719 Bacteria 916
59 Ga0068861_101165010 3300005719 Bacteria 744
60 Ga0068861_101479496 3300005719 Bacteria 666
61 Ga0068861_102491064 3300005719 Unclassified 521
62 Ga0068862_102042407 3300005844 Bacteria 584
63 Ga0081538_10027524 3300005981 Bacteria 3939
64 Ga0070717_11509442 3300006028 Bacteria 610
65 Ga0075362_10530117 3300006177 Bacteria 604
66 Ga0075366_10141574 3300006195 Bacteria 1454
67 Ga0097621_100451091 3300006237 Bacteria 1159
68 Ga0097621_101538774 3300006237 Bacteria 632
69 Ga0075370_10276206 3300006353 Bacteria 998
70 Ga0075370_10748296 3300006353 Bacteria 595
71 Ga0068871_100773409 3300006358 Bacteria 884
72 Ga0075430_100109859 3300006846 Bacteria 2300
73 Ga0068865_100829148 3300006881 Bacteria 800
74 Ga0068865_101662088 3300006881 Bacteria 575
75 Ga0097620_100262732 3300006931 Bacteria 1818
76 Ga0111539_10676070 3300009094 Bacteria 1202
77 Ga0105245_10614321 3300009098 Bacteria 1115
78 Ga0105245_12171589 3300009098 Bacteria 609
79 Ga0105245_12741191 3300009098 Bacteria 546
80 Ga0105245_12965009 3300009098 Bacteria 526
81 Ga0105243_10335883 3300009148 Bacteria 1382
82 Ga0105243_11710017 3300009148 Bacteria 658
83 Ga0105241_12301049 3300009174 Unclassified 536
84 Ga0105242_10002383 3300009176 Bacteria 14811
85 Ga0105242_10304405 3300009176 Bacteria 1456
86 Ga0105242_10668023 3300009176 Bacteria 1013
87 Ga0105242_11140943 3300009176 Bacteria 796
88 Ga0105242_12610758 3300009176 Bacteria 554
89 Ga0105242_12778326 3300009176 Bacteria 540
90 Ga0105248_10799106 3300009177 Bacteria 1065
91 Ga0105248_11182179 3300009177 Bacteria 865
92 Ga0105238_10283676 3300009551 Bacteria 1638
93 Ga0157369_10580553 3300013105 Bacteria 1158
94 Ga0163162_10110573 3300013306 Bacteria 2845
95 Ga0163162_10283305 3300013306 Bacteria 1789
96 Ga0163162_11031094 3300013306 Bacteria 931
97 Ga0163162_11038229 3300013306 Bacteria 927
98 Ga0157372_11507848 3300013307 Bacteria 774
99 Ga0157375_11720417 3300013308 Bacteria 743
100 Ga0157375_12254563 3300013308 Bacteria 649
101 Ga0163163_12050786 3300014325 Bacteria 632
102 Ga0157380_10112677 3300014326 Bacteria 2289
103 Ga0157380_11463002 3300014326 Bacteria 735
104 Ga0157377_10100870 3300014745 Bacteria 1720
105 Ga0157379_10306250 3300014968 Bacteria 1449
106 Ga0157379_10636397 3300014968 Bacteria 998
107 Ga0157376_10077547 3300014969 Bacteria 2843
108 Ga0163161_10646951 3300017792 Bacteria 876
109 Ga0213872_10001055 3300021361 Bacteria 19163
110 Ga0213872_10006948 3300021361 Bacteria 5624
111 Ga0207682_10373905 3300025893 Bacteria 672
112 Ga0207642_10463117 3300025899 Bacteria 770
113 Ga0207688_10437593 3300025901 Bacteria 814
114 Ga0207699_10395763 3300025906 Bacteria 983
115 Ga0207643_10055995 3300025908 Bacteria 2242
116 Ga0207705_10054124 3300025909 Bacteria 2892
117 Ga0207705_10605917 3300025909 Bacteria 852
118 Ga0207660_10078813 3300025917 Bacteria 2415
119 Ga0207662_10133274 3300025918 Bacteria 1568
120 Ga0207662_10193018 3300025918 Bacteria 1315
121 Ga0207649_10611639 3300025920 Bacteria 839
122 Ga0207681_10204823 3300025923 Bacteria 1517
