F378881
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 180 | 272 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100049342|Ga0070708_1000493424 |
| Length | 338 |
| Sequence | MFFMLLWTLAEARGLVLYHSPQGSQVEHNTAFVFPGQGSQYAGMGRDVAEKYPAARRVFEEIDGALGFPLSKVCFEGPEEQLRLTAITQPAILAVSAAIHEVLEDLGATRRDLVAGHSLGEYSAIVSDGGLTPAEAAKIVHLRGKFMQEAVPVGTGAMAALIGPTVDEVRAICEEATRGEVVSVANINAPGQTVIAGTKAAVDRAIDIAKRRGVRRALPLPVSAPFHCALMKPAEEKLRPVLEQAPLKDLWIALVSNVDASPIGTATAVRNALVRQVVSPVRWVEGVQKMISMGVRHFVEVGPGNVLTGLIKRIDSSVQLTNVSDVKSIEAFAAVVKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 78 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 79 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 80 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 124 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 132 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 133 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 134 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 137 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 138 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 140 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 145 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 148 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 149 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 150 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 151 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 152 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 153 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 154 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 155 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 156 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 157 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 158 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 164 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.1 |
| Nodule | 0 |
| Rhizoplane | 1.83 |
| Rhizosphere | 90.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10036744 | 3300005327 | Bacteria | 3948 |
| 2 | Ga0070676_10027616 | 3300005328 | Bacteria | 3219 |
| 3 | Ga0070683_100000103 | 3300005329 | Bacteria | 55332 |
| 4 | Ga0070670_100000067 | 3300005331 | Bacteria | 107051 |
| 5 | Ga0070670_100116341 | 3300005331 | Bacteria | 2305 |
| 6 | Ga0068869_100050040 | 3300005334 | Bacteria | 3028 |
| 7 | Ga0068869_100125744 | 3300005334 | Bacteria | 1966 |
| 8 | Ga0068869_100257512 | 3300005334 | Unclassified | 1396 |
| 9 | Ga0070680_100027651 | 3300005336 | Bacteria | 4543 |
| 10 | Ga0070682_100000010 | 3300005337 | Bacteria | 280957 |
| 11 | Ga0068868_100000249 | 3300005338 | Bacteria | 36630 |
| 12 | Ga0068868_100000558 | 3300005338 | Bacteria | 24973 |
| 13 | Ga0070687_100230347 | 3300005343 | Bacteria | 1140 |
| 14 | Ga0070692_10000105 | 3300005345 | Bacteria | 18944 |
| 15 | Ga0070692_10028092 | 3300005345 | Bacteria | 2795 |
| 16 | Ga0070669_100008511 | 3300005353 | Bacteria | 7324 |
| 17 | Ga0070669_100057012 | 3300005353 | Bacteria | 2865 |
| 18 | Ga0070675_100000024 | 3300005354 | Bacteria | 117191 |
| 19 | Ga0070674_100016867 | 3300005356 | Bacteria | 4582 |
| 20 | Ga0070659_100068118 | 3300005366 | Bacteria | 2823 |
| 21 | Ga0070713_100017090 | 3300005436 | Bacteria | 5475 |
| 22 | Ga0070701_10159622 | 3300005438 | Bacteria | 1305 |
| 23 | Ga0070700_100000002 | 3300005441 | Bacteria | 261904 |
| 24 | Ga0070700_100024081 | 3300005441 | Bacteria | 3570 |
| 25 | Ga0070694_100008064 | 3300005444 | Bacteria | 6432 |
| 26 | Ga0070694_100206758 | 3300005444 | Unclassified | 1466 |
| 27 | Ga0070708_100049342 | 3300005445 | Bacteria | 3723 |
| 28 | Ga0070708_100130265 | 3300005445 | Bacteria | 2328 |
| 29 | Ga0070708_100355728 | 3300005445 | Bacteria | 1380 |
| 30 | Ga0070663_100126136 | 3300005455 | Bacteria | 1939 |
| 31 | Ga0070662_100028001 | 3300005457 | Bacteria | 3919 |
| 32 | Ga0070662_100075871 | 3300005457 | Bacteria | 2490 |
| 33 | Ga0068867_100358353 | 3300005459 | Bacteria | 1219 |
| 34 | Ga0070706_100002630 | 3300005467 | Bacteria | 17990 |
| 35 | Ga0070706_100008767 | 3300005467 | Bacteria | 9423 |
| 36 | Ga0070706_100124290 | 3300005467 | Bacteria | 2405 |
| 37 | Ga0070706_100291729 | 3300005467 | Bacteria | 1522 |
| 38 | Ga0070707_100010141 | 3300005468 | Bacteria | 8770 |
| 39 | Ga0070707_100120577 | 3300005468 | Bacteria | 2546 |
| 40 | Ga0070707_100175439 | 3300005468 | Bacteria | 2089 |
| 41 | Ga0070698_100000020 | 3300005471 | Bacteria | 106237 |
| 42 | Ga0070699_100029308 | 3300005518 | Bacteria | 4745 |
| 43 | Ga0070699_100377200 | 3300005518 | Bacteria | 1280 |
| 44 | Ga0070684_100000272 | 3300005535 | Bacteria | 35847 |
| 45 | Ga0070684_100196057 | 3300005535 | Bacteria | 1839 |
| 46 | Ga0070697_100091559 | 3300005536 | Bacteria | 2515 |
| 47 | Ga0070697_100103315 | 3300005536 | Bacteria | 2369 |
| 48 | Ga0068853_100007729 | 3300005539 | Bacteria | 8622 |
| 49 | Ga0070672_100000697 | 3300005543 | Bacteria | 19893 |
| 50 | Ga0070672_100023292 | 3300005543 | Bacteria | 4562 |
