F378881

General Info

Members Datasets Scaffolds Average Seq Length
273 180 272 303

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100049342|Ga0070708_1000493424
Length 338
Sequence MFFMLLWTLAEARGLVLYHSPQGSQVEHNTAFVFPGQGSQYAGMGRDVAEKYPAARRVFEEIDGALGFPLSKVCFEGPEEQLRLTAITQPAILAVSAAIHEVLEDLGATRRDLVAGHSLGEYSAIVSDGGLTPAEAAKIVHLRGKFMQEAVPVGTGAMAALIGPTVDEVRAICEEATRGEVVSVANINAPGQTVIAGTKAAVDRAIDIAKRRGVRRALPLPVSAPFHCALMKPAEEKLRPVLEQAPLKDLWIALVSNVDASPIGTATAVRNALVRQVVSPVRWVEGVQKMISMGVRHFVEVGPGNVLTGLIKRIDSSVQLTNVSDVKSIEAFAAVVKG

Samples

Sample ID Description Type Environment
1 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 1.83
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10036744 3300005327 Bacteria 3948
2 Ga0070676_10027616 3300005328 Bacteria 3219
3 Ga0070683_100000103 3300005329 Bacteria 55332
4 Ga0070670_100000067 3300005331 Bacteria 107051
5 Ga0070670_100116341 3300005331 Bacteria 2305
6 Ga0068869_100050040 3300005334 Bacteria 3028
7 Ga0068869_100125744 3300005334 Bacteria 1966
8 Ga0068869_100257512 3300005334 Unclassified 1396
9 Ga0070680_100027651 3300005336 Bacteria 4543
10 Ga0070682_100000010 3300005337 Bacteria 280957
11 Ga0068868_100000249 3300005338 Bacteria 36630
12 Ga0068868_100000558 3300005338 Bacteria 24973
13 Ga0070687_100230347 3300005343 Bacteria 1140
14 Ga0070692_10000105 3300005345 Bacteria 18944
15 Ga0070692_10028092 3300005345 Bacteria 2795
16 Ga0070669_100008511 3300005353 Bacteria 7324
17 Ga0070669_100057012 3300005353 Bacteria 2865
18 Ga0070675_100000024 3300005354 Bacteria 117191
19 Ga0070674_100016867 3300005356 Bacteria 4582
20 Ga0070659_100068118 3300005366 Bacteria 2823
21 Ga0070713_100017090 3300005436 Bacteria 5475
22 Ga0070701_10159622 3300005438 Bacteria 1305
23 Ga0070700_100000002 3300005441 Bacteria 261904
24 Ga0070700_100024081 3300005441 Bacteria 3570
25 Ga0070694_100008064 3300005444 Bacteria 6432
26 Ga0070694_100206758 3300005444 Unclassified 1466
27 Ga0070708_100049342 3300005445 Bacteria 3723
28 Ga0070708_100130265 3300005445 Bacteria 2328
29 Ga0070708_100355728 3300005445 Bacteria 1380
30 Ga0070663_100126136 3300005455 Bacteria 1939
31 Ga0070662_100028001 3300005457 Bacteria 3919
32 Ga0070662_100075871 3300005457 Bacteria 2490
33 Ga0068867_100358353 3300005459 Bacteria 1219
34 Ga0070706_100002630 3300005467 Bacteria 17990
35 Ga0070706_100008767 3300005467 Bacteria 9423
36 Ga0070706_100124290 3300005467 Bacteria 2405
37 Ga0070706_100291729 3300005467 Bacteria 1522
38 Ga0070707_100010141 3300005468 Bacteria 8770
39 Ga0070707_100120577 3300005468 Bacteria 2546
40 Ga0070707_100175439 3300005468 Bacteria 2089
41 Ga0070698_100000020 3300005471 Bacteria 106237
42 Ga0070699_100029308 3300005518 Bacteria 4745
43 Ga0070699_100377200 3300005518 Bacteria 1280
44 Ga0070684_100000272 3300005535 Bacteria 35847
45 Ga0070684_100196057 3300005535 Bacteria 1839
46 Ga0070697_100091559 3300005536 Bacteria 2515
47 Ga0070697_100103315 3300005536 Bacteria 2369
48 Ga0068853_100007729 3300005539 Bacteria 8622
49 Ga0070672_100000697 3300005543 Bacteria 19893
50 Ga0070672_100023292 3300005543 Bacteria 4562
51 Ga0070672_100052849 3300005543 Bacteria 3174
52 Ga0070686_100193161 3300005544 Bacteria 1454
53 Ga0070686_100346573 3300005544 Bacteria 1115
54 Ga0070696_100167966 3300005546 Bacteria 1620
55 Ga0070696_100331011 3300005546 Bacteria 1174
56 Ga0070665_100070939 3300005548 Bacteria 3490
57 Ga0070704_100239534 3300005549 Bacteria 1484
58 Ga0068855_100088436 3300005563 Bacteria 3578
59 Ga0068854_100012221 3300005578 Bacteria 5618
60 Ga0068854_100086591 3300005578 Bacteria 2323
61 Ga0070702_100120440 3300005615 Bacteria 1642
62 Ga0068864_100000008 3300005618 Bacteria 390035
63 Ga0068861_100021982 3300005719 Bacteria 4589
64 Ga0068861_100206164 3300005719 Bacteria 1653
65 Ga0068870_10015161 3300005840 Bacteria 3652
66 Ga0068863_100067516 3300005841 Bacteria 3382
67 Ga0068863_100112022 3300005841 Bacteria 2599
68 Ga0068858_100000518 3300005842 Bacteria 40503
69 Ga0068858_100084456 3300005842 Bacteria 2953