123 Ga0207681_11035053 3300025923 Bacteria 689
124 Ga0207694_10659497 3300025924 Bacteria 882
125 Ga0207694_11528049 3300025924 Bacteria 563
126 Ga0207650_10700277 3300025925 Bacteria 856
127 Ga0207650_11616070 3300025925 Bacteria 550
128 Ga0207659_10731293 3300025926 Bacteria 848
129 Ga0207687_10352726 3300025927 Bacteria 1199
130 Ga0207687_10371918 3300025927 Bacteria 1169
131 Ga0207687_10665044 3300025927 Bacteria 882
132 Ga0207690_10064757 3300025932 Bacteria 2497
133 Ga0207686_11804243 3300025934 Bacteria 506
134 Ga0207686_11820113 3300025934 Bacteria 504
135 Ga0207670_10115433 3300025936 Bacteria 1942
136 Ga0207670_10558662 3300025936 Bacteria 936
137 Ga0207669_10396988 3300025937 Bacteria 1079
138 Ga0207669_10800012 3300025937 Bacteria 782
139 Ga0207669_10863770 3300025937 Bacteria 754
140 Ga0207669_11678859 3300025937 Bacteria 542
141 Ga0207704_10774069 3300025938 Bacteria 800
142 Ga0207704_11506774 3300025938 Bacteria 577
143 Ga0207691_10024708 3300025940 Bacteria 5650
144 Ga0207691_10459215 3300025940 Bacteria 1083
145 Ga0207691_10770920 3300025940 Bacteria 809
146 Ga0207711_11417309 3300025941 Bacteria 637
147 Ga0207689_10109805 3300025942 Bacteria 2266
148 Ga0207679_10891000 3300025945 Bacteria 814
149 Ga0207651_10299605 3300025960 Bacteria 1336
150 Ga0207651_10456438 3300025960 Bacteria 1097
151 Ga0207651_10740474 3300025960 Bacteria 868
152 Ga0207658_11432595 3300025986 Bacteria 632
153 Ga0207708_11981111 3300026075 Bacteria 510
154 Ga0207648_10059054 3300026089 Bacteria 3345
155 Ga0207648_10916736 3300026089 Bacteria 819
156 Ga0207676_10952900 3300026095 Bacteria 844
157 Ga0207676_12367292 3300026095 Bacteria 528
158 Ga0207675_100753058 3300026118 Bacteria 985
159 Ga0207675_101163041 3300026118 Bacteria 792
160 Ga0207683_10581953 3300026121 Bacteria 1035
161 Ga0207683_10626944 3300026121 Bacteria 996
162 Ga0207683_10640659 3300026121 Bacteria 984
163 Ga0207698_12485355 3300026142 Bacteria 528
164 Ga0268266_10074286 3300028379 Bacteria 2952
165 Ga0268266_10940025 3300028379 Bacteria 836
166 Ga0268265_11611418 3300028380 Bacteria 654
167 Ga0307408_100250569 3300031548 Bacteria 1460
168 Ga0307408_101059053 3300031548 Bacteria 750
169 Ga0307405_10469001 3300031731 Bacteria 1002
170 Ga0307405_11296878 3300031731 Bacteria 633
171 Ga0307407_10422909 3300031903 Bacteria 961
172 Ga0307412_10072565 3300031911 Bacteria 2353
173 Ga0307412_10513527 3300031911 Bacteria 1000
174 Ga0307412_11500660 3300031911 Bacteria 613
175 Ga0307416_100519682 3300032002 Bacteria 1258
176 Ga0307416_102116244 3300032002 Bacteria 664
177 Ga0307416_102961699 3300032002 Bacteria 568
178 Ga0307411_11270915 3300032005 Bacteria 670
179 Ga0307415_100531509 3300032126 Bacteria 1034
180 Ga0373929_0069071 3300035085 Bacteria 842
181 Ga0373923_0262815 3300035111 Bacteria 810
182 Ga0373954_0144376 3300035118 Bacteria 1162
183 Ga0373956_0078104 3300035119 Bacteria 1516
184 Ga0373955_0058185 3300035172 Bacteria 2126
185 Ga0373927_1089372 3300035695 Bacteria 527
186 Ga0373933_0049030 3300035724 Bacteria 2517
187 Ga0373937_0504452 3300036401 Bacteria 1149