| 51 | Ga0070672_100052849 | 3300005543 | Bacteria | 3174 |
| 52 | Ga0070686_100193161 | 3300005544 | Bacteria | 1454 |
| 53 | Ga0070686_100346573 | 3300005544 | Bacteria | 1115 |
| 54 | Ga0070696_100167966 | 3300005546 | Bacteria | 1620 |
| 55 | Ga0070696_100331011 | 3300005546 | Bacteria | 1174 |
| 56 | Ga0070665_100070939 | 3300005548 | Bacteria | 3490 |
| 57 | Ga0070704_100239534 | 3300005549 | Bacteria | 1484 |
| 58 | Ga0068855_100088436 | 3300005563 | Bacteria | 3578 |
| 59 | Ga0068854_100012221 | 3300005578 | Bacteria | 5618 |
| 60 | Ga0068854_100086591 | 3300005578 | Bacteria | 2323 |
| 61 | Ga0070702_100120440 | 3300005615 | Bacteria | 1642 |
| 62 | Ga0068864_100000008 | 3300005618 | Bacteria | 390035 |
| 63 | Ga0068861_100021982 | 3300005719 | Bacteria | 4589 |
| 64 | Ga0068861_100206164 | 3300005719 | Bacteria | 1653 |
| 65 | Ga0068870_10015161 | 3300005840 | Bacteria | 3652 |
| 66 | Ga0068863_100067516 | 3300005841 | Bacteria | 3382 |
| 67 | Ga0068863_100112022 | 3300005841 | Bacteria | 2599 |
| 68 | Ga0068858_100000518 | 3300005842 | Bacteria | 40503 |
| 69 | Ga0068858_100084456 | 3300005842 | Bacteria | 2953 |
| 70 | Ga0068860_100293780 | 3300005843 | Bacteria | 1590 |
| 71 | Ga0068862_100007438 | 3300005844 | Bacteria | 9079 |
| 72 | Ga0068862_100084638 | 3300005844 | Bacteria | 2755 |
| 73 | Ga0070717_10000173 | 3300006028 | Bacteria | 48151 |
| 74 | Ga0075365_10026713 | 3300006038 | Bacteria | 3667 |
| 75 | Ga0075368_10010732 | 3300006042 | Bacteria | 3318 |
| 76 | Ga0075363_100052617 | 3300006048 | Bacteria | 2174 |
| 77 | Ga0070712_100045496 | 3300006175 | Bacteria | 3031 |
| 78 | Ga0075428_100000766 | 3300006844 | Bacteria | 33418 |
| 79 | Ga0075428_100233338 | 3300006844 | Bacteria | 1985 |
| 80 | Ga0075430_100218070 | 3300006846 | Bacteria | 1583 |
| 81 | Ga0075431_100308730 | 3300006847 | Bacteria | 1597 |
| 82 | Ga0075433_10000886 | 3300006852 | Bacteria | 21055 |
| 83 | Ga0075434_100000339 | 3300006871 | Bacteria | 33788 |
| 84 | Ga0075434_100300752 | 3300006871 | Bacteria | 1625 |
| 85 | Ga0075436_100004991 | 3300006914 | Bacteria | 9117 |
| 86 | Ga0075435_100000206 | 3300007076 | Bacteria | 35805 |
| 87 | Ga0075435_100470301 | 3300007076 | Bacteria | 1085 |
| 88 | Ga0105240_10011838 | 3300009093 | Bacteria | 12115 |
| 89 | Ga0111539_10000006 | 3300009094 | Bacteria | 463720 |
| 90 | Ga0111539_10333594 | 3300009094 | Bacteria | 1765 |
| 91 | Ga0105245_10000003 | 3300009098 | Bacteria | 488207 |
| 92 | Ga0105245_10000284 | 3300009098 | Bacteria | 48293 |
| 93 | Ga0105245_10079071 | 3300009098 | Bacteria | 3002 |
| 94 | Ga0105245_10131807 | 3300009098 | Bacteria | 2345 |
| 95 | Ga0114129_10007953 | 3300009147 | Bacteria | 15092 |
| 96 | Ga0114129_10011524 | 3300009147 | Bacteria | 12591 |
| 97 | Ga0114129_10094698 | 3300009147 | Bacteria | 4136 |
| 98 | Ga0114129_10300799 | 3300009147 | Bacteria | 2138 |
| 99 | Ga0114129_10390726 | 3300009147 | Bacteria | 1835 |
| 100 | Ga0105242_10026423 | 3300009176 | Bacteria | 4602 |
| 101 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 102 | Ga0105249_10028344 | 3300009553 | Bacteria | 5055 |
| 103 | Ga0105239_10071439 | 3300010375 | Bacteria | 3813 |
| 104 | Ga0157369_10000189 | 3300013105 | Bacteria | 85144 |
| 105 | Ga0157374_10000037 | 3300013296 | Bacteria | 170359 |
| 106 | Ga0157378_10000335 | 3300013297 | Bacteria | 46123 |
| 107 | Ga0163162_10013189 | 3300013306 | Bacteria | 8071 |
| 108 | Ga0163162_10027290 | 3300013306 | Bacteria | 5645 |
| 109 | Ga0163162_10154630 | 3300013306 | Bacteria | 2413 |
| 110 | Ga0157372_10037168 | 3300013307 | Bacteria | 5368 |
| 111 | Ga0157375_10000009 | 3300013308 | Bacteria | 366440 |
| 112 | Ga0157375_10000090 | 3300013308 | Bacteria | 91416 |
| 113 | Ga0157375_10002134 | 3300013308 | Bacteria | 17082 |
| 114 | Ga0157375_10059978 | 3300013308 | Bacteria | 3771 |
| 115 | Ga0163163_10080524 | 3300014325 | Bacteria | 3257 |
| 116 | Ga0157380_10001455 | 3300014326 | Bacteria | 15496 |
| 117 | Ga0157380_10200818 | 3300014326 | Bacteria | 1769 |
| 118 | Ga0157380_10387665 | 3300014326 | Bacteria | 1321 |
| 119 | Ga0157377_10000008 | 3300014745 | Bacteria | 394748 |
| 120 | Ga0157377_10000115 | 3300014745 | Bacteria | 54899 |
| 121 | Ga0157379_10061525 | 3300014968 | Bacteria | 3357 |
| 122 | Ga0157376_10000006 | 3300014969 | Bacteria | 368549 |
| 123 | Ga0213873_10000004 | 3300021358 | Bacteria | 774374 |
| 124 | Ga0213873_10002838 | 3300021358 | Bacteria | 3051 |
| 125 | Ga0213876_10000007 | 3300021384 | Bacteria | 670340 |
| 126 | Ga0213876_10000188 | 3300021384 | Bacteria | 64172 |
| 127 | Ga0213876_10001441 | 3300021384 | Bacteria | 14794 |
| 128 | Ga0213876_10012783 | 3300021384 | Bacteria | 4463 |
| 129 | Ga0213876_10038058 | 3300021384 | Bacteria | 2537 |
| 130 | Ga0213875_10033853 | 3300021388 | Bacteria | 2414 |
| 131 | Ga0209759_1013846 | 3300025256 | Bacteria | 2163 |
| 132 | Ga0207682_10017504 | 3300025893 | Bacteria | 2799 |
| 133 | Ga0207688_10013796 | 3300025901 | Bacteria | 4392 |