70 Ga0068860_100293780 3300005843 Bacteria 1590
71 Ga0068862_100007438 3300005844 Bacteria 9079
72 Ga0068862_100084638 3300005844 Bacteria 2755
73 Ga0070717_10000173 3300006028 Bacteria 48151
74 Ga0075365_10026713 3300006038 Bacteria 3667
75 Ga0075368_10010732 3300006042 Bacteria 3318
76 Ga0075363_100052617 3300006048 Bacteria 2174
77 Ga0070712_100045496 3300006175 Bacteria 3031
78 Ga0075428_100000766 3300006844 Bacteria 33418
79 Ga0075428_100233338 3300006844 Bacteria 1985
80 Ga0075430_100218070 3300006846 Bacteria 1583
81 Ga0075431_100308730 3300006847 Bacteria 1597
82 Ga0075433_10000886 3300006852 Bacteria 21055
83 Ga0075434_100000339 3300006871 Bacteria 33788
84 Ga0075434_100300752 3300006871 Bacteria 1625
85 Ga0075436_100004991 3300006914 Bacteria 9117
86 Ga0075435_100000206 3300007076 Bacteria 35805
87 Ga0075435_100470301 3300007076 Bacteria 1085
88 Ga0105240_10011838 3300009093 Bacteria 12115
89 Ga0111539_10000006 3300009094 Bacteria 463720
90 Ga0111539_10333594 3300009094 Bacteria 1765
91 Ga0105245_10000003 3300009098 Bacteria 488207
92 Ga0105245_10000284 3300009098 Bacteria 48293
93 Ga0105245_10079071 3300009098 Bacteria 3002
94 Ga0105245_10131807 3300009098 Bacteria 2345
95 Ga0114129_10007953 3300009147 Bacteria 15092
96 Ga0114129_10011524 3300009147 Bacteria 12591
97 Ga0114129_10094698 3300009147 Bacteria 4136
98 Ga0114129_10300799 3300009147 Bacteria 2138
99 Ga0114129_10390726 3300009147 Bacteria 1835
100 Ga0105242_10026423 3300009176 Bacteria 4602
101 Ga0105238_10000001 3300009551 Bacteria 2036163
102 Ga0105249_10028344 3300009553 Bacteria 5055
103 Ga0105239_10071439 3300010375 Bacteria 3813
104 Ga0157369_10000189 3300013105 Bacteria 85144
105 Ga0157374_10000037 3300013296 Bacteria 170359
106 Ga0157378_10000335 3300013297 Bacteria 46123
107 Ga0163162_10013189 3300013306 Bacteria 8071
108 Ga0163162_10027290 3300013306 Bacteria 5645
109 Ga0163162_10154630 3300013306 Bacteria 2413
110 Ga0157372_10037168 3300013307 Bacteria 5368
111 Ga0157375_10000009 3300013308 Bacteria 366440
112 Ga0157375_10000090 3300013308 Bacteria 91416
113 Ga0157375_10002134 3300013308 Bacteria 17082
114 Ga0157375_10059978 3300013308 Bacteria 3771
115 Ga0163163_10080524 3300014325 Bacteria 3257
116 Ga0157380_10001455 3300014326 Bacteria 15496
117 Ga0157380_10200818 3300014326 Bacteria 1769
118 Ga0157380_10387665 3300014326 Bacteria 1321
119 Ga0157377_10000008 3300014745 Bacteria 394748
120 Ga0157377_10000115 3300014745 Bacteria 54899
121 Ga0157379_10061525 3300014968 Bacteria 3357
122 Ga0157376_10000006 3300014969 Bacteria 368549
123 Ga0213873_10000004 3300021358 Bacteria 774374
124 Ga0213873_10002838 3300021358 Bacteria 3051
125 Ga0213876_10000007 3300021384 Bacteria 670340
126 Ga0213876_10000188 3300021384 Bacteria 64172
127 Ga0213876_10001441 3300021384 Bacteria 14794
128 Ga0213876_10012783 3300021384 Bacteria 4463
129 Ga0213876_10038058 3300021384 Bacteria 2537
130 Ga0213875_10033853 3300021388 Bacteria 2414
131 Ga0209759_1013846 3300025256 Bacteria 2163
132 Ga0207682_10017504 3300025893 Bacteria 2799
133 Ga0207688_10013796 3300025901 Bacteria 4392
134 Ga0207645_10005681 3300025907 Bacteria 9012
135 Ga0207643_10008071 3300025908 Bacteria 5646
136 Ga0207705_10028399 3300025909 Bacteria 3988
137 Ga0207684_10011281 3300025910 Bacteria 7825
138 Ga0207684_10027628 3300025910 Bacteria 4832
139 Ga0207695_10028893 3300025913 Bacteria 6137
140 Ga0207660_10043321 3300025917 Bacteria 3162
141 Ga0207662_10127401 3300025918 Bacteria 1602
142 Ga0207657_10006508 3300025919 Bacteria 12104
143 Ga0207649_10108826 3300025920 Bacteria 1848
144 Ga0207646_10014498 3300025922 Bacteria 7482
145 Ga0207681_10037736 3300025923 Bacteria 3196
146 Ga0207681_10089913 3300025923 Bacteria 2190
147 Ga0207694_10000001 3300025924 Bacteria 4078485
148 Ga0207650_10000067 3300025925 Bacteria 140196
149 Ga0207650_10030839 3300025925 Bacteria 3867
150 Ga0207659_10000029 3300025926 Bacteria 129487
151 Ga0207687_10000002 3300025927 Bacteria 975489
152 Ga0207687_10002030 3300025927 Bacteria 13890