188 Ga0373937_1318816 3300036401 Bacteria 670
189 Ga0436361_0319783 3300039447 Bacteria 14827
190 Ga0436361_0520379 3300039447 Unclassified 636
191 Ga0436361_0571183 3300039447 Bacteria 1603
192 Ga0436361_0713204 3300039447 Bacteria 601
193 Ga0436361_0969584 3300039447 Bacteria 809
194 Ga0451789_0011632 3300041443 Bacteria 715
195 Ga0451798_0769277 3300041458 Bacteria 618
196 Ga0451807_0914443 3300041486 Bacteria 700
197 Ga0451849_0427207 3300041505 Bacteria 684
198 Ga0451853_1816730 3300041512 Bacteria 947
199 Ga0439443_068347 3300042003 Bacteria 645
200 Ga0450914_034666 3300042118 Bacteria 621
201 Ga0450896_033508 3300042133 Bacteria 784
202 Ga0439435_0001129 3300042436 Bacteria 4765
203 Ga0453684_0312641 3300044712 Bacteria 1782
204 Ga0451576_1197703 3300045051 Bacteria 793
205 Ga0495592_0028103 3300046454 Bacteria 4261
206 Ga0495653_0203291 3300046463 Bacteria 1343
207 Ga0495664_0504530 3300046477 Bacteria 722
208 Ga0495608_0004050 3300046511 Bacteria 10517
209 Ga0495608_0346929 3300046511 Bacteria 914
210 Ga0495618_0710625 3300046514 Bacteria 590
211 Ga0495628_0014106 3300046516 Bacteria 6708
212 Ga0495652_0139684 3300046529 Bacteria 1906
213 Ga0495586_0708215 3300046535 Bacteria 581
214 Ga0495587_0247471 3300046536 Bacteria 1002
215 Ga0495598_0215986 3300046537 Bacteria 698
216 Ga0495645_0002145 3300046543 Bacteria 13389
217 Ga0495667_0060537 3300046559 Bacteria 2483
218 Ga0495634_0301787 3300046642 Bacteria 968
219 Ga0495635_0127019 3300046663 Bacteria 1739
220 Ga0495599_0017376 3300046678 Bacteria 4472
221 Ga0495623_0064294 3300046679 Bacteria 2296
222 Ga0495600_0048452 3300046809 Bacteria 2772
223 Ga0495680_0419809 3300047322 Bacteria 920
224 Ga0495677_0303647 3300047445 Bacteria 628
225 Ga0495684_0257873 3300047471 Bacteria 1266
226 Ga0495602_0300682 3300048088 Bacteria 1174
227 Ga0501037_0050567 3300049573 Bacteria 3041
228 Ga0501038_0344483 3300049574 Bacteria 1162
229 Ga0501039_0018353 3300049575 Bacteria 5369
230 Ga0501039_0435821 3300049575 Bacteria 1029
231 Ga0501039_0481613 3300049575 Bacteria 974
232 Ga0501040_0011322 3300049576 Bacteria 5838
233 Ga0501040_0914938 3300049576 Bacteria 635
234 Ga0501041_0075225 3300049577 Bacteria 2076
235 Ga0501041_0362486 3300049577 Bacteria 916
236 Ga0501042_0341808 3300049578 Bacteria 1082
237 Ga0501046_0199359 3300049580 Bacteria 1490
238 Ga0501046_0271689 3300049580 Bacteria 1243
239 Ga0501046_0752996 3300049580 Bacteria 684
240 Ga0501048_0608532 3300049582 Bacteria 784
241 Ga0501071_0175845 3300049587 Bacteria 1603
242 Ga0501072_0019197 3300049588 Bacteria 5281
243 Ga0501072_0272916 3300049588 Bacteria 1345
244 Ga0501073_0183156 3300049589 Bacteria 1450
245 Ga0501075_0392053 3300049591 Bacteria 1058
246 Ga0501075_0738829 3300049591 Bacteria 749
247 Ga0501076_0043588 3300049592 Bacteria 3536
248 Ga0501077_0426376 3300049593 Bacteria 849
249 Ga0501079_0258362 3300049741 Bacteria 1361
250 Ga0501079_0892331 3300049741 Bacteria 700
251 Ga0501079_1471030 3300049741 Bacteria 536
252 Ga0501080_0275412 3300049742 Bacteria 1531