| 134 | Ga0207645_10005681 | 3300025907 | Bacteria | 9012 |
| 135 | Ga0207643_10008071 | 3300025908 | Bacteria | 5646 |
| 136 | Ga0207705_10028399 | 3300025909 | Bacteria | 3988 |
| 137 | Ga0207684_10011281 | 3300025910 | Bacteria | 7825 |
| 138 | Ga0207684_10027628 | 3300025910 | Bacteria | 4832 |
| 139 | Ga0207695_10028893 | 3300025913 | Bacteria | 6137 |
| 140 | Ga0207660_10043321 | 3300025917 | Bacteria | 3162 |
| 141 | Ga0207662_10127401 | 3300025918 | Bacteria | 1602 |
| 142 | Ga0207657_10006508 | 3300025919 | Bacteria | 12104 |
| 143 | Ga0207649_10108826 | 3300025920 | Bacteria | 1848 |
| 144 | Ga0207646_10014498 | 3300025922 | Bacteria | 7482 |
| 145 | Ga0207681_10037736 | 3300025923 | Bacteria | 3196 |
| 146 | Ga0207681_10089913 | 3300025923 | Bacteria | 2190 |
| 147 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 148 | Ga0207650_10000067 | 3300025925 | Bacteria | 140196 |
| 149 | Ga0207650_10030839 | 3300025925 | Bacteria | 3867 |
| 150 | Ga0207659_10000029 | 3300025926 | Bacteria | 129487 |
| 151 | Ga0207687_10000002 | 3300025927 | Bacteria | 975489 |
| 152 | Ga0207687_10002030 | 3300025927 | Bacteria | 13890 |
| 153 | Ga0207687_10031920 | 3300025927 | Bacteria | 3563 |
| 154 | Ga0207700_10012662 | 3300025928 | Bacteria | 5451 |
| 155 | Ga0207706_10005268 | 3300025933 | Bacteria | 12060 |
| 156 | Ga0207686_10253260 | 3300025934 | Bacteria | 1287 |
| 157 | Ga0207670_10193041 | 3300025936 | Bacteria | 1542 |
| 158 | Ga0207665_10059852 | 3300025939 | Bacteria | 2578 |
| 159 | Ga0207691_10000312 | 3300025940 | Bacteria | 48438 |
| 160 | Ga0207691_10000507 | 3300025940 | Bacteria | 38790 |
| 161 | Ga0207691_10128062 | 3300025940 | Bacteria | 2245 |
| 162 | Ga0207689_10004202 | 3300025942 | Bacteria | 13095 |
| 163 | Ga0207689_10013673 | 3300025942 | Bacteria | 6921 |
| 164 | Ga0207689_10025127 | 3300025942 | Bacteria | 4993 |
| 165 | Ga0207661_10000007 | 3300025944 | Bacteria | 471636 |
| 166 | Ga0207640_10000706 | 3300025981 | Bacteria | 19362 |
| 167 | Ga0207640_10041278 | 3300025981 | Bacteria | 2933 |
| 168 | Ga0207677_10000008 | 3300026023 | Bacteria | 266293 |
| 169 | Ga0207677_10000133 | 3300026023 | Bacteria | 61065 |
| 170 | Ga0207703_10000164 | 3300026035 | Bacteria | 76934 |
| 171 | Ga0207703_10188122 | 3300026035 | Bacteria | 1826 |
| 172 | Ga0207639_10000020 | 3300026041 | Bacteria | 236698 |
| 173 | Ga0207678_10049819 | 3300026067 | Bacteria | 3620 |
| 174 | Ga0207708_10000137 | 3300026075 | Bacteria | 57745 |
| 175 | Ga0207648_10137596 | 3300026089 | Bacteria | 2152 |
| 176 | Ga0207648_10277956 | 3300026089 | Bacteria | 1497 |
| 177 | Ga0207648_10335689 | 3300026089 | Bacteria | 1360 |
| 178 | Ga0207676_10000070 | 3300026095 | Bacteria | 104103 |
| 179 | Ga0207676_10045962 | 3300026095 | Bacteria | 3376 |
| 180 | Ga0207675_100010379 | 3300026118 | Bacteria | 8727 |
| 181 | Ga0207675_100014137 | 3300026118 | Bacteria | 7443 |
| 182 | Ga0207683_10025711 | 3300026121 | Bacteria | 5078 |
| 183 | Ga0207428_10000007 | 3300027907 | Bacteria | 463715 |
| 184 | Ga0268265_10015211 | 3300028380 | Bacteria | 5261 |
| 185 | Ga0268264_10053355 | 3300028381 | Bacteria | 3372 |
| 186 | Ga0268264_10138983 | 3300028381 | Bacteria | 2164 |
| 187 | Ga0265319_1007364 | 3300028563 | Bacteria | 4959 |
| 188 | Ga0265334_10005672 | 3300028573 | Bacteria | 5448 |
| 189 | Ga0265318_10001570 | 3300028577 | Bacteria | 13264 |
| 190 | Ga0265318_10040085 | 3300028577 | Bacteria | 1785 |
| 191 | Ga0265338_10004489 | 3300028800 | Bacteria | 18814 |
| 192 | Ga0307511_10005518 | 3300030521 | Bacteria | 12851 |
| 193 | Ga0265330_10000022 | 3300031235 | Bacteria | 154198 |
| 194 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 195 | Ga0265325_10005305 | 3300031241 | Bacteria | 7985 |
| 196 | Ga0265340_10008358 | 3300031247 | Bacteria | 5592 |
| 197 | Ga0265339_10034411 | 3300031249 | Bacteria | 2847 |
| 198 | Ga0307513_10222362 | 3300031456 | Bacteria | 1708 |
| 199 | Ga0265314_10000013 | 3300031711 | Bacteria | 403405 |
| 200 | Ga0316576_10000041 | 3300031727 | Bacteria | 38424 |
| 201 | Ga0316578_10016055 | 3300031728 | Bacteria | 4044 |
| 202 | Ga0307516_10008493 | 3300031730 | Bacteria | 11609 |
| 203 | Ga0373934_0047576 | 3300035086 | Bacteria | 1697 |
| 204 | Ga0373943_0005723 | 3300035170 | Bacteria | 5578 |
| 205 | Ga0316574_0043345 | 3300035398 | Bacteria | 2780 |
| 206 | Ga0373947_0089685 | 3300035725 | Bacteria | 1915 |
| 207 | Ga0373937_0196069 | 3300036401 | Bacteria | 1898 |
| 208 | Ga0316584_0051260 | 3300036712 | Bacteria | 3087 |
| 209 | Ga0316584_0067850 | 3300036712 | Bacteria | 2673 |
| 210 | Ga0373925_0026493 | 3300037068 | Bacteria | 4242 |
| 211 | Ga0395899_0056134 | 3300037312 | Bacteria | 2911 |
| 212 | Ga0395900_0324391 | 3300037418 | Bacteria | 1519 |
| 213 | Ga0395898_0108565 | 3300037466 | Bacteria | 2661 |
| 214 | Ga0395905_0180632 | 3300037471 | Bacteria | 1981 |
| 215 | Ga0436364_0321269 | 3300037853 | Bacteria | 1524 |
| 216 | Ga0436364_1377383 | 3300037853 | Bacteria | 2635 |