153 Ga0207687_10031920 3300025927 Bacteria 3563
154 Ga0207700_10012662 3300025928 Bacteria 5451
155 Ga0207706_10005268 3300025933 Bacteria 12060
156 Ga0207686_10253260 3300025934 Bacteria 1287
157 Ga0207670_10193041 3300025936 Bacteria 1542
158 Ga0207665_10059852 3300025939 Bacteria 2578
159 Ga0207691_10000312 3300025940 Bacteria 48438
160 Ga0207691_10000507 3300025940 Bacteria 38790
161 Ga0207691_10128062 3300025940 Bacteria 2245
162 Ga0207689_10004202 3300025942 Bacteria 13095
163 Ga0207689_10013673 3300025942 Bacteria 6921
164 Ga0207689_10025127 3300025942 Bacteria 4993
165 Ga0207661_10000007 3300025944 Bacteria 471636
166 Ga0207640_10000706 3300025981 Bacteria 19362
167 Ga0207640_10041278 3300025981 Bacteria 2933
168 Ga0207677_10000008 3300026023 Bacteria 266293
169 Ga0207677_10000133 3300026023 Bacteria 61065
170 Ga0207703_10000164 3300026035 Bacteria 76934
171 Ga0207703_10188122 3300026035 Bacteria 1826
172 Ga0207639_10000020 3300026041 Bacteria 236698
173 Ga0207678_10049819 3300026067 Bacteria 3620
174 Ga0207708_10000137 3300026075 Bacteria 57745
175 Ga0207648_10137596 3300026089 Bacteria 2152
176 Ga0207648_10277956 3300026089 Bacteria 1497
177 Ga0207648_10335689 3300026089 Bacteria 1360
178 Ga0207676_10000070 3300026095 Bacteria 104103
179 Ga0207676_10045962 3300026095 Bacteria 3376
180 Ga0207675_100010379 3300026118 Bacteria 8727
181 Ga0207675_100014137 3300026118 Bacteria 7443
182 Ga0207683_10025711 3300026121 Bacteria 5078
183 Ga0207428_10000007 3300027907 Bacteria 463715
184 Ga0268265_10015211 3300028380 Bacteria 5261
185 Ga0268264_10053355 3300028381 Bacteria 3372
186 Ga0268264_10138983 3300028381 Bacteria 2164
187 Ga0265319_1007364 3300028563 Bacteria 4959
188 Ga0265334_10005672 3300028573 Bacteria 5448
189 Ga0265318_10001570 3300028577 Bacteria 13264
190 Ga0265318_10040085 3300028577 Bacteria 1785
191 Ga0265338_10004489 3300028800 Bacteria 18814
192 Ga0307511_10005518 3300030521 Bacteria 12851
193 Ga0265330_10000022 3300031235 Bacteria 154198
194 Ga0265332_10000001 3300031238 Bacteria 863783
195 Ga0265325_10005305 3300031241 Bacteria 7985
196 Ga0265340_10008358 3300031247 Bacteria 5592
197 Ga0265339_10034411 3300031249 Bacteria 2847
198 Ga0307513_10222362 3300031456 Bacteria 1708
199 Ga0265314_10000013 3300031711 Bacteria 403405
200 Ga0316576_10000041 3300031727 Bacteria 38424
201 Ga0316578_10016055 3300031728 Bacteria 4044
202 Ga0307516_10008493 3300031730 Bacteria 11609
203 Ga0373934_0047576 3300035086 Bacteria 1697
204 Ga0373943_0005723 3300035170 Bacteria 5578
205 Ga0316574_0043345 3300035398 Bacteria 2780
206 Ga0373947_0089685 3300035725 Bacteria 1915
207 Ga0373937_0196069 3300036401 Bacteria 1898
208 Ga0316584_0051260 3300036712 Bacteria 3087
209 Ga0316584_0067850 3300036712 Bacteria 2673
210 Ga0373925_0026493 3300037068 Bacteria 4242
211 Ga0395899_0056134 3300037312 Bacteria 2911
212 Ga0395900_0324391 3300037418 Bacteria 1519
213 Ga0395898_0108565 3300037466 Bacteria 2661
214 Ga0395905_0180632 3300037471 Bacteria 1981
215 Ga0436364_0321269 3300037853 Bacteria 1524
216 Ga0436364_1377383 3300037853 Bacteria 2635
217 Ga0436364_1506321 3300037853 Bacteria 6256
218 Ga0395901_0165846 3300038443 Bacteria 2319
219 Ga0395901_0191000 3300038443 Bacteria 2148
220 Ga0395901_0194770 3300038443 Bacteria 2125
221 Ga0436365_0073603 3300039437 Bacteria 250590
222 Ga0436365_0506999 3300039437 Bacteria 18404
223 Ga0436365_0637274 3300039437 Bacteria 17734
224 Ga0436365_1688836 3300039437 Bacteria 2240
225 Ga0436365_1929564 3300039437 Bacteria 3931
226 Ga0436362_0290430 3300039453 Bacteria 772596
227 Ga0436362_1187303 3300039453 Bacteria 11856
228 Ga0439453_0021541 3300041408 Bacteria 1163
229 Ga0451853_0870457 3300041512 Bacteria 1839
230 Ga0439449_0000371 3300042007 Bacteria 16522
231 Ga0439446_0041274 3300042156 Bacteria 1360
232 Ga0439464_0018270 3300042439 Bacteria 1907
233 Ga0439460_0020042 3300042461 Bacteria 1816
234 Ga0439460_0045642 3300042461 Bacteria 1300
235 Ga0451577_0016922 3300042876 Bacteria 6745