253 Ga0501081_0017192 3300049743 Bacteria 4784
254 Ga0501081_0136005 3300049743 Bacteria 1759
255 Ga0501081_1287048 3300049743 Bacteria 554
256 Ga0501045_0150893 3300049824 Bacteria 1729
257 Ga0501045_0649411 3300049824 Bacteria 780
258 Ga0501045_1141454 3300049824 Bacteria 569
259 nmdc:mga0k408_22396_c1 3300050493 Bacteria 2266
260 nmdc:mga07m45_270865_c1 3300050496 Bacteria 988
261 nmdc:mga07m45_455013_c1 3300050496 Bacteria 742
262 nmdc:mga09592_1559054_c1 3300050508 Bacteria 536
263 nmdc:mga0qj67_27315_c1 3300050509 Bacteria 4422
264 nmdc:mga08y16_1840640_c1 3300050511 Bacteria 557
265 nmdc:mga08y16_431553_c1 3300050511 Bacteria 1346
266 Ga0495601_0006605 3300053077 Bacteria 6784
267 Ga0495595_0136886 3300053084 Bacteria 1200
268 Ga0500628_171908 3300053129 Bacteria 615
269 Ga0501084_0561715 3300054114 Bacteria 964
270 Ga0590075_171717 3300059424 Bacteria 573
271 Ga0501082_0040578 3300060353 Bacteria 4014
272 Ga0530510_0107040 3300061734 Bacteria 2046
273 Ga0530510_1223020 3300061734 Bacteria 576
274 Ga0070696_101801730
275 rootL2_10020475
276 Ga0070658_10126597
277 Ga0070658_11017174
278 Ga0070676_10216924
279 Ga0070690_100730754
280 Ga0070670_100876931
281 Ga0070670_102018172
282 Ga0070677_10370705
283 Ga0070677_10529973
284 Ga0068869_100102080
285 Ga0070660_100576285
286 Ga0070689_100019625
287 Ga0070669_100501518
288 Ga0070669_101155817
289 Ga0070675_100000315
290 Ga0070675_100036731
291 Ga0070671_100415500
292 Ga0070674_100019984
293 Ga0070674_100700754
294 Ga0070674_102096983
295 Ga0070673_100083886
296 Ga0070673_100121368
297 Ga0070673_100645137
298 Ga0070688_100162215
299 Ga0070688_101329689
300 Ga0070659_101215767
301 Ga0070667_101987295
302 Ga0070709_10938734
303 Ga0070714_101529822
304 Ga0070705_100048960
305 Ga0070705_100092912
306 Ga0070700_101604098
307 Ga0070694_100083073
308 Ga0070678_100307389
309 Ga0070678_100514783
310 Ga0070678_100806407
311 Ga0068867_100020082
312 Ga0070685_11403941
313 Ga0070698_100474207
314 Ga0070698_101305661
315 Ga0070698_102060492
316 Ga0070684_101940421
317 Ga0070672_100085271
318 Ga0070686_101552640
319 Ga0070695_100348012
320 Ga0070693_100148212
321 Ga0070693_100885325
322 Ga0070665_101744129
323 Ga0070704_101573920
324 Ga0068857_100102628
325 Ga0070702_100021987
326 Ga0070702_100111069
327 Ga0070702_100557510
328 Ga0070702_101541803
329 Ga0068859_100262738
330 Ga0068864_100806855
331 Ga0068861_100743074
332 Ga0068861_101165010
333 Ga0068861_101479496
334 Ga0068861_102491064
335 Ga0068862_102042407
336 Ga0081538_10027524
337 Ga0070717_11509442
338 Ga0075362_10530117
339 Ga0075366_10141574
340 Ga0097621_100451091
341 Ga0097621_101538774
342 Ga0075370_10276206
343 Ga0075370_10748296
344 Ga0068871_100773409
345 Ga0075430_100109859
346 Ga0068865_100829148
347 Ga0068865_101662088
348 Ga0097620_100262732
349 Ga0111539_10676070
350 Ga0105245_10614321
351 Ga0105245_12171589
352 Ga0105245_12741191
353 Ga0105245_12965009
354 Ga0105243_10335883
355 Ga0105243_11710017
356 Ga0105241_12301049
357 Ga0105242_10002383
358 Ga0105242_10304405
359 Ga0105242_10668023
360 Ga0105242_11140943
361 Ga0105242_12610758
362 Ga0105242_12778326
363 Ga0105248_10799106
364 Ga0105248_11182179
365 Ga0105238_10283676
366 Ga0157369_10580553
367 Ga0163162_10110573
368 Ga0163162_10283305
369 Ga0163162_11031094
370 Ga0163162_11038229
371 Ga0157372_11507848
372 Ga0157375_11720417
373 Ga0157375_12254563
374 Ga0163163_12050786
375 Ga0157380_10112677
376 Ga0157380_11463002
377 Ga0157377_10100870
378 Ga0157379_10306250
379 Ga0157379_10636397
380 Ga0157376_10077547
381 Ga0163161_10646951
382 Ga0213872_10001055
383 Ga0213872_10006948
384 Ga0207682_10373905
385 Ga0207642_10463117
386 Ga0207688_10437593
387 Ga0207699_10395763
388 Ga0207643_10055995
389 Ga0207705_10054124
390 Ga0207705_10605917
391 Ga0207660_10078813
392 Ga0207662_10133274
393 Ga0207662_10193018
394 Ga0207649_10611639
395 Ga0207681_10204823
396 Ga0207681_11035053
397 Ga0207694_10659497
398 Ga0207694_11528049
399 Ga0207650_10700277
400 Ga0207650_11616070
401 Ga0207659_10731293
402 Ga0207687_10352726
403 Ga0207687_10371918
404 Ga0207687_10665044
405 Ga0207690_10064757
406 Ga0207686_11804243
407 Ga0207686_11820113
408 Ga0207670_10115433
409 Ga0207670_10558662
410 Ga0207669_10396988
411 Ga0207669_10800012
412 Ga0207669_10863770
413 Ga0207669_11678859
414 Ga0207704_10774069
415 Ga0207704_11506774
416 Ga0207691_10024708
417 Ga0207691_10459215
418 Ga0207691_10770920
419 Ga0207711_11417309
420 Ga0207689_10109805
421 Ga0207679_10891000
422 Ga0207651_10299605
423 Ga0207651_10456438
424 Ga0207651_10740474
425 Ga0207658_11432595
426 Ga0207708_11981111
427 Ga0207648_10059054
428 Ga0207648_10916736
429 Ga0207676_10952900
430 Ga0207676_12367292
431 Ga0207675_100753058
432 Ga0207675_101163041
433 Ga0207683_10581953
434 Ga0207683_10626944
435 Ga0207683_10640659
436 Ga0207698_12485355
437 Ga0268266_10074286
438 Ga0268266_10940025
439 Ga0268265_11611418
440 Ga0307408_100250569
441 Ga0307408_101059053
442 Ga0307405_10469001
443 Ga0307405_11296878
444 Ga0307407_10422909
445 Ga0307412_10072565
446 Ga0307412_10513527
447 Ga0307412_11500660
448 Ga0307416_100519682
449 Ga0307416_102116244
450 Ga0307416_102961699
451 Ga0307411_11270915
452 Ga0307415_100531509
453 Ga0373929_0069071
454 Ga0373923_0262815
455 Ga0373954_0144376
456 Ga0373956_0078104
457 Ga0373955_0058185
458 Ga0373927_1089372
459 Ga0373933_0049030
460 Ga0373937_0504452
461 Ga0373937_1318816
462 Ga0436361_0319783
463 Ga0436361_0520379
464 Ga0436361_0571183
465 Ga0436361_0713204
466 Ga0436361_0969584
467 Ga0451789_0011632
468 Ga0451798_0769277
469 Ga0451807_0914443
470 Ga0451849_0427207
471 Ga0451853_1816730
472 Ga0439443_068347
473 Ga0450914_034666
474 Ga0450896_033508
475 Ga0439435_0001129
476 Ga0453684_0312641
477 Ga0451576_1197703
478 Ga0495592_0028103
479 Ga0495653_0203291
480 Ga0495664_0504530
481 Ga0495608_0004050
482 Ga0495608_0346929
483 Ga0495618_0710625
484 Ga0495628_0014106
485 Ga0495652_0139684
486 Ga0495586_0708215
487 Ga0495587_0247471
488 Ga0495598_0215986
489 Ga0495645_0002145
490 Ga0495667_0060537
491 Ga0495634_0301787
492 Ga0495635_0127019
493 Ga0495599_0017376