| 217 | Ga0436364_1506321 | 3300037853 | Bacteria | 6256 |
| 218 | Ga0395901_0165846 | 3300038443 | Bacteria | 2319 |
| 219 | Ga0395901_0191000 | 3300038443 | Bacteria | 2148 |
| 220 | Ga0395901_0194770 | 3300038443 | Bacteria | 2125 |
| 221 | Ga0436365_0073603 | 3300039437 | Bacteria | 250590 |
| 222 | Ga0436365_0506999 | 3300039437 | Bacteria | 18404 |
| 223 | Ga0436365_0637274 | 3300039437 | Bacteria | 17734 |
| 224 | Ga0436365_1688836 | 3300039437 | Bacteria | 2240 |
| 225 | Ga0436365_1929564 | 3300039437 | Bacteria | 3931 |
| 226 | Ga0436362_0290430 | 3300039453 | Bacteria | 772596 |
| 227 | Ga0436362_1187303 | 3300039453 | Bacteria | 11856 |
| 228 | Ga0439453_0021541 | 3300041408 | Bacteria | 1163 |
| 229 | Ga0451853_0870457 | 3300041512 | Bacteria | 1839 |
| 230 | Ga0439449_0000371 | 3300042007 | Bacteria | 16522 |
| 231 | Ga0439446_0041274 | 3300042156 | Bacteria | 1360 |
| 232 | Ga0439464_0018270 | 3300042439 | Bacteria | 1907 |
| 233 | Ga0439460_0020042 | 3300042461 | Bacteria | 1816 |
| 234 | Ga0439460_0045642 | 3300042461 | Bacteria | 1300 |
| 235 | Ga0451577_0016922 | 3300042876 | Bacteria | 6745 |
| 236 | Ga0451577_0057152 | 3300042876 | Bacteria | 3478 |
| 237 | Ga0453683_0039576 | 3300044673 | Bacteria | 2963 |
| 238 | Ga0453684_0012886 | 3300044712 | Bacteria | 13697 |
| 239 | Ga0453684_0108627 | 3300044712 | Bacteria | 3376 |
| 240 | Ga0453684_0387911 | 3300044712 | Bacteria | 1567 |
| 241 | Ga0495617_059956 | 3300046452 | Bacteria | 1260 |
| 242 | Ga0495620_0001137 | 3300046515 | Bacteria | 16250 |
| 243 | Ga0495586_0030883 | 3300046535 | Bacteria | 2868 |
| 244 | Ga0495679_008002 | 3300047446 | Bacteria | 4344 |
| 245 | Ga0496102_0206527 | 3300048905 | Bacteria | 1852 |
| 246 | Ga0496102_0320268 | 3300048905 | Bacteria | 1461 |
| 247 | Ga0496107_0170293 | 3300048910 | Bacteria | 1616 |
| 248 | Ga0496111_0152233 | 3300048914 | Bacteria | 1716 |
| 249 | Ga0496112_0341430 | 3300048915 | Bacteria | 1441 |
| 250 | Ga0501038_0180069 | 3300049574 | Bacteria | 1706 |
| 251 | Ga0501070_0000101 | 3300049586 | Bacteria | 74887 |
| 252 | Ga0501073_0001439 | 3300049589 | Bacteria | 17590 |
| 253 | Ga0501073_0001544 | 3300049589 | Bacteria | 17056 |
| 254 | Ga0501073_0012470 | 3300049589 | Bacteria | 6202 |
| 255 | Ga0501074_0087706 | 3300049590 | Bacteria | 2228 |
| 256 | Ga0501074_0179289 | 3300049590 | Bacteria | 1511 |
| 257 | Ga0501080_0001051 | 3300049742 | Bacteria | 22721 |
| 258 | Ga0501080_0001683 | 3300049742 | Bacteria | 18846 |
| 259 | Ga0501083_0013759 | 3300049744 | Bacteria | 5657 |
| 260 | Ga0501083_0071713 | 3300049744 | Unclassified | 2303 |
| 261 | nmdc:mga05p37_326567_c1 | 3300050507 | Unclassified | 1814 |
| 262 | nmdc:mga05p37_349555_c1 | 3300050507 | Bacteria | 1741 |
| 263 | nmdc:mga06r32_2025_c1 | 3300050510 | Bacteria | 18124 |
| 264 | nmdc:mga08y16_11_c1 | 3300050511 | Bacteria | 463712 |
| 265 | nmdc:mga08y16_351511_c1 | 3300050511 | Bacteria | 1514 |
| 266 | nmdc:mga0n895_2902_c1 | 3300050512 | Bacteria | 13605 |
| 267 | nmdc:mga0rr50_1256_c1 | 3300050513 | Bacteria | 13795 |
| 268 | nmdc:mga0rr50_3204_c1 | 3300050513 | Bacteria | 9365 |
| 269 | nmdc:mga08x19_1832_c1 | 3300050514 | Bacteria | 13043 |
| 270 | nmdc:mga0a205_3081_c1 | 3300050515 | Bacteria | 14800 |
| 271 | Ga0495655_0000046 | 3300053083 | Bacteria | 25139 |
| 272 | Ga0501082_0183424 | 3300060353 | Bacteria | 1820 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049590 | Ga0501074_0179289 | Ga0501074_0179289_36_923 | 243 |
| 2 | 3300031728 | Ga0316578_10016055 | Ga0316578_100160555 | 247 |
| 3 | 3300050513 | nmdc:mga0rr50_3204_c1 | nmdc:mga0rr50_3204_c1_8490_9344 | 247 |
| 4 | 3300005467 | Ga0070706_100002630 | Ga0070706_1000026308 | 248 |
| 5 | 3300005471 | Ga0070698_100000020 | Ga0070698_10000002020 | 248 |
| 6 | 3300005536 | Ga0070697_100103315 | Ga0070697_1001033152 | 248 |
| 7 | 3300025910 | Ga0207684_10027628 | Ga0207684_100276283 | 248 |
| 8 | 3300005334 | Ga0068869_100050040 | Ga0068869_1000500402 | 250 |
| 9 | 3300005345 | Ga0070692_10000105 | Ga0070692_1000010517 | 250 |
| 10 | 3300005353 | Ga0070669_100057012 | Ga0070669_1000570122 | 250 |
| 11 | 3300005444 | Ga0070694_100008064 | Ga0070694_1000080645 | 250 |
| 12 | 3300005455 | Ga0070663_100126136 | Ga0070663_1001261361 | 250 |
| 13 | 3300005543 | Ga0070672_100052849 | Ga0070672_1000528493 | 250 |
| 14 | 3300005549 | Ga0070704_100239534 | Ga0070704_1002395342 | 250 |
| 15 | 3300005578 | Ga0068854_100086591 | Ga0068854_1000865912 | 250 |
| 16 | 3300005719 | Ga0068861_100021982 | Ga0068861_1000219822 | 250 |
| 17 | 3300005841 | Ga0068863_100112022 | Ga0068863_1001120223 | 250 |
| 18 | 3300005844 | Ga0068862_100084638 | Ga0068862_1000846382 | 250 |
| 19 | 3300009553 | Ga0105249_10028344 | Ga0105249_100283443 | 250 |
| 20 | 3300013306 | Ga0163162_10013189 | Ga0163162_100131899 | 250 |
| 21 | 3300014326 | Ga0157380_10387665 | Ga0157380_103876652 | 250 |
| 22 | 3300014968 | Ga0157379_10061525 | Ga0157379_100615252 | 250 |