236 Ga0451577_0057152 3300042876 Bacteria 3478
237 Ga0453683_0039576 3300044673 Bacteria 2963
238 Ga0453684_0012886 3300044712 Bacteria 13697
239 Ga0453684_0108627 3300044712 Bacteria 3376
240 Ga0453684_0387911 3300044712 Bacteria 1567
241 Ga0495617_059956 3300046452 Bacteria 1260
242 Ga0495620_0001137 3300046515 Bacteria 16250
243 Ga0495586_0030883 3300046535 Bacteria 2868
244 Ga0495679_008002 3300047446 Bacteria 4344
245 Ga0496102_0206527 3300048905 Bacteria 1852
246 Ga0496102_0320268 3300048905 Bacteria 1461
247 Ga0496107_0170293 3300048910 Bacteria 1616
248 Ga0496111_0152233 3300048914 Bacteria 1716
249 Ga0496112_0341430 3300048915 Bacteria 1441
250 Ga0501038_0180069 3300049574 Bacteria 1706
251 Ga0501070_0000101 3300049586 Bacteria 74887
252 Ga0501073_0001439 3300049589 Bacteria 17590
253 Ga0501073_0001544 3300049589 Bacteria 17056
254 Ga0501073_0012470 3300049589 Bacteria 6202
255 Ga0501074_0087706 3300049590 Bacteria 2228
256 Ga0501074_0179289 3300049590 Bacteria 1511
257 Ga0501080_0001051 3300049742 Bacteria 22721
258 Ga0501080_0001683 3300049742 Bacteria 18846
259 Ga0501083_0013759 3300049744 Bacteria 5657
260 Ga0501083_0071713 3300049744 Unclassified 2303
261 nmdc:mga05p37_326567_c1 3300050507 Unclassified 1814
262 nmdc:mga05p37_349555_c1 3300050507 Bacteria 1741
263 nmdc:mga06r32_2025_c1 3300050510 Bacteria 18124
264 nmdc:mga08y16_11_c1 3300050511 Bacteria 463712
265 nmdc:mga08y16_351511_c1 3300050511 Bacteria 1514
266 nmdc:mga0n895_2902_c1 3300050512 Bacteria 13605
267 nmdc:mga0rr50_1256_c1 3300050513 Bacteria 13795
268 nmdc:mga0rr50_3204_c1 3300050513 Bacteria 9365
269 nmdc:mga08x19_1832_c1 3300050514 Bacteria 13043
270 nmdc:mga0a205_3081_c1 3300050515 Bacteria 14800
271 Ga0495655_0000046 3300053083 Bacteria 25139
272 Ga0501082_0183424 3300060353 Bacteria 1820

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0179289 Ga0501074_0179289_36_923 243
2 3300031728 Ga0316578_10016055 Ga0316578_100160555 247
3 3300050513 nmdc:mga0rr50_3204_c1 nmdc:mga0rr50_3204_c1_8490_9344 247
4 3300005467 Ga0070706_100002630 Ga0070706_1000026308 248
5 3300005471 Ga0070698_100000020 Ga0070698_10000002020 248
6 3300005536 Ga0070697_100103315 Ga0070697_1001033152 248
7 3300025910 Ga0207684_10027628 Ga0207684_100276283 248
8 3300005334 Ga0068869_100050040 Ga0068869_1000500402 250
9 3300005345 Ga0070692_10000105 Ga0070692_1000010517 250
10 3300005353 Ga0070669_100057012 Ga0070669_1000570122 250
11 3300005444 Ga0070694_100008064 Ga0070694_1000080645 250
12 3300005455 Ga0070663_100126136 Ga0070663_1001261361 250
13 3300005543 Ga0070672_100052849 Ga0070672_1000528493 250
14 3300005549 Ga0070704_100239534 Ga0070704_1002395342 250
15 3300005578 Ga0068854_100086591 Ga0068854_1000865912 250
16 3300005719 Ga0068861_100021982 Ga0068861_1000219822 250
17 3300005841 Ga0068863_100112022 Ga0068863_1001120223 250
18 3300005844 Ga0068862_100084638 Ga0068862_1000846382 250
19 3300009553 Ga0105249_10028344 Ga0105249_100283443 250
20 3300013306 Ga0163162_10013189 Ga0163162_100131899 250
21 3300014326 Ga0157380_10387665 Ga0157380_103876652 250
22 3300014968 Ga0157379_10061525 Ga0157379_100615252 250
23 3300025940 Ga0207691_10128062 Ga0207691_101280622 250
24 3300025942 Ga0207689_10004202 Ga0207689_100042026 250
25 3300026067 Ga0207678_10049819 Ga0207678_100498195 250
26 3300026118 Ga0207675_100010379 Ga0207675_1000103798 250
27 3300028381 Ga0268264_10053355 Ga0268264_100533552 250
28 3300044712 Ga0453684_0108627 Ga0453684_0108627_767_1630 250
29 3300048905 Ga0496102_0206527 Ga0496102_0206527_447_1310 250
30 3300048910 Ga0496107_0170293 Ga0496107_0170293_665_1528 250
31 3300048914 Ga0496111_0152233 Ga0496111_0152233_308_1171 250
32 3300025919 Ga0207657_10006508 Ga0207657_100065085 251
33 3300005563 Ga0068855_100088436 Ga0068855_1000884365 254
34 3300031456 Ga0307513_10222362 Ga0307513_102223622 257
35 3300046452 Ga0495617_059956 Ga0495617_059956_120_998 257
36 3300049586 Ga0501070_0000101 Ga0501070_0000101_51944_52882 258