494 Ga0495623_0064294
495 Ga0495600_0048452
496 Ga0495680_0419809
497 Ga0495677_0303647
498 Ga0495684_0257873
499 Ga0495602_0300682
500 Ga0501037_0050567
501 Ga0501038_0344483
502 Ga0501039_0018353
503 Ga0501039_0435821
504 Ga0501039_0481613
505 Ga0501040_0011322
506 Ga0501040_0914938
507 Ga0501041_0075225
508 Ga0501041_0362486
509 Ga0501042_0341808
510 Ga0501046_0199359
511 Ga0501046_0271689
512 Ga0501046_0752996
513 Ga0501048_0608532
514 Ga0501071_0175845
515 Ga0501072_0019197
516 Ga0501072_0272916
517 Ga0501073_0183156
518 Ga0501075_0392053
519 Ga0501075_0738829
520 Ga0501076_0043588
521 Ga0501077_0426376
522 Ga0501079_0258362
523 Ga0501079_0892331
524 Ga0501079_1471030
525 Ga0501080_0275412
526 Ga0501081_0017192
527 Ga0501081_0136005
528 Ga0501081_1287048
529 Ga0501045_0150893
530 Ga0501045_0649411
531 Ga0501045_1141454
532 nmdc:mga0k408_22396_c1
533 nmdc:mga07m45_270865_c1
534 nmdc:mga07m45_455013_c1
535 nmdc:mga09592_1559054_c1
536 nmdc:mga0qj67_27315_c1
537 nmdc:mga08y16_1840640_c1
538 nmdc:mga08y16_431553_c1
539 Ga0495601_0006605
540 Ga0495595_0136886
541 Ga0500628_171908
542 Ga0501084_0561715
543 Ga0590075_171717
544 Ga0501082_0040578
545 Ga0530510_0107040
546 Ga0530510_1223020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03937

Sdh5

Flavinator of succinate dehydrogenase

22

94

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c12-assembly1.cif.gz_D sdha-sdhe complex 0.8798 5 84
6vax-assembly2.cif.gz_D crystal structure of human sdha-sdhaf2 assembly intermediate 0.8636 4 80
1puz-assembly1.cif.gz_A solution nmr structure of protein nma1147 from neisseria meningitidis. northeast structural genomics consortium target mr19 0.8498 3 79
6c12-assembly1.cif.gz_D sdha-sdhe complex 0.8149 5 84
1puz-assembly1.cif.gz_A solution nmr structure of protein nma1147 from neisseria meningitidis. northeast structural genomics consortium target mr19 0.7968 3 79
ID Description Score Start End Superfamily
6c12C00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Flavinator of succinate dehydrogenase 0.9111 5 79 1.10.150.250
af_Q54B20_51_135_1.10.150.250 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Flavinator of succinate dehydrogenase 0.8938 7 80 1.10.150.250
1puzA00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Flavinator of succinate dehydrogenase 0.8498 3 79 1.10.150.250
af_Q10440_46_131_1.10.150.250 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Flavinator of succinate dehydrogenase 0.8422 4 83 1.10.150.250
af_Q4V5I9_65_153_1.10.150.250 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Flavinator of succinate dehydrogenase 0.8312 7 85 1.10.150.250
ID Description Score Start End GO Terms
AF-A0A516SMR0-F1-model_v4 FAD assembly factor SdhE 0.9997 1 85 GO:0005737
AF-A0A2I6S789-F1-model_v4 FAD assembly factor SdhE 0.9879 7 79 GO:0005737
GO:0006105
AF-A0A6C1B273-F1-model_v4 FAD assembly factor SdhE 0.9817 8 82 GO:0005737
AF-A0A516SMR0-F1-model_v4 FAD assembly factor SdhE 0.9767 1 85 GO:0005737
AF-A0A1U9JJE7-F1-model_v4 FAD assembly factor SdhE 0.9758 3 79 GO:0005737

Map