| 23 | 3300025940 | Ga0207691_10128062 | Ga0207691_101280622 | 250 |
| 24 | 3300025942 | Ga0207689_10004202 | Ga0207689_100042026 | 250 |
| 25 | 3300026067 | Ga0207678_10049819 | Ga0207678_100498195 | 250 |
| 26 | 3300026118 | Ga0207675_100010379 | Ga0207675_1000103798 | 250 |
| 27 | 3300028381 | Ga0268264_10053355 | Ga0268264_100533552 | 250 |
| 28 | 3300044712 | Ga0453684_0108627 | Ga0453684_0108627_767_1630 | 250 |
| 29 | 3300048905 | Ga0496102_0206527 | Ga0496102_0206527_447_1310 | 250 |
| 30 | 3300048910 | Ga0496107_0170293 | Ga0496107_0170293_665_1528 | 250 |
| 31 | 3300048914 | Ga0496111_0152233 | Ga0496111_0152233_308_1171 | 250 |
| 32 | 3300025919 | Ga0207657_10006508 | Ga0207657_100065085 | 251 |
| 33 | 3300005563 | Ga0068855_100088436 | Ga0068855_1000884365 | 254 |
| 34 | 3300031456 | Ga0307513_10222362 | Ga0307513_102223622 | 257 |
| 35 | 3300046452 | Ga0495617_059956 | Ga0495617_059956_120_998 | 257 |
| 36 | 3300049586 | Ga0501070_0000101 | Ga0501070_0000101_51944_52882 | 258 |
| 37 | 3300049589 | Ga0501073_0012470 | Ga0501073_0012470_147_1085 | 258 |
| 38 | 3300049742 | Ga0501080_0001683 | Ga0501080_0001683_123_1061 | 258 |
| 39 | 3300049744 | Ga0501083_0013759 | Ga0501083_0013759_4599_5537 | 258 |
| 40 | 3300060353 | Ga0501082_0183424 | Ga0501082_0183424_691_1629 | 258 |
| 41 | 3300031249 | Ga0265339_10034411 | Ga0265339_100344112 | 259 |
| 42 | 3300013307 | Ga0157372_10037168 | Ga0157372_100371681 | 260 |
| 43 | 3300037853 | Ga0436364_0321269 | Ga0436364_0321269_617_1498 | 262 |
| 44 | 3300042461 | Ga0439460_0045642 | Ga0439460_0045642_329_1219 | 262 |
| 45 | 3300005328 | Ga0070676_10027616 | Ga0070676_100276163 | 263 |
| 46 | 3300005331 | Ga0070670_100116341 | Ga0070670_1001163412 | 263 |
| 47 | 3300005334 | Ga0068869_100125744 | Ga0068869_1001257442 | 263 |
| 48 | 3300005353 | Ga0070669_100008511 | Ga0070669_1000085119 | 263 |
| 49 | 3300005356 | Ga0070674_100016867 | Ga0070674_1000168672 | 263 |
| 50 | 3300005366 | Ga0070659_100068118 | Ga0070659_1000681183 | 263 |
| 51 | 3300005441 | Ga0070700_100024081 | Ga0070700_1000240812 | 263 |
| 52 | 3300005444 | Ga0070694_100206758 | Ga0070694_1002067582 | 263 |
| 53 | 3300005457 | Ga0070662_100028001 | Ga0070662_1000280013 | 263 |
| 54 | 3300005457 | Ga0070662_100075871 | Ga0070662_1000758712 | 263 |
| 55 | 3300005468 | Ga0070707_100175439 | Ga0070707_1001754392 | 263 |
| 56 | 3300005543 | Ga0070672_100023292 | Ga0070672_1000232926 | 263 |
| 57 | 3300005615 | Ga0070702_100120440 | Ga0070702_1001204402 | 263 |
| 58 | 3300005719 | Ga0068861_100206164 | Ga0068861_1002061642 | 263 |
| 59 | 3300005842 | Ga0068858_100084456 | Ga0068858_1000844563 | 263 |
| 60 | 3300005843 | Ga0068860_100293780 | Ga0068860_1002937802 | 263 |
| 61 | 3300005844 | Ga0068862_100007438 | Ga0068862_1000074389 | 263 |
| 62 | 3300013306 | Ga0163162_10154630 | Ga0163162_101546302 | 263 |
| 63 | 3300013308 | Ga0157375_10059978 | Ga0157375_100599784 | 263 |
| 64 | 3300014325 | Ga0163163_10080524 | Ga0163163_100805243 | 263 |
| 65 | 3300025893 | Ga0207682_10017504 | Ga0207682_100175043 | 263 |
| 66 | 3300025901 | Ga0207688_10013796 | Ga0207688_100137963 | 263 |
| 67 | 3300025907 | Ga0207645_10005681 | Ga0207645_100056813 | 263 |
| 68 | 3300025908 | Ga0207643_10008071 | Ga0207643_100080713 | 263 |
| 69 | 3300025920 | Ga0207649_10108826 | Ga0207649_101088262 | 263 |
| 70 | 3300025923 | Ga0207681_10037736 | Ga0207681_100377363 | 263 |
| 71 | 3300025923 | Ga0207681_10089913 | Ga0207681_100899132 | 263 |
| 72 | 3300025933 | Ga0207706_10005268 | Ga0207706_1000526811 | 263 |
| 73 | 3300025940 | Ga0207691_10000312 | Ga0207691_1000031240 | 263 |
| 74 | 3300025942 | Ga0207689_10025127 | Ga0207689_100251272 | 263 |
| 75 | 3300026035 | Ga0207703_10188122 | Ga0207703_101881222 | 263 |
| 76 | 3300026089 | Ga0207648_10137596 | Ga0207648_101375962 | 263 |
| 77 | 3300026095 | Ga0207676_10045962 | Ga0207676_100459622 | 263 |
| 78 | 3300026118 | Ga0207675_100014137 | Ga0207675_1000141374 | 263 |
| 79 | 3300026121 | Ga0207683_10025711 | Ga0207683_100257112 | 263 |
| 80 | 3300028380 | Ga0268265_10015211 | Ga0268265_100152113 | 263 |
| 81 | 3300028381 | Ga0268264_10138983 | Ga0268264_101389832 | 263 |
| 82 | 3300028577 | Ga0265318_10040085 | Ga0265318_100400852 | 263 |
| 83 | 3300031247 | Ga0265340_10008358 | Ga0265340_100083584 | 263 |
| 84 | 3300035086 | Ga0373934_0047576 | Ga0373934_0047576_138_1019 | 263 |
| 85 | 3300035725 | Ga0373947_0089685 | Ga0373947_0089685_492_1373 | 263 |
| 86 | 3300044673 | Ga0453683_0039576 | Ga0453683_0039576_217_1104 | 263 |
| 87 | 3300050510 | nmdc:mga06r32_2025_c1 | nmdc:mga06r32_2025_c1_16872_17759 | 263 |
| 88 | 3300006852 | Ga0075433_10000886 | Ga0075433_1000088610 | 264 |
| 89 | 3300006871 | Ga0075434_100000339 | Ga0075434_10000033929 | 264 |
| 90 | 3300009147 | Ga0114129_10007953 | Ga0114129_1000795311 | 264 |
| 91 | 3300036712 | Ga0316584_0051260 | Ga0316584_0051260_2125_3042 | 264 |
| 92 | 3300050512 | nmdc:mga0n895_2902_c1 | nmdc:mga0n895_2902_c1_880_1785 | 264 |