37 3300049589 Ga0501073_0012470 Ga0501073_0012470_147_1085 258
38 3300049742 Ga0501080_0001683 Ga0501080_0001683_123_1061 258
39 3300049744 Ga0501083_0013759 Ga0501083_0013759_4599_5537 258
40 3300060353 Ga0501082_0183424 Ga0501082_0183424_691_1629 258
41 3300031249 Ga0265339_10034411 Ga0265339_100344112 259
42 3300013307 Ga0157372_10037168 Ga0157372_100371681 260
43 3300037853 Ga0436364_0321269 Ga0436364_0321269_617_1498 262
44 3300042461 Ga0439460_0045642 Ga0439460_0045642_329_1219 262
45 3300005328 Ga0070676_10027616 Ga0070676_100276163 263
46 3300005331 Ga0070670_100116341 Ga0070670_1001163412 263
47 3300005334 Ga0068869_100125744 Ga0068869_1001257442 263
48 3300005353 Ga0070669_100008511 Ga0070669_1000085119 263
49 3300005356 Ga0070674_100016867 Ga0070674_1000168672 263
50 3300005366 Ga0070659_100068118 Ga0070659_1000681183 263
51 3300005441 Ga0070700_100024081 Ga0070700_1000240812 263
52 3300005444 Ga0070694_100206758 Ga0070694_1002067582 263
53 3300005457 Ga0070662_100028001 Ga0070662_1000280013 263
54 3300005457 Ga0070662_100075871 Ga0070662_1000758712 263
55 3300005468 Ga0070707_100175439 Ga0070707_1001754392 263
56 3300005543 Ga0070672_100023292 Ga0070672_1000232926 263
57 3300005615 Ga0070702_100120440 Ga0070702_1001204402 263
58 3300005719 Ga0068861_100206164 Ga0068861_1002061642 263
59 3300005842 Ga0068858_100084456 Ga0068858_1000844563 263
60 3300005843 Ga0068860_100293780 Ga0068860_1002937802 263
61 3300005844 Ga0068862_100007438 Ga0068862_1000074389 263
62 3300013306 Ga0163162_10154630 Ga0163162_101546302 263
63 3300013308 Ga0157375_10059978 Ga0157375_100599784 263
64 3300014325 Ga0163163_10080524 Ga0163163_100805243 263
65 3300025893 Ga0207682_10017504 Ga0207682_100175043 263
66 3300025901 Ga0207688_10013796 Ga0207688_100137963 263
67 3300025907 Ga0207645_10005681 Ga0207645_100056813 263
68 3300025908 Ga0207643_10008071 Ga0207643_100080713 263
69 3300025920 Ga0207649_10108826 Ga0207649_101088262 263
70 3300025923 Ga0207681_10037736 Ga0207681_100377363 263
71 3300025923 Ga0207681_10089913 Ga0207681_100899132 263
72 3300025933 Ga0207706_10005268 Ga0207706_1000526811 263
73 3300025940 Ga0207691_10000312 Ga0207691_1000031240 263
74 3300025942 Ga0207689_10025127 Ga0207689_100251272 263
75 3300026035 Ga0207703_10188122 Ga0207703_101881222 263
76 3300026089 Ga0207648_10137596 Ga0207648_101375962 263
77 3300026095 Ga0207676_10045962 Ga0207676_100459622 263
78 3300026118 Ga0207675_100014137 Ga0207675_1000141374 263
79 3300026121 Ga0207683_10025711 Ga0207683_100257112 263
80 3300028380 Ga0268265_10015211 Ga0268265_100152113 263
81 3300028381 Ga0268264_10138983 Ga0268264_101389832 263
82 3300028577 Ga0265318_10040085 Ga0265318_100400852 263
83 3300031247 Ga0265340_10008358 Ga0265340_100083584 263
84 3300035086 Ga0373934_0047576 Ga0373934_0047576_138_1019 263
85 3300035725 Ga0373947_0089685 Ga0373947_0089685_492_1373 263
86 3300044673 Ga0453683_0039576 Ga0453683_0039576_217_1104 263
87 3300050510 nmdc:mga06r32_2025_c1 nmdc:mga06r32_2025_c1_16872_17759 263
88 3300006852 Ga0075433_10000886 Ga0075433_1000088610 264
89 3300006871 Ga0075434_100000339 Ga0075434_10000033929 264
90 3300009147 Ga0114129_10007953 Ga0114129_1000795311 264
91 3300036712 Ga0316584_0051260 Ga0316584_0051260_2125_3042 264
92 3300050512 nmdc:mga0n895_2902_c1 nmdc:mga0n895_2902_c1_880_1785 264
93 3300050515 nmdc:mga0a205_3081_c1 nmdc:mga0a205_3081_c1_2662_3567 264
94 3300005841 Ga0068863_100067516 Ga0068863_1000675162 265
95 3300046535 Ga0495586_0030883 Ga0495586_0030883_367_1311 265
96 3300025256 Ga0209759_1013846 Ga0209759_10138462 267
97 3300005548 Ga0070665_100070939 Ga0070665_1000709392 269
98 3300037853 Ga0436364_1377383 Ga0436364_1377383_1662_2600 269
99 3300006175 Ga0070712_100045496 Ga0070712_1000454962 270
100 3300006844 Ga0075428_100000766 Ga0075428_10000076621 270
101 3300006871 Ga0075434_100300752 Ga0075434_1003007522 273
102 3300041512 Ga0451853_0870457 Ga0451853_0870457_839_1768 273
103 3300049590 Ga0501074_0087706 Ga0501074_0087706_990_1922 273