| 93 | 3300050515 | nmdc:mga0a205_3081_c1 | nmdc:mga0a205_3081_c1_2662_3567 | 264 |
| 94 | 3300005841 | Ga0068863_100067516 | Ga0068863_1000675162 | 265 |
| 95 | 3300046535 | Ga0495586_0030883 | Ga0495586_0030883_367_1311 | 265 |
| 96 | 3300025256 | Ga0209759_1013846 | Ga0209759_10138462 | 267 |
| 97 | 3300005548 | Ga0070665_100070939 | Ga0070665_1000709392 | 269 |
| 98 | 3300037853 | Ga0436364_1377383 | Ga0436364_1377383_1662_2600 | 269 |
| 99 | 3300006175 | Ga0070712_100045496 | Ga0070712_1000454962 | 270 |
| 100 | 3300006844 | Ga0075428_100000766 | Ga0075428_10000076621 | 270 |
| 101 | 3300006871 | Ga0075434_100300752 | Ga0075434_1003007522 | 273 |
| 102 | 3300041512 | Ga0451853_0870457 | Ga0451853_0870457_839_1768 | 273 |
| 103 | 3300049590 | Ga0501074_0087706 | Ga0501074_0087706_990_1922 | 273 |
| 104 | 3300009094 | Ga0111539_10000006 | Ga0111539_10000006199 | 274 |
| 105 | 3300027907 | Ga0207428_10000007 | Ga0207428_10000007198 | 274 |
| 106 | 3300050511 | nmdc:mga08y16_11_c1 | nmdc:mga08y16_11_c1_209992_210927 | 274 |
| 107 | 3300037312 | Ga0395899_0056134 | Ga0395899_0056134_1451_2380 | 275 |
| 108 | 3300037418 | Ga0395900_0324391 | Ga0395900_0324391_279_1208 | 275 |
| 109 | 3300037471 | Ga0395905_0180632 | Ga0395905_0180632_876_1805 | 275 |
| 110 | 3300038443 | Ga0395901_0165846 | Ga0395901_0165846_542_1471 | 275 |
| 111 | 3300038443 | Ga0395901_0194770 | Ga0395901_0194770_247_1176 | 275 |
| 112 | iso_pu_bacteria | 2916971899 | 2916974609 | 275 |
| 113 | 3300005445 | Ga0070708_100130265 | Ga0070708_1001302652 | 276 |
| 114 | 3300005467 | Ga0070706_100291729 | Ga0070706_1002917291 | 276 |
| 115 | 3300005546 | Ga0070696_100167966 | Ga0070696_1001679662 | 276 |
| 116 | 3300006847 | Ga0075431_100308730 | Ga0075431_1003087301 | 276 |
| 117 | 3300006914 | Ga0075436_100004991 | Ga0075436_1000049918 | 276 |
| 118 | 3300007076 | Ga0075435_100000206 | Ga0075435_1000002063 | 276 |
| 119 | 3300009147 | Ga0114129_10094698 | Ga0114129_100946982 | 276 |
| 120 | 3300014745 | Ga0157377_10000115 | Ga0157377_1000011528 | 276 |
| 121 | 3300021388 | Ga0213875_10033853 | Ga0213875_100338531 | 276 |
| 122 | 3300025936 | Ga0207670_10193041 | Ga0207670_101930412 | 276 |
| 123 | 3300037466 | Ga0395898_0108565 | Ga0395898_0108565_434_1375 | 276 |
| 124 | 3300037853 | Ga0436364_1506321 | Ga0436364_1506321_415_1353 | 276 |
| 125 | 3300038443 | Ga0395901_0191000 | Ga0395901_0191000_13_945 | 276 |
| 126 | 3300041408 | Ga0439453_0021541 | Ga0439453_0021541_151_1101 | 276 |
| 127 | 3300048905 | Ga0496102_0320268 | Ga0496102_0320268_344_1300 | 276 |
| 128 | 3300050513 | nmdc:mga0rr50_1256_c1 | nmdc:mga0rr50_1256_c1_9069_9998 | 276 |
| 129 | 3300050514 | nmdc:mga08x19_1832_c1 | nmdc:mga08x19_1832_c1_6144_7073 | 276 |
| 130 | 3300053083 | Ga0495655_0000046 | Ga0495655_0000046_17554_18483 | 276 |
| 131 | 3300005436 | Ga0070713_100017090 | Ga0070713_1000170903 | 277 |
| 132 | 3300006028 | Ga0070717_10000173 | Ga0070717_1000017347 | 277 |
| 133 | 3300009147 | Ga0114129_10300799 | Ga0114129_103007993 | 277 |
| 134 | 3300014326 | Ga0157380_10200818 | Ga0157380_102008182 | 277 |
| 135 | 3300025928 | Ga0207700_10012662 | Ga0207700_100126626 | 277 |
| 136 | 3300042439 | Ga0439464_0018270 | Ga0439464_0018270_588_1526 | 277 |
| 137 | 3300042461 | Ga0439460_0020042 | Ga0439460_0020042_846_1784 | 277 |
| 138 | 3300046515 | Ga0495620_0001137 | Ga0495620_0001137_10366_11304 | 277 |
| 139 | 3300005329 | Ga0070683_100000103 | Ga0070683_10000010332 | 278 |
| 140 | 3300005343 | Ga0070687_100230347 | Ga0070687_1002303471 | 278 |
| 141 | 3300005535 | Ga0070684_100000272 | Ga0070684_10000027217 | 278 |
| 142 | 3300005544 | Ga0070686_100346573 | Ga0070686_1003465731 | 278 |
| 143 | 3300005578 | Ga0068854_100012221 | Ga0068854_1000122213 | 278 |
| 144 | 3300006038 | Ga0075365_10026713 | Ga0075365_100267133 | 278 |
| 145 | 3300006042 | Ga0075368_10010732 | Ga0075368_100107322 | 278 |
| 146 | 3300006048 | Ga0075363_100052617 | Ga0075363_1000526173 | 278 |
| 147 | 3300009094 | Ga0111539_10333594 | Ga0111539_103335942 | 278 |
| 148 | 3300009098 | Ga0105245_10000003 | Ga0105245_10000003211 | 278 |
| 149 | 3300013308 | Ga0157375_10002134 | Ga0157375_100021342 | 278 |
| 150 | 3300014969 | Ga0157376_10000006 | Ga0157376_10000006230 | 278 |
| 151 | 3300021358 | Ga0213873_10000004 | Ga0213873_1000000496 | 278 |
| 152 | 3300021384 | Ga0213876_10000007 | Ga0213876_1000000796 | 278 |
| 153 | 3300021384 | Ga0213876_10038058 | Ga0213876_100380583 | 278 |
| 154 | 3300025918 | Ga0207662_10127401 | Ga0207662_101274012 | 278 |
| 155 | 3300025927 | Ga0207687_10000002 | Ga0207687_10000002209 | 278 |
| 156 | 3300025944 | Ga0207661_10000007 | Ga0207661_10000007105 | 278 |
| 157 | 3300025981 | Ga0207640_10000706 | Ga0207640_1000070612 | 278 |
| 158 | 3300028563 | Ga0265319_1007364 | Ga0265319_10073642 | 278 |
| 159 | 3300028573 | Ga0265334_10005672 | Ga0265334_100056722 | 278 |
| 160 | 3300028577 | Ga0265318_10001570 | Ga0265318_1000157014 | 278 |
| 161 | 3300028800 | Ga0265338_10004489 | Ga0265338_100044898 | 278 |
| 162 | 3300031235 | Ga0265330_10000022 | Ga0265330_1000002298 | 278 |
| 163 | 3300031238 | Ga0265332_10000001 | Ga0265332_10000001607 | 278 |
| 164 | 3300031241 | Ga0265325_10005305 | Ga0265325_100053054 | 278 |
| 165 | 3300031711 | Ga0265314_10000013 | Ga0265314_10000013210 | 278 |
| 166 | 3300031730 | Ga0307516_10008493 | Ga0307516_1000849311 | 278 |
| 167 | 3300037068 | Ga0373925_0026493 | Ga0373925_0026493_882_1829 | 278 |
| 168 | 3300039437 | Ga0436365_0073603 | Ga0436365_0073603_19193_20122 | 278 |
| 169 | 3300039437 | Ga0436365_1688836 | Ga0436365_1688836_414_1343 | 278 |
| 170 | 3300039453 | Ga0436362_0290430 | Ga0436362_0290430_662578_663507 | 278 |
| 171 | 3300042007 | Ga0439449_0000371 | Ga0439449_0000371_7241_8191 | 278 |
| 172 | 3300042876 | Ga0451577_0057152 | Ga0451577_0057152_1151_2086 | 278 |
| 173 | 3300044712 | Ga0453684_0012886 | Ga0453684_0012886_1113_2048 | 278 |
| 174 | 3300044712 | Ga0453684_0387911 | Ga0453684_0387911_580_1521 | 278 |
| 175 | 3300049574 | Ga0501038_0180069 | Ga0501038_0180069_736_1695 | 278 |
| 176 | 3300049744 | Ga0501083_0071713 | Ga0501083_0071713_1075_2031 | 278 |
| 177 | 3300050511 | nmdc:mga08y16_351511_c1 | nmdc:mga08y16_351511_c1_204_1139 | 278 |
| 178 | 3300005336 | Ga0070680_100027651 | Ga0070680_1000276513 | 279 |
| 179 | 3300005354 | Ga0070675_100000024 | Ga0070675_10000002442 | 279 |
| 180 | 3300005518 | Ga0070699_100377200 | Ga0070699_1003772001 | 279 |
| 181 | 3300009147 | Ga0114129_10390726 | Ga0114129_103907262 | 279 |
| 182 | 3300025917 | Ga0207660_10043321 | Ga0207660_100433213 | 279 |
| 183 | 3300025926 | Ga0207659_10000029 | Ga0207659_1000002952 | 279 |
| 184 | 3300031727 | Ga0316576_10000041 | Ga0316576_1000004118 | 279 |
| 185 | 3300036712 | Ga0316584_0067850 | Ga0316584_0067850_376_1317 | 279 |
| 186 | 3300042156 | Ga0439446_0041274 | Ga0439446_0041274_165_1118 | 279 |
| 187 | 3300050507 | nmdc:mga05p37_349555_c1 | nmdc:mga05p37_349555_c1_609_1541 | 279 |
| 188 | 3300005337 | Ga0070682_100000010 | Ga0070682_10000001071 | 280 |
| 189 | 3300005441 | Ga0070700_100000002 | Ga0070700_100000002197 | 280 |
| 190 | 3300005445 | Ga0070708_100355728 | Ga0070708_1003557282 | 280 |
| 191 | 3300005459 | Ga0068867_100358353 | Ga0068867_1003583531 | 280 |
| 192 | 3300005546 | Ga0070696_100331011 | Ga0070696_1003310111 | 280 |
| 193 | 3300006844 | Ga0075428_100233338 | Ga0075428_1002333382 | 280 |
| 194 | 3300009176 | Ga0105242_10026423 | Ga0105242_100264232 | 280 |
| 195 | 3300025939 | Ga0207665_10059852 | Ga0207665_100598522 | 280 |
| 196 | 3300026075 | Ga0207708_10000137 | Ga0207708_1000013733 | 280 |
| 197 | 3300026089 | Ga0207648_10277956 | Ga0207648_102779562 | 280 |
| 198 | 3300035398 | Ga0316574_0043345 | Ga0316574_0043345_686_1636 | 280 |
| 199 | 3300042876 | Ga0451577_0016922 | Ga0451577_0016922_702_1637 | 280 |
| 200 | 3300047446 | Ga0495679_008002 | Ga0495679_008002_2269_3207 | 280 |
| 201 | 3300005327 | Ga0070658_10036744 | Ga0070658_100367444 | 281 |
| 202 | 3300005331 | Ga0070670_100000067 | Ga0070670_10000006720 | 281 |
| 203 | 3300005334 | Ga0068869_100257512 | Ga0068869_1002575121 | 281 |
| 204 | 3300005338 | Ga0068868_100000249 | Ga0068868_10000024922 | 281 |
| 205 | 3300005338 | Ga0068868_100000558 | Ga0068868_1000005588 | 281 |
| 206 | 3300005345 | Ga0070692_10028092 | Ga0070692_100280924 | 281 |
| 207 | 3300005438 | Ga0070701_10159622 | Ga0070701_101596222 | 281 |
| 208 | 3300005445 | Ga0070708_100049342 | Ga0070708_1000493424 | 281 |
| 209 | 3300005467 | Ga0070706_100008767 | Ga0070706_10000876712 | 281 |
| 210 | 3300005467 | Ga0070706_100124290 | Ga0070706_1001242902 | 281 |
| 211 | 3300005468 | Ga0070707_100010141 | Ga0070707_1000101412 | 281 |
| 212 | 3300005468 | Ga0070707_100120577 | Ga0070707_1001205773 | 281 |
| 213 | 3300005518 | Ga0070699_100029308 | Ga0070699_1000293083 | 281 |
| 214 | 3300005535 | Ga0070684_100196057 | Ga0070684_1001960572 | 281 |
| 215 | 3300005536 | Ga0070697_100091559 | Ga0070697_1000915593 | 281 |
| 216 | 3300005539 | Ga0068853_100007729 | Ga0068853_1000077298 | 281 |
| 217 | 3300005543 | Ga0070672_100000697 | Ga0070672_10000069718 | 281 |
| 218 | 3300005544 | Ga0070686_100193161 | Ga0070686_1001931612 | 281 |
| 219 | 3300005618 | Ga0068864_100000008 | Ga0068864_100000008308 | 281 |
| 220 | 3300005840 | Ga0068870_10015161 | Ga0068870_100151614 | 281 |
| 221 | 3300005842 | Ga0068858_100000518 | Ga0068858_10000051816 | 281 |
| 222 | 3300006846 | Ga0075430_100218070 | Ga0075430_1002180701 | 281 |
| 223 | 3300007076 | Ga0075435_100470301 | Ga0075435_1004703011 | 281 |
| 224 | 3300009093 | Ga0105240_10011838 | Ga0105240_100118386 | 281 |
| 225 | 3300009098 | Ga0105245_10000284 | Ga0105245_100002844 | 281 |
| 226 | 3300009098 | Ga0105245_10079071 | Ga0105245_100790713 | 281 |
| 227 | 3300009098 | Ga0105245_10131807 | Ga0105245_101318072 | 281 |
| 228 | 3300009147 | Ga0114129_10011524 | Ga0114129_1001152416 | 281 |
| 229 | 3300009551 | Ga0105238_10000001 | Ga0105238_100000011747 | 281 |