104 3300009094 Ga0111539_10000006 Ga0111539_10000006199 274
105 3300027907 Ga0207428_10000007 Ga0207428_10000007198 274
106 3300050511 nmdc:mga08y16_11_c1 nmdc:mga08y16_11_c1_209992_210927 274
107 3300037312 Ga0395899_0056134 Ga0395899_0056134_1451_2380 275
108 3300037418 Ga0395900_0324391 Ga0395900_0324391_279_1208 275
109 3300037471 Ga0395905_0180632 Ga0395905_0180632_876_1805 275
110 3300038443 Ga0395901_0165846 Ga0395901_0165846_542_1471 275
111 3300038443 Ga0395901_0194770 Ga0395901_0194770_247_1176 275
112 iso_pu_bacteria 2916971899 2916974609 275
113 3300005445 Ga0070708_100130265 Ga0070708_1001302652 276
114 3300005467 Ga0070706_100291729 Ga0070706_1002917291 276
115 3300005546 Ga0070696_100167966 Ga0070696_1001679662 276
116 3300006847 Ga0075431_100308730 Ga0075431_1003087301 276
117 3300006914 Ga0075436_100004991 Ga0075436_1000049918 276
118 3300007076 Ga0075435_100000206 Ga0075435_1000002063 276
119 3300009147 Ga0114129_10094698 Ga0114129_100946982 276
120 3300014745 Ga0157377_10000115 Ga0157377_1000011528 276
121 3300021388 Ga0213875_10033853 Ga0213875_100338531 276
122 3300025936 Ga0207670_10193041 Ga0207670_101930412 276
123 3300037466 Ga0395898_0108565 Ga0395898_0108565_434_1375 276
124 3300037853 Ga0436364_1506321 Ga0436364_1506321_415_1353 276
125 3300038443 Ga0395901_0191000 Ga0395901_0191000_13_945 276
126 3300041408 Ga0439453_0021541 Ga0439453_0021541_151_1101 276
127 3300048905 Ga0496102_0320268 Ga0496102_0320268_344_1300 276
128 3300050513 nmdc:mga0rr50_1256_c1 nmdc:mga0rr50_1256_c1_9069_9998 276
129 3300050514 nmdc:mga08x19_1832_c1 nmdc:mga08x19_1832_c1_6144_7073 276
130 3300053083 Ga0495655_0000046 Ga0495655_0000046_17554_18483 276
131 3300005436 Ga0070713_100017090 Ga0070713_1000170903 277
132 3300006028 Ga0070717_10000173 Ga0070717_1000017347 277
133 3300009147 Ga0114129_10300799 Ga0114129_103007993 277
134 3300014326 Ga0157380_10200818 Ga0157380_102008182 277
135 3300025928 Ga0207700_10012662 Ga0207700_100126626 277
136 3300042439 Ga0439464_0018270 Ga0439464_0018270_588_1526 277
137 3300042461 Ga0439460_0020042 Ga0439460_0020042_846_1784 277
138 3300046515 Ga0495620_0001137 Ga0495620_0001137_10366_11304 277
139 3300005329 Ga0070683_100000103 Ga0070683_10000010332 278
140 3300005343 Ga0070687_100230347 Ga0070687_1002303471 278
141 3300005535 Ga0070684_100000272 Ga0070684_10000027217 278
142 3300005544 Ga0070686_100346573 Ga0070686_1003465731 278
143 3300005578 Ga0068854_100012221 Ga0068854_1000122213 278
144 3300006038 Ga0075365_10026713 Ga0075365_100267133 278
145 3300006042 Ga0075368_10010732 Ga0075368_100107322 278
146 3300006048 Ga0075363_100052617 Ga0075363_1000526173 278
147 3300009094 Ga0111539_10333594 Ga0111539_103335942 278
148 3300009098 Ga0105245_10000003 Ga0105245_10000003211 278
149 3300013308 Ga0157375_10002134 Ga0157375_100021342 278
150 3300014969 Ga0157376_10000006 Ga0157376_10000006230 278
151 3300021358 Ga0213873_10000004 Ga0213873_1000000496 278
152 3300021384 Ga0213876_10000007 Ga0213876_1000000796 278
153 3300021384 Ga0213876_10038058 Ga0213876_100380583 278
154 3300025918 Ga0207662_10127401 Ga0207662_101274012 278
155 3300025927 Ga0207687_10000002 Ga0207687_10000002209 278
156 3300025944 Ga0207661_10000007 Ga0207661_10000007105 278
157 3300025981 Ga0207640_10000706 Ga0207640_1000070612 278
158 3300028563 Ga0265319_1007364 Ga0265319_10073642 278
159 3300028573 Ga0265334_10005672 Ga0265334_100056722 278
160 3300028577 Ga0265318_10001570 Ga0265318_1000157014 278
161 3300028800 Ga0265338_10004489 Ga0265338_100044898 278
162 3300031235 Ga0265330_10000022 Ga0265330_1000002298 278
163 3300031238 Ga0265332_10000001 Ga0265332_10000001607 278
164 3300031241 Ga0265325_10005305 Ga0265325_100053054 278
165 3300031711 Ga0265314_10000013 Ga0265314_10000013210 278
166 3300031730 Ga0307516_10008493 Ga0307516_1000849311 278
167 3300037068 Ga0373925_0026493 Ga0373925_0026493_882_1829 278
168 3300039437 Ga0436365_0073603 Ga0436365_0073603_19193_20122 278
169 3300039437 Ga0436365_1688836 Ga0436365_1688836_414_1343 278
170 3300039453 Ga0436362_0290430 Ga0436362_0290430_662578_663507 278
171 3300042007 Ga0439449_0000371 Ga0439449_0000371_7241_8191 278
172 3300042876 Ga0451577_0057152 Ga0451577_0057152_1151_2086 278
173 3300044712 Ga0453684_0012886 Ga0453684_0012886_1113_2048 278
174 3300044712 Ga0453684_0387911 Ga0453684_0387911_580_1521 278
175 3300049574 Ga0501038_0180069 Ga0501038_0180069_736_1695 278
176 3300049744 Ga0501083_0071713 Ga0501083_0071713_1075_2031 278
177 3300050511 nmdc:mga08y16_351511_c1 nmdc:mga08y16_351511_c1_204_1139 278
178 3300005336 Ga0070680_100027651 Ga0070680_1000276513 279
179 3300005354 Ga0070675_100000024 Ga0070675_10000002442 279
180 3300005518 Ga0070699_100377200 Ga0070699_1003772001 279
181 3300009147 Ga0114129_10390726 Ga0114129_103907262 279
182 3300025917 Ga0207660_10043321 Ga0207660_100433213 279
183 3300025926 Ga0207659_10000029 Ga0207659_1000002952 279
184 3300031727 Ga0316576_10000041 Ga0316576_1000004118 279
185 3300036712 Ga0316584_0067850 Ga0316584_0067850_376_1317 279
186 3300042156 Ga0439446_0041274 Ga0439446_0041274_165_1118 279
187 3300050507 nmdc:mga05p37_349555_c1 nmdc:mga05p37_349555_c1_609_1541 279
188 3300005337 Ga0070682_100000010 Ga0070682_10000001071 280
189 3300005441 Ga0070700_100000002 Ga0070700_100000002197 280
190 3300005445 Ga0070708_100355728 Ga0070708_1003557282 280
191 3300005459 Ga0068867_100358353 Ga0068867_1003583531 280
192 3300005546 Ga0070696_100331011 Ga0070696_1003310111 280
193 3300006844 Ga0075428_100233338 Ga0075428_1002333382 280
194 3300009176 Ga0105242_10026423 Ga0105242_100264232 280
195 3300025939 Ga0207665_10059852 Ga0207665_100598522 280
196 3300026075 Ga0207708_10000137 Ga0207708_1000013733 280
197 3300026089 Ga0207648_10277956 Ga0207648_102779562 280
198 3300035398 Ga0316574_0043345 Ga0316574_0043345_686_1636 280
199 3300042876 Ga0451577_0016922 Ga0451577_0016922_702_1637 280
200 3300047446 Ga0495679_008002 Ga0495679_008002_2269_3207 280
201 3300005327 Ga0070658_10036744 Ga0070658_100367444 281
202 3300005331 Ga0070670_100000067 Ga0070670_10000006720 281
203 3300005334 Ga0068869_100257512 Ga0068869_1002575121 281
204 3300005338 Ga0068868_100000249 Ga0068868_10000024922 281
205 3300005338 Ga0068868_100000558 Ga0068868_1000005588 281
206 3300005345 Ga0070692_10028092 Ga0070692_100280924 281
207 3300005438 Ga0070701_10159622 Ga0070701_101596222 281
208 3300005445 Ga0070708_100049342 Ga0070708_1000493424 281
209 3300005467 Ga0070706_100008767 Ga0070706_10000876712 281
210 3300005467 Ga0070706_100124290 Ga0070706_1001242902 281
211 3300005468 Ga0070707_100010141 Ga0070707_1000101412 281
212 3300005468 Ga0070707_100120577 Ga0070707_1001205773 281
213 3300005518 Ga0070699_100029308 Ga0070699_1000293083 281
214 3300005535 Ga0070684_100196057 Ga0070684_1001960572 281
215 3300005536 Ga0070697_100091559 Ga0070697_1000915593 281
216 3300005539 Ga0068853_100007729 Ga0068853_1000077298 281
217 3300005543 Ga0070672_100000697 Ga0070672_10000069718 281
218 3300005544 Ga0070686_100193161 Ga0070686_1001931612 281
219 3300005618 Ga0068864_100000008 Ga0068864_100000008308 281
220 3300005840 Ga0068870_10015161 Ga0068870_100151614 281
221 3300005842 Ga0068858_100000518 Ga0068858_10000051816 281
222 3300006846 Ga0075430_100218070 Ga0075430_1002180701 281
223 3300007076 Ga0075435_100470301 Ga0075435_1004703011 281
224 3300009093 Ga0105240_10011838 Ga0105240_100118386 281
225 3300009098 Ga0105245_10000284 Ga0105245_100002844 281
226 3300009098 Ga0105245_10079071 Ga0105245_100790713 281
227 3300009098 Ga0105245_10131807 Ga0105245_101318072 281
228 3300009147 Ga0114129_10011524 Ga0114129_1001152416 281
229 3300009551 Ga0105238_10000001 Ga0105238_100000011747 281
230 3300010375 Ga0105239_10071439 Ga0105239_100714393 281
231 3300013105 Ga0157369_10000189 Ga0157369_1000018964 281
232 3300013296 Ga0157374_10000037 Ga0157374_1000003745 281
233 3300013297 Ga0157378_10000335 Ga0157378_1000033546 281
234 3300013306 Ga0163162_10027290 Ga0163162_100272908 281
235 3300013308 Ga0157375_10000009 Ga0157375_10000009207 281
236 3300013308 Ga0157375_10000090 Ga0157375_1000009045 281
237 3300014326 Ga0157380_10001455 Ga0157380_1000145510 281
238 3300014745 Ga0157377_10000008 Ga0157377_1000000844 281
239 3300021358 Ga0213873_10002838 Ga0213873_100028382 281
240 3300021384 Ga0213876_10000188 Ga0213876_100001885 281
241 3300021384 Ga0213876_10001441 Ga0213876_1000144116 281
242 3300021384 Ga0213876_10012783 Ga0213876_100127833 281
243 3300025909 Ga0207705_10028399 Ga0207705_100283994 281
244 3300025910 Ga0207684_10011281 Ga0207684_1001128110 281
245 3300025913 Ga0207695_10028893 Ga0207695_100288934 281
246 3300025922 Ga0207646_10014498 Ga0207646_100144985 281
247 3300025924 Ga0207694_10000001 Ga0207694_100000012779 281
248 3300025925 Ga0207650_10000067 Ga0207650_1000006733 281
249 3300025925 Ga0207650_10030839 Ga0207650_100308392 281
250 3300025927 Ga0207687_10002030 Ga0207687_100020308 281
251 3300025927 Ga0207687_10031920 Ga0207687_100319202 281
252 3300025934 Ga0207686_10253260 Ga0207686_102532601 281
253 3300025940 Ga0207691_10000507 Ga0207691_1000050737 281
254 3300025942 Ga0207689_10013673 Ga0207689_100136737 281
255 3300025981 Ga0207640_10041278 Ga0207640_100412782 281
256 3300026023 Ga0207677_10000008 Ga0207677_1000000850 281
257 3300026023 Ga0207677_10000133 Ga0207677_1000013337 281
258 3300026035 Ga0207703_10000164 Ga0207703_1000016440 281
259 3300026041 Ga0207639_10000020 Ga0207639_1000002023 281
260 3300026089 Ga0207648_10335689 Ga0207648_103356892 281
261 3300026095 Ga0207676_10000070 Ga0207676_1000007015 281
262 3300030521 Ga0307511_10005518 Ga0307511_100055184 281
263 3300035170 Ga0373943_0005723 Ga0373943_0005723_1857_2801 281
264 3300036401 Ga0373937_0196069 Ga0373937_0196069_90_1046 281
265 3300039437 Ga0436365_0506999 Ga0436365_0506999_10970_11911 281
266 3300039437 Ga0436365_0637274 Ga0436365_0637274_3448_4386 281
267 3300039437 Ga0436365_1929564 Ga0436365_1929564_809_1765 281
268 3300039453 Ga0436362_1187303 Ga0436362_1187303_7525_8463 281
269 3300048915 Ga0496112_0341430 Ga0496112_0341430_276_1232 281
270 3300049589 Ga0501073_0001439 Ga0501073_0001439_9920_10912 281
271 3300049589 Ga0501073_0001544 Ga0501073_0001544_742_1683 281
272 3300049742 Ga0501080_0001051 Ga0501080_0001051_4792_5733 281
273 3300050507 nmdc:mga05p37_326567_c1 nmdc:mga05p37_326567_c1_763_1704 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

31

333

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjv-assembly1.cif.gz_B 1.7 angstrom resolution crystal structure of an acyl carrier protein s-malonyltransferase from vibrio cholerae o1 biovar eltor str. n16961 0.9566 4 275
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.9485 4 275
3qat-assembly1.cif.gz_A crystal structure of acyl-carrier-protein-s-malonyltransferase from bartonella henselae 0.9458 4 280
6smd-assembly2.cif.gz_C plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase 0.9439 4 279
3h0p-assembly1.cif.gz_A 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. 0.9391 4 277
ID Description Score Start End Superfamily
2cuyB01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9771 5 279 3.40.366.10
2g1hA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9718 4 278 3.40.366.10
3im9A01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9701 4 276 3.40.366.10
4rr5A01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9665 4 275 3.40.366.10
2g1hA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9637 4 278 3.40.366.10
ID Description Score Start End GO Terms
AF-A0A3D0ND55-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase 0.969 168 268 GO:0016740
AF-A0A3C0LZ96-F1-model_v4 deleted 0.9623 4 114
AF-A0A382XRN8-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9613 4 127 GO:0004314
GO:0006633
AF-A0A4U3BMW2-F1-model_v4 deleted 0.9609 181 281
AF-A0A377XQH9-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9601 4 118 GO:0004314
GO:0005829
GO:0006633

Feature Viewer

pLDDT pTM Quality
92.44 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map