| 230 | 3300010375 | Ga0105239_10071439 | Ga0105239_100714393 | 281 |
| 231 | 3300013105 | Ga0157369_10000189 | Ga0157369_1000018964 | 281 |
| 232 | 3300013296 | Ga0157374_10000037 | Ga0157374_1000003745 | 281 |
| 233 | 3300013297 | Ga0157378_10000335 | Ga0157378_1000033546 | 281 |
| 234 | 3300013306 | Ga0163162_10027290 | Ga0163162_100272908 | 281 |
| 235 | 3300013308 | Ga0157375_10000009 | Ga0157375_10000009207 | 281 |
| 236 | 3300013308 | Ga0157375_10000090 | Ga0157375_1000009045 | 281 |
| 237 | 3300014326 | Ga0157380_10001455 | Ga0157380_1000145510 | 281 |
| 238 | 3300014745 | Ga0157377_10000008 | Ga0157377_1000000844 | 281 |
| 239 | 3300021358 | Ga0213873_10002838 | Ga0213873_100028382 | 281 |
| 240 | 3300021384 | Ga0213876_10000188 | Ga0213876_100001885 | 281 |
| 241 | 3300021384 | Ga0213876_10001441 | Ga0213876_1000144116 | 281 |
| 242 | 3300021384 | Ga0213876_10012783 | Ga0213876_100127833 | 281 |
| 243 | 3300025909 | Ga0207705_10028399 | Ga0207705_100283994 | 281 |
| 244 | 3300025910 | Ga0207684_10011281 | Ga0207684_1001128110 | 281 |
| 245 | 3300025913 | Ga0207695_10028893 | Ga0207695_100288934 | 281 |
| 246 | 3300025922 | Ga0207646_10014498 | Ga0207646_100144985 | 281 |
| 247 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000012779 | 281 |
| 248 | 3300025925 | Ga0207650_10000067 | Ga0207650_1000006733 | 281 |
| 249 | 3300025925 | Ga0207650_10030839 | Ga0207650_100308392 | 281 |
| 250 | 3300025927 | Ga0207687_10002030 | Ga0207687_100020308 | 281 |
| 251 | 3300025927 | Ga0207687_10031920 | Ga0207687_100319202 | 281 |
| 252 | 3300025934 | Ga0207686_10253260 | Ga0207686_102532601 | 281 |
| 253 | 3300025940 | Ga0207691_10000507 | Ga0207691_1000050737 | 281 |
| 254 | 3300025942 | Ga0207689_10013673 | Ga0207689_100136737 | 281 |
| 255 | 3300025981 | Ga0207640_10041278 | Ga0207640_100412782 | 281 |
| 256 | 3300026023 | Ga0207677_10000008 | Ga0207677_1000000850 | 281 |
| 257 | 3300026023 | Ga0207677_10000133 | Ga0207677_1000013337 | 281 |
| 258 | 3300026035 | Ga0207703_10000164 | Ga0207703_1000016440 | 281 |
| 259 | 3300026041 | Ga0207639_10000020 | Ga0207639_1000002023 | 281 |
| 260 | 3300026089 | Ga0207648_10335689 | Ga0207648_103356892 | 281 |
| 261 | 3300026095 | Ga0207676_10000070 | Ga0207676_1000007015 | 281 |
| 262 | 3300030521 | Ga0307511_10005518 | Ga0307511_100055184 | 281 |
| 263 | 3300035170 | Ga0373943_0005723 | Ga0373943_0005723_1857_2801 | 281 |
| 264 | 3300036401 | Ga0373937_0196069 | Ga0373937_0196069_90_1046 | 281 |
| 265 | 3300039437 | Ga0436365_0506999 | Ga0436365_0506999_10970_11911 | 281 |
| 266 | 3300039437 | Ga0436365_0637274 | Ga0436365_0637274_3448_4386 | 281 |
| 267 | 3300039437 | Ga0436365_1929564 | Ga0436365_1929564_809_1765 | 281 |
| 268 | 3300039453 | Ga0436362_1187303 | Ga0436362_1187303_7525_8463 | 281 |
| 269 | 3300048915 | Ga0496112_0341430 | Ga0496112_0341430_276_1232 | 281 |
| 270 | 3300049589 | Ga0501073_0001439 | Ga0501073_0001439_9920_10912 | 281 |
| 271 | 3300049589 | Ga0501073_0001544 | Ga0501073_0001544_742_1683 | 281 |
| 272 | 3300049742 | Ga0501080_0001051 | Ga0501080_0001051_4792_5733 | 281 |
| 273 | 3300050507 | nmdc:mga05p37_326567_c1 | nmdc:mga05p37_326567_c1_763_1704 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hjv-assembly1.cif.gz_B | 1.7 angstrom resolution crystal structure of an acyl carrier protein s-malonyltransferase from vibrio cholerae o1 biovar eltor str. n16961 | 0.9566 | 4 | 275 |
| 2g2y-assembly1.cif.gz_A | structure of e.coli fabd complexed with malonate | 0.9485 | 4 | 275 |
| 3qat-assembly1.cif.gz_A | crystal structure of acyl-carrier-protein-s-malonyltransferase from bartonella henselae | 0.9458 | 4 | 280 |
| 6smd-assembly2.cif.gz_C | plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase | 0.9439 | 4 | 279 |
| 3h0p-assembly1.cif.gz_A | 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. | 0.9391 | 4 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cuyB01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9771 | 5 | 279 | 3.40.366.10 |
| 2g1hA01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9718 | 4 | 278 | 3.40.366.10 |
| 3im9A01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9701 | 4 | 276 | 3.40.366.10 |
| 4rr5A01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9665 | 4 | 275 | 3.40.366.10 |
| 2g1hA01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9637 | 4 | 278 | 3.40.366.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0ND55-F1-model_v4 | [acyl-carrier-protein] S-malonyltransferase | 0.969 | 168 | 268 |
GO:0016740
|
| AF-A0A3C0LZ96-F1-model_v4 | deleted | 0.9623 | 4 | 114 |
|
| AF-A0A382XRN8-F1-model_v4 | [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) | 0.9613 | 4 | 127 |
GO:0004314
GO:0006633 |
| AF-A0A4U3BMW2-F1-model_v4 | deleted | 0.9609 | 181 | 281 |
|
| AF-A0A377XQH9-F1-model_v4 | [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) | 0.9601 | 4 | 118 |
GO:0004314
GO:0005829 GO:0006633 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar