F378851

General Info

Members Datasets Scaffolds Average Seq Length
273 160 273 115

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_101387181|Ga0070668_1013871811
Length 122
Sequence MDSRPLVSKERAPKDSGFRSFAEFYPFYLSEHRHPVSRALHYAGTWGAVLCLLALVSTGEGWWLLGALVCGYSFAWFGHFRFERNKPATFRFPFYSLAADFRMWWDLNLGRLRFREYPRFER

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
109 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
112 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
113 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
114 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
118 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 4.76
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10185055 3300003322 Bacteria 1553
2 Ga0070676_10127951 3300005328 Bacteria 1603
3 Ga0070676_10386896 3300005328 Bacteria 970
4 Ga0070677_10001803 3300005333 Bacteria 6770
5 Ga0070677_10019138 3300005333 Bacteria 2476
6 Ga0068869_100142554 3300005334 Bacteria 1851
7 Ga0070666_10607853 3300005335 Bacteria 798
8 Ga0070682_100016133 3300005337 Bacteria 4340
9 Ga0070682_100356324 3300005337 Bacteria 1092
10 Ga0070682_101135593 3300005337 Bacteria 656
11 Ga0068868_100584017 3300005338 Bacteria 988
12 Ga0070689_100314721 3300005340 Bacteria 1306
13 Ga0070692_10779904 3300005345 Bacteria 651
14 Ga0070668_100815583 3300005347 Bacteria 830
15 Ga0070668_101387181 3300005347 Unclassified 640
16 Ga0070669_100024281 3300005353 Bacteria 4347
17 Ga0070669_100032969 3300005353 Bacteria 3744
18 Ga0070669_101492655 3300005353 Bacteria 587
19 Ga0070675_100022304 3300005354 Bacteria 5058
20 Ga0070675_100040117 3300005354 Bacteria 3821
21 Ga0070671_100105086 3300005355 Bacteria 2370
22 Ga0070671_100253770 3300005355 Bacteria 1494
23 Ga0070671_100290643 3300005355 Bacteria 1391
24 Ga0070671_100746848 3300005355 Bacteria 850
25 Ga0070674_100019263 3300005356 Bacteria 4333
26 Ga0070674_100029575 3300005356 Bacteria 3611
27 Ga0070674_101719532 3300005356 Bacteria 567
28 Ga0070673_100034287 3300005364 Bacteria 3839
29 Ga0070673_100944487 3300005364 Bacteria 801
30 Ga0070688_100006679 3300005365 Bacteria 6182
31 Ga0070688_100125605 3300005365 Bacteria 1724
32 Ga0070667_100380829 3300005367 Bacteria 1281
33 Ga0070667_100382222 3300005367 Bacteria 1279
34 Ga0070709_10107559 3300005434 Bacteria 1869
35 Ga0070701_10078566 3300005438 Bacteria 1781
36 Ga0070701_10130956 3300005438 Bacteria 1425
37 Ga0070701_10623448 3300005438 Bacteria 717
38 Ga0070700_100045447 3300005441 Bacteria 2709
39 Ga0070700_100412218 3300005441 Bacteria 1019
40 Ga0070663_100227670 3300005455 Bacteria 1467
41 Ga0070663_100655584 3300005455 Bacteria 888
42 Ga0070678_100072135 3300005456 Bacteria 2587
43 Ga0070662_100459112 3300005457 Unclassified 1058
44 Ga0068867_100551165 3300005459 Bacteria 999
45 Ga0070672_100011114 3300005543 Bacteria 6270
46 Ga0070672_100124962 3300005543 Bacteria 2109
47 Ga0070672_100182010 3300005543 Bacteria 1751
48 Ga0070672_100407784 3300005543 Bacteria 1166
49 Ga0070672_100601690 3300005543 Bacteria 957
50 Ga0070686_100107450 3300005544 Bacteria 1895
51 Ga0070686_100566387 3300005544 Bacteria 891
52 Ga0070686_100613230 3300005544 Bacteria 859
53 Ga0070693_100807750 3300005547 Bacteria 696
54 Ga0070665_100931823 3300005548 Bacteria 881
55 Ga0070665_101941984 3300005548 Bacteria 594
56 Ga0068857_101485115 3300005577 Bacteria 660
57 Ga0068859_100041938 3300005617 Bacteria 4597
58 Ga0068859_100097274 3300005617 Bacteria 2996
59 Ga0068864_101215161 3300005618 Bacteria 753
60 Ga0068864_101872019 3300005618 Bacteria 606
61 Ga0068861_100070547 3300005719 Bacteria 2706
62 Ga0068861_100231059 3300005719 Bacteria 1569
63 Ga0068861_100306978 3300005719 Bacteria 1377
64 Ga0068870_10003232 3300005840 Bacteria 6880
65 Ga0068870_10607396 3300005840 Unclassified 744
66 Ga0068863_100327709 3300005841 Bacteria 1488
67 Ga0068860_100072602 3300005843 Bacteria 3270
68 Ga0068860_101436164 3300005843 Bacteria 711
69 Ga0068860_102606846 3300005843 Bacteria 525
70 Ga0068862_100125518 3300005844 Bacteria 2266
71 Ga0068862_100143095 3300005844 Bacteria 2124
72 Ga0068862_101221197 3300005844 Bacteria 751
73 Ga0070715_10090798 3300006163 Bacteria 1405
74 Ga0070712_101945086 3300006175 Bacteria 515
75 Ga0075366_10523293 3300006195 Bacteria 734
76 Ga0097621_100164617 3300006237 Bacteria 1908
77 Ga0097621_100188854 3300006237 Bacteria 1783
78 Ga0068871_100503374 3300006358 Bacteria 1092
79 Ga0075429_101423289 3300006880 Unclassified 604
80 Ga0068865_100074804 3300006881 Bacteria 2413
81 Ga0068865_100541020 3300006881 Bacteria 977
82 Ga0097620_100041938 3300006931 Bacteria 4597
83 Ga0097620_100097275 3300006931 Bacteria 2996
84 Ga0111539_10091488 3300009094 Bacteria 3574
85 Ga0111539_10352871 3300009094 Bacteria 1712
86 Ga0111539_10988314 3300009094 Bacteria 978
87 Ga0111539_12948240 3300009094 Unclassified 550
88 Ga0105243_10384809 3300009148 Bacteria 1299
89 Ga0105243_10975353 3300009148 Bacteria 848
90 Ga0105243_11056803 3300009148 Unclassified 818
91 Ga0105243_11422894 3300009148 Bacteria 715
92 Ga0105242_11413937 3300009176 Bacteria 723
93 Ga0105248_11318422 3300009177 Bacteria 817
94 Ga0105237_11528895 3300009545 Bacteria 674
95 Ga0105249_10192171 3300009553 Bacteria 1993
96 Ga0105249_13079558 3300009553 Bacteria 536
97 Ga0105246_11210602 3300011119 Unclassified 696
98 Ga0157370_11207368 3300013104 Bacteria 682
99 Ga0157374_11043402 3300013296 Bacteria 837
100 Ga0157378_10724748 3300013297 Bacteria 1015
101 Ga0157378_11390789 3300013297 Bacteria 744
102 Ga0163162_10103156 3300013306 Bacteria 2946
103 Ga0157375_10166979 3300013308 Bacteria 2346
104 Ga0163163_10662711 3300014325 Bacteria 1107
105 Ga0157380_10017091 3300014326 Bacteria 5362
106 Ga0157380_10043079 3300014326 Bacteria 3531
107 Ga0157380_10215222 3300014326 Bacteria 1715
108 Ga0157380_10338590 3300014326 Bacteria 1402
109 Ga0157380_10393409 3300014326 Bacteria 1312
110 Ga0157380_10538011 3300014326 Bacteria 1143
111 Ga0157380_10613598 3300014326 Bacteria 1079
112 Ga0157377_10198366 3300014745 Bacteria 1273
113 Ga0157379_10072962 3300014968 Bacteria 3072
114 Ga0157376_10183487 3300014969 Bacteria 1914
115 Ga0163161_10350927 3300017792 Bacteria 1173
116 Ga0207682_10003239 3300025893 Bacteria 7121
117 Ga0207682_10008362 3300025893 Bacteria 4093
118 Ga0207682_10098161 3300025893 Bacteria 1277
119 Ga0207688_10647739 3300025901 Bacteria 667
120 Ga0207645_10060127 3300025907 Bacteria 2426
121 Ga0207662_10107355 3300025918 Bacteria 1737
122 Ga0207681_10019540 3300025923 Bacteria 4282
123 Ga0207681_10539963 3300025923 Bacteria 958
124 Ga0207681_11091182 3300025923 Bacteria 670
125 Ga0207650_10178818 3300025925 Bacteria 1690
126 Ga0207659_10013931 3300025926 Bacteria 5171
127 Ga0207659_10160930 3300025926 Bacteria 1762
128 Ga0207644_10211798 3300025931 Bacteria 1533
129 Ga0207644_10534124 3300025931 Bacteria 970
130 Ga0207644_11143897 3300025931 Bacteria 654
131 Ga0207709_10874093 3300025935 Unclassified 729
132 Ga0207670_10270412 3300025936 Bacteria 1321
133 Ga0207670_11113939 3300025936 Bacteria 667
134 Ga0207669_10007379 3300025937 Bacteria 5080
135 Ga0207704_10823771 3300025938 Bacteria 776
136 Ga0207691_10005505 3300025940 Bacteria 12237
137 Ga0207691_10008332 3300025940 Bacteria 9956
138 Ga0207691_10009993 3300025940 Bacteria 9113
139 Ga0207691_10334642 3300025940 Bacteria 1297
140 Ga0207689_10008474 3300025942 Bacteria 8957
141 Ga0207651_10008440 3300025960 Bacteria 5565
142 Ga0207651_10057642 3300025960 Bacteria 2680
143 Ga0207651_11035234 3300025960 Bacteria 734
144 Ga0207668_10156880 3300025972 Bacteria 1769
145 Ga0207668_10193746 3300025972 Bacteria 1613
146 Ga0207668_11359457 3300025972 Unclassified 640
147 Ga0207658_10309888 3300025986 Bacteria 1363
148 Ga0207678_10197951 3300026067 Bacteria 1717
149 Ga0207678_10267127 3300026067 Bacteria 1467
150 Ga0207708_10018510 3300026075 Bacteria 5247
151 Ga0207708_10019207 3300026075 Bacteria 5148
152 Ga0207708_10161320 3300026075 Bacteria 1771
153 Ga0207641_10032369 3300026088 Bacteria 4341
154 Ga0207648_10022150 3300026089 Bacteria 5708
155 Ga0207648_10150984 3300026089 Bacteria 2050
156 Ga0207648_11381217 3300026089 Bacteria 662
157 Ga0207676_11263584 3300026095 Bacteria 733
158 Ga0207674_10409094 3300026116 Bacteria 1311
159 Ga0207675_100071010 3300026118 Bacteria 3255
160 Ga0207675_100104208 3300026118 Bacteria 2673
161 Ga0207675_100132642 3300026118 Bacteria 2362
162 Ga0207675_100385728 3300026118 Bacteria 1378
163 Ga0207675_100736507 3300026118 Bacteria 996
164 Ga0207683_10025019 3300026121 Bacteria 5147
165 Ga0207683_11102103 3300026121 Unclassified 737
166 Ga0207698_11741201 3300026142 Bacteria 638
167 Ga0207428_10219745 3300027907 Bacteria 1425
168 Ga0268266_10427042 3300028379 Bacteria 1257
169 Ga0268266_10727275 3300028379 Bacteria 957
170 Ga0268265_10022528 3300028380 Bacteria 4428
171 Ga0268265_10523405 3300028380 Bacteria 1121
172 Ga0268264_10067238 3300028381 Bacteria 3024
173 Ga0268264_10418529 3300028381 Bacteria 1292
174 Ga0268264_11319869 3300028381 Unclassified 732
175 Ga0307515_10753975 3300028794 Unclassified 593
176 Ga0307513_10010158 3300031456 Bacteria 11836
177 Ga0307513_10013964 3300031456 Bacteria 9841
178 Ga0307513_10059295 3300031456 Bacteria 4063
179 Ga0307513_10632948 3300031456 Bacteria 777
180 Ga0307509_10128267 3300031507 Bacteria 2498
181 Ga0307408_100301571 3300031548 Bacteria 1342
182 Ga0307408_101399539 3300031548 Bacteria 658
183 Ga0307405_10247319 3300031731 Bacteria 1325
184 Ga0307405_10646233 3300031731 Bacteria 869
185 Ga0307405_11907281 3300031731 Bacteria 530
186 Ga0307413_10289955 3300031824 Unclassified 1235
187 Ga0307410_10011901 3300031852 Bacteria 5001
188 Ga0307410_10126513 3300031852 Bacteria 1871
189 Ga0307406_10481718 3300031901 Bacteria 1002
190 Ga0307406_11390750 3300031901 Bacteria 615
191 Ga0307407_10094417 3300031903 Bacteria 1841
192 Ga0307407_10347340 3300031903 Unclassified 1049
193 Ga0307412_11439027 3300031911 Bacteria 625
194 Ga0307409_100011706 3300031995 Bacteria 5548
195 Ga0307409_100299023 3300031995 Bacteria 1496
196 Ga0307409_100521493 3300031995 Bacteria 1161
197 Ga0307416_100093776 3300032002 Bacteria 2587
198 Ga0307416_100696169 3300032002 Bacteria 1105
199 Ga0307414_11354883 3300032004 Bacteria 661
200 Ga0307411_10009093 3300032005 Bacteria 5199
201 Ga0307411_10088942 3300032005 Bacteria 2150
202 Ga0307415_100117868 3300032126 Bacteria 1984
203 Ga0307415_100649571 3300032126 Bacteria 945
204 Ga0373939_0365620 3300035114 Bacteria 590
205 Ga0451789_1038442 3300041443 Unclassified 725
206 Ga0451789_1190880 3300041443 Bacteria 1350
207 Ga0451791_0980533 3300041451 Bacteria 3103
208 Ga0451791_1028070 3300041451 Bacteria 516
209 Ga0451791_1101669 3300041451 Bacteria 758
210 Ga0451795_0293419 3300041456 Unclassified 657
211 Ga0451798_0497739 3300041458 Unclassified 733
212 Ga0451800_0402211 3300041459 Bacteria 1552
213 Ga0451804_0127672 3300041463 Bacteria 678
214 Ga0451807_0470364 3300041486 Bacteria 1051
215 Ga0451807_1300771 3300041486 Bacteria 2695
216 Ga0451807_1323559 3300041486 Bacteria 1662
217 Ga0451837_1029966 3300041494 Bacteria 3320
218 Ga0451843_0819289 3300041509 Unclassified 639
219 Ga0451855_1384785 3300041511 Unclassified 649
220 Ga0451853_2504078 3300041512 Bacteria 1127
221 Ga0439459_0052464 3300042438 Bacteria 900
222 Ga0495590_0005899 3300046457 Bacteria 4806
223 Ga0495638_0012140 3300046460 Bacteria 5913
224 Ga0495616_0059286 3300046513 Bacteria 1883
225 Ga0495631_0295349 3300046518 Bacteria 690
226 Ga0495632_0100272 3300046519 Bacteria 1365
227 Ga0495598_0041384 3300046537 Bacteria 1348
228 Ga0495621_0151944 3300046539 Bacteria 911
229 Ga0495622_0512491 3300046557 Bacteria 512
230 Ga0495668_0095201 3300046616 Bacteria 1630
231 Ga0495668_0365564 3300046616 Unclassified 792
232 Ga0495611_0085610 3300046648 Bacteria 1454
233 Ga0495669_0218311 3300046684 Bacteria 914
234 Ga0495670_0452493 3300046691 Bacteria 696
235 Ga0495671_0063306 3300046692 Bacteria 1822
236 Ga0495649_0205676 3300046694 Bacteria 1021
237 Ga0495649_0236797 3300046694 Bacteria 941
238 Ga0495649_0440820 3300046694 Unclassified 651
239 Ga0495686_0059594 3300047472 Bacteria 2376
240 Ga0495686_0276595 3300047472 Bacteria 934
241 Ga0496114_0042777 3300048917 Bacteria 3755
242 Ga0495678_156959 3300049459 Bacteria 730
243 Ga0501036_0257901 3300049572 Bacteria 1461
244 Ga0501037_0703971 3300049573 Bacteria 672
245 Ga0501038_0509823 3300049574 Bacteria 919
246 Ga0501042_0067394 3300049578 Bacteria 2559
247 Ga0501042_0776063 3300049578 Bacteria 697
248 Ga0501067_0122010 3300049583 Bacteria 1450
249 Ga0501067_0830623 3300049583 Bacteria 521
250 Ga0501068_0057134 3300049584 Bacteria 2365
251 Ga0501068_0103640 3300049584 Bacteria 1765
252 Ga0501068_0530375 3300049584 Bacteria 765
253 Ga0501069_0118881 3300049585 Bacteria 1509
254 Ga0501071_0198583 3300049587 Bacteria 1506
255 Ga0501071_0319557 3300049587 Bacteria 1179
256 Ga0501072_0986173 3300049588 Bacteria 657
257 Ga0501073_0013615 3300049589 Bacteria 5916
258 Ga0501074_0147136 3300049590 Bacteria 1684
259 Ga0501076_0245474 3300049592 Bacteria 1465
260 Ga0501077_0156484 3300049593 Bacteria 1446
261 Ga0501079_0094821 3300049741 Bacteria 2312
262 Ga0501080_0062883 3300049742 Bacteria 3454
263 Ga0501080_0348760 3300049742 Bacteria 1337
264 Ga0501083_0094376 3300049744 Bacteria 1975
265 Ga0501266_090817 3300049763 Bacteria 530
266 nmdc:mga08y16_2101601_c1 3300050511 Bacteria 512
267 nmdc:mga08y16_317469_c1 3300050511 Bacteria 1604
268 nmdc:mga08y16_59710_c1 3300050511 Bacteria 3983
269 Ga0500644_0328284 3300053088 Bacteria 659
270 Ga0500611_094867 3300053727 Bacteria 765
271 Ga0501084_0094482 3300054114 Bacteria 2510
272 Ga0501082_0173271 3300060353 Bacteria 1876
273 Ga0530510_0555072 3300061734 Bacteria 872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005547 Ga0070693_100807750 Ga0070693_1008077502 101
2 3300035114 Ga0373939_0365620 Ga0373939_0365620_29_370 110
3 3300041451 Ga0451791_1101669 Ga0451791_1101669_294_641 111
4 3300041486 Ga0451807_1300771 Ga0451807_1300771_1176_1523 111
5 3300046457 Ga0495590_0005899 Ga0495590_0005899_4057_4392 111
6 3300046616 Ga0495668_0095201 Ga0495668_0095201_926_1261 111
7 3300046648 Ga0495611_0085610 Ga0495611_0085610_429_764 111
8 3300046684 Ga0495669_0218311 Ga0495669_0218311_486_821 111
9 3300046694 Ga0495649_0205676 Ga0495649_0205676_518_853 111
10 3300049459 Ga0495678_156959 Ga0495678_156959_107_442 111
11 3300005328 Ga0070676_10386896 Ga0070676_103868961 112
12 3300005333 Ga0070677_10001803 Ga0070677_100018036 112
13 3300005334 Ga0068869_100142554 Ga0068869_1001425542 112
14 3300005353 Ga0070669_100032969 Ga0070669_1000329692 112
15 3300005354 Ga0070675_100040117 Ga0070675_1000401173 112
16 3300005355 Ga0070671_100290643 Ga0070671_1002906432 112
17 3300005356 Ga0070674_100019263 Ga0070674_1000192631 112
18 3300005356 Ga0070674_101719532 Ga0070674_1017195322 112
19 3300005364 Ga0070673_100034287 Ga0070673_1000342875 112
20 3300005365 Ga0070688_100006679 Ga0070688_1000066792 112
21 3300005367 Ga0070667_100380829 Ga0070667_1003808292 112
22 3300005438 Ga0070701_10130956 Ga0070701_101309562 112
23 3300005456 Ga0070678_100072135 Ga0070678_1000721352 112
24 3300005543 Ga0070672_100182010 Ga0070672_1001820102 112
25 3300005543 Ga0070672_100407784 Ga0070672_1004077842 112
26 3300005543 Ga0070672_100601690 Ga0070672_1006016901 112
27 3300005544 Ga0070686_100566387 Ga0070686_1005663872 112
28 3300005548 Ga0070665_100931823 Ga0070665_1009318232 112
29 3300005618 Ga0068864_101215161 Ga0068864_1012151611 112
30 3300005719 Ga0068861_100070547 Ga0068861_1000705472 112
31 3300005840 Ga0068870_10003232 Ga0068870_100032326 112
32 3300005841 Ga0068863_100327709 Ga0068863_1003277091 112
33 3300005844 Ga0068862_100143095 Ga0068862_1001430952 112
34 3300005844 Ga0068862_101221197 Ga0068862_1012211971 112
35 3300006237 Ga0097621_100188854 Ga0097621_1001888542 112
36 3300006880 Ga0075429_101423289 Ga0075429_1014232891 112
37 3300006881 Ga0068865_100074804 Ga0068865_1000748042 112
38 3300009148 Ga0105243_10384809 Ga0105243_103848092 112
39 3300009148 Ga0105243_11422894 Ga0105243_114228942 112
40 3300009553 Ga0105249_10192171 Ga0105249_101921712 112
41 3300009553 Ga0105249_13079558 Ga0105249_130795581 112
42 3300013296 Ga0157374_11043402 Ga0157374_110434021 112
43 3300013297 Ga0157378_10724748 Ga0157378_107247482 112
44 3300013306 Ga0163162_10103156 Ga0163162_101031562 112
45 3300014325 Ga0163163_10662711 Ga0163163_106627112 112
46 3300014326 Ga0157380_10215222 Ga0157380_102152221 112
47 3300014326 Ga0157380_10393409 Ga0157380_103934092 112
48 3300014326 Ga0157380_10538011 Ga0157380_105380112 112
49 3300014968 Ga0157379_10072962 Ga0157379_100729622 112
50 3300017792 Ga0163161_10350927 Ga0163161_103509272 112
51 3300025893 Ga0207682_10008362 Ga0207682_100083622 112
52 3300025901 Ga0207688_10647739 Ga0207688_106477392 112
53 3300025923 Ga0207681_10539963 Ga0207681_105399632 112
54 3300025926 Ga0207659_10013931 Ga0207659_100139312 112
55 3300025931 Ga0207644_10534124 Ga0207644_105341242 112
56 3300025936 Ga0207670_11113939 Ga0207670_111139391 112
57 3300025937 Ga0207669_10007379 Ga0207669_100073792 112
58 3300025938 Ga0207704_10823771 Ga0207704_108237712 112
59 3300025940 Ga0207691_10008332 Ga0207691_100083321 112
60 3300025942 Ga0207689_10008474 Ga0207689_100084747 112
61 3300025960 Ga0207651_10008440 Ga0207651_100084403 112
62 3300026067 Ga0207678_10197951 Ga0207678_101979512 112
63 3300026075 Ga0207708_10019207 Ga0207708_100192074 112
64 3300026088 Ga0207641_10032369 Ga0207641_100323693 112
65 3300026089 Ga0207648_10022150 Ga0207648_100221505 112
66 3300026095 Ga0207676_11263584 Ga0207676_112635842 112
67 3300026118 Ga0207675_100132642 Ga0207675_1001326422 112
68 3300026118 Ga0207675_100736507 Ga0207675_1007365072 112
69 3300026121 Ga0207683_10025019 Ga0207683_100250194 112
70 3300028379 Ga0268266_10727275 Ga0268266_107272752 112
71 3300028380 Ga0268265_10523405 Ga0268265_105234052 112
72 3300031456 Ga0307513_10010158 Ga0307513_100101582 112
73 3300031901 Ga0307406_10481718 Ga0307406_104817182 112
74 3300031901 Ga0307406_11390750 Ga0307406_113907502 112
75 3300031911 Ga0307412_11439027 Ga0307412_114390271 112
76 3300041443 Ga0451789_1038442 Ga0451789_1038442_175_513 112
77 3300041451 Ga0451791_0980533 Ga0451791_0980533_830_1168 112
78 3300041456 Ga0451795_0293419 Ga0451795_0293419_102_440 112
79 3300041463 Ga0451804_0127672 Ga0451804_0127672_208_546 112
80 3300041486 Ga0451807_0470364 Ga0451807_0470364_391_729 112
81 3300041486 Ga0451807_1323559 Ga0451807_1323559_735_1073 112
82 3300041494 Ga0451837_1029966 Ga0451837_1029966_366_704 112
83 3300041509 Ga0451843_0819289 Ga0451843_0819289_59_397 112
84 3300041511 Ga0451855_1384785 Ga0451855_1384785_275_613 112
85 3300042438 Ga0439459_0052464 Ga0439459_0052464_357_695 112
86 3300046513 Ga0495616_0059286 Ga0495616_0059286_581_919 112
87 3300046537 Ga0495598_0041384 Ga0495598_0041384_731_1069 112
88 3300046539 Ga0495621_0151944 Ga0495621_0151944_332_670 112
89 3300046692 Ga0495671_0063306 Ga0495671_0063306_356_694 112
90 3300046694 Ga0495649_0236797 Ga0495649_0236797_123_461 112
91 3300046694 Ga0495649_0440820 Ga0495649_0440820_28_366 112
92 3300049584 Ga0501068_0530375 Ga0501068_0530375_288_626 112
93 3300049585 Ga0501069_0118881 Ga0501069_0118881_619_957 112
94 3300049587 Ga0501071_0319557 Ga0501071_0319557_675_1013 112
95 3300049763 Ga0501266_090817 Ga0501266_090817_15_353 112
96 3300053088 Ga0500644_0328284 Ga0500644_0328284_273_611 112
97 3300053727 Ga0500611_094867 Ga0500611_094867_270_608 112
98 3300005328 Ga0070676_10127951 Ga0070676_101279511 113
99 3300005333 Ga0070677_10019138 Ga0070677_100191382 113
100 3300005335 Ga0070666_10607853 Ga0070666_106078532 113
101 3300005337 Ga0070682_100356324 Ga0070682_1003563242 113
102 3300005354 Ga0070675_100022304 Ga0070675_1000223043 113
103 3300005355 Ga0070671_100105086 Ga0070671_1001050862 113
104 3300005356 Ga0070674_100029575 Ga0070674_1000295752 113
105 3300005455 Ga0070663_100227670 Ga0070663_1002276702 113
106 3300005455 Ga0070663_100655584 Ga0070663_1006555842 113
107 3300005459 Ga0068867_100551165 Ga0068867_1005511652 113
108 3300005543 Ga0070672_100011114 Ga0070672_1000111146 113
109 3300005544 Ga0070686_100107450 Ga0070686_1001074502 113
110 3300005544 Ga0070686_100613230 Ga0070686_1006132302 113
111 3300005548 Ga0070665_101941984 Ga0070665_1019419842 113
112 3300009094 Ga0111539_12948240 Ga0111539_129482402 113
113 3300009176 Ga0105242_11413937 Ga0105242_114139372 113
114 3300014326 Ga0157380_10043079 Ga0157380_100430792 113
115 3300014326 Ga0157380_10338590 Ga0157380_103385902 113
116 3300014326 Ga0157380_10613598 Ga0157380_106135981 113
117 3300014745 Ga0157377_10198366 Ga0157377_101983662 113
118 3300025893 Ga0207682_10003239 Ga0207682_100032395 113
119 3300025907 Ga0207645_10060127 Ga0207645_100601272 113
120 3300025925 Ga0207650_10178818 Ga0207650_101788182 113
121 3300025926 Ga0207659_10160930 Ga0207659_101609301 113
122 3300025931 Ga0207644_10211798 Ga0207644_102117982 113
123 3300025940 Ga0207691_10005505 Ga0207691_100055056 113
124 3300025960 Ga0207651_10057642 Ga0207651_100576422 113
125 3300025972 Ga0207668_10156880 Ga0207668_101568802 113
126 3300025986 Ga0207658_10309888 Ga0207658_103098882 113
127 3300026067 Ga0207678_10267127 Ga0207678_102671272 113
128 3300028379 Ga0268266_10427042 Ga0268266_104270422 113
129 3300028381 Ga0268264_10418529 Ga0268264_104185292 113
130 3300028794 Ga0307515_10753975 Ga0307515_107539751 113
131 3300031456 Ga0307513_10013964 Ga0307513_1001396411 113
132 3300031456 Ga0307513_10632948 Ga0307513_106329482 113
133 3300031731 Ga0307405_10247319 Ga0307405_102473191 113
134 3300031731 Ga0307405_11907281 Ga0307405_119072811 113
135 3300031995 Ga0307409_100521493 Ga0307409_1005214932 113
136 3300032005 Ga0307411_10088942 Ga0307411_100889422 113
137 3300041443 Ga0451789_1190880 Ga0451789_1190880_778_1119 113
138 3300041451 Ga0451791_1028070 Ga0451791_1028070_99_440 113
139 3300041458 Ga0451798_0497739 Ga0451798_0497739_264_605 113
140 3300041459 Ga0451800_0402211 Ga0451800_0402211_266_607 113
141 3300041512 Ga0451853_2504078 Ga0451853_2504078_649_990 113
142 3300046460 Ga0495638_0012140 Ga0495638_0012140_3668_4009 113
143 3300046518 Ga0495631_0295349 Ga0495631_0295349_98_439 113
144 3300046519 Ga0495632_0100272 Ga0495632_0100272_446_787 113
145 3300046557 Ga0495622_0512491 Ga0495622_0512491_141_482 113
146 3300046616 Ga0495668_0365564 Ga0495668_0365564_104_445 113
147 3300047472 Ga0495686_0059594 Ga0495686_0059594_395_736 113
148 3300049572 Ga0501036_0257901 Ga0501036_0257901_1046_1387 113
149 3300049578 Ga0501042_0776063 Ga0501042_0776063_206_550 113
150 3300049584 Ga0501068_0103640 Ga0501068_0103640_249_590 113
151 3300049742 Ga0501080_0348760 Ga0501080_0348760_333_677 113
152 3300050511 nmdc:mga08y16_2101601_c1 nmdc:mga08y16_2101601_c1_49_390 113
153 3300031507 Ga0307509_10128267 Ga0307509_101282672 114
154 3300047472 Ga0495686_0276595 Ga0495686_0276595_443_787 114
155 3300005337 Ga0070682_101135593 Ga0070682_1011355932 115
156 3300005355 Ga0070671_100253770 Ga0070671_1002537702 115
157 3300005434 Ga0070709_10107559 Ga0070709_101075592 115
158 3300006163 Ga0070715_10090798 Ga0070715_100907981 115
159 3300006175 Ga0070712_101945086 Ga0070712_1019450861 115
160 3300006237 Ga0097621_100164617 Ga0097621_1001646172 115
161 3300009148 Ga0105243_10975353 Ga0105243_109753532 115
162 3300009545 Ga0105237_11528895 Ga0105237_115288951 115
163 3300013297 Ga0157378_11390789 Ga0157378_113907892 115
164 3300014969 Ga0157376_10183487 Ga0157376_101834872 115
165 3300026142 Ga0207698_11741201 Ga0207698_117412012 115
166 3300048917 Ga0496114_0042777 Ga0496114_0042777_594_941 115
167 3300005340 Ga0070689_100314721 Ga0070689_1003147212 116
168 3300005347 Ga0070668_100815583 Ga0070668_1008155832 116
169 3300005365 Ga0070688_100125605 Ga0070688_1001256052 116
170 3300005438 Ga0070701_10078566 Ga0070701_100785662 116
171 3300005441 Ga0070700_100412218 Ga0070700_1004122181 116
172 3300005617 Ga0068859_100041938 Ga0068859_1000419383 116
173 3300005618 Ga0068864_101872019 Ga0068864_1018720192 116
174 3300005843 Ga0068860_102606846 Ga0068860_1026068461 116
175 3300006881 Ga0068865_100541020 Ga0068865_1005410202 116
176 3300006931 Ga0097620_100041938 Ga0097620_1000419383 116
177 3300009094 Ga0111539_10352871 Ga0111539_103528712 116
178 3300009177 Ga0105248_11318422 Ga0105248_113184221 116
179 3300025918 Ga0207662_10107355 Ga0207662_101073552 116
180 3300025936 Ga0207670_10270412 Ga0207670_102704122 116
181 3300025940 Ga0207691_10334642 Ga0207691_103346422 116
182 3300025972 Ga0207668_10193746 Ga0207668_101937462 116
183 3300026075 Ga0207708_10161320 Ga0207708_101613202 116
184 3300026118 Ga0207675_100385728 Ga0207675_1003857282 116
185 3300031456 Ga0307513_10059295 Ga0307513_100592952 116
186 3300031548 Ga0307408_100301571 Ga0307408_1003015712 116
187 3300031824 Ga0307413_10289955 Ga0307413_102899552 116
188 3300031852 Ga0307410_10011901 Ga0307410_100119013 116
189 3300031903 Ga0307407_10347340 Ga0307407_103473402 116
190 3300031995 Ga0307409_100011706 Ga0307409_1000117062 116
191 3300032002 Ga0307416_100093776 Ga0307416_1000937762 116
192 3300032002 Ga0307416_100696169 Ga0307416_1006961692 116
193 3300032004 Ga0307414_11354883 Ga0307414_113548832 116
194 3300032126 Ga0307415_100117868 Ga0307415_1001178682 116
195 3300049578 Ga0501042_0067394 Ga0501042_0067394_495_845 116
196 3300005347 Ga0070668_101387181 Ga0070668_1013871811 117
197 3300005353 Ga0070669_100024281 Ga0070669_1000242812 117
198 3300005353 Ga0070669_101492655 Ga0070669_1014926551 117
199 3300005355 Ga0070671_100746848 Ga0070671_1007468482 117
200 3300005364 Ga0070673_100944487 Ga0070673_1009444872 117
201 3300005367 Ga0070667_100382222 Ga0070667_1003822222 117
202 3300005438 Ga0070701_10623448 Ga0070701_106234482 117
203 3300005441 Ga0070700_100045447 Ga0070700_1000454472 117
204 3300005457 Ga0070662_100459112 Ga0070662_1004591122 117
205 3300005543 Ga0070672_100124962 Ga0070672_1001249621 117
206 3300005577 Ga0068857_101485115 Ga0068857_1014851152 117
207 3300005617 Ga0068859_100097274 Ga0068859_1000972742 117
208 3300005719 Ga0068861_100306978 Ga0068861_1003069782 117
209 3300005840 Ga0068870_10607396 Ga0068870_106073962 117
210 3300005843 Ga0068860_100072602 Ga0068860_1000726022 117
211 3300005843 Ga0068860_101436164 Ga0068860_1014361642 117
212 3300005844 Ga0068862_100125518 Ga0068862_1001255182 117
213 3300006358 Ga0068871_100503374 Ga0068871_1005033742 117
214 3300006931 Ga0097620_100097275 Ga0097620_1000972752 117
215 3300009094 Ga0111539_10091488 Ga0111539_100914882 117
216 3300009094 Ga0111539_10988314 Ga0111539_109883142 117
217 3300009148 Ga0105243_11056803 Ga0105243_110568032 117
218 3300011119 Ga0105246_11210602 Ga0105246_112106021 117
219 3300013104 Ga0157370_11207368 Ga0157370_112073681 117
220 3300013308 Ga0157375_10166979 Ga0157375_101669792 117
221 3300014326 Ga0157380_10017091 Ga0157380_100170912 117
222 3300025893 Ga0207682_10098161 Ga0207682_100981611 117
223 3300025923 Ga0207681_10019540 Ga0207681_100195404 117
224 3300025923 Ga0207681_11091182 Ga0207681_110911822 117
225 3300025931 Ga0207644_11143897 Ga0207644_111438972 117
226 3300025935 Ga0207709_10874093 Ga0207709_108740932 117
227 3300025940 Ga0207691_10009993 Ga0207691_100099934 117
228 3300025960 Ga0207651_11035234 Ga0207651_110352341 117
229 3300025972 Ga0207668_11359457 Ga0207668_113594572 117
230 3300026075 Ga0207708_10018510 Ga0207708_100185103 117
231 3300026089 Ga0207648_10150984 Ga0207648_101509842 117
232 3300026089 Ga0207648_11381217 Ga0207648_113812172 117
233 3300026116 Ga0207674_10409094 Ga0207674_104090942 117
234 3300026118 Ga0207675_100104208 Ga0207675_1001042082 117
235 3300027907 Ga0207428_10219745 Ga0207428_102197452 117
236 3300028380 Ga0268265_10022528 Ga0268265_100225283 117
237 3300028381 Ga0268264_10067238 Ga0268264_100672382 117
238 3300028381 Ga0268264_11319869 Ga0268264_113198692 117
239 3300046691 Ga0495670_0452493 Ga0495670_0452493_55_408 117
240 3300049573 Ga0501037_0703971 Ga0501037_0703971_56_424 117
241 3300049574 Ga0501038_0509823 Ga0501038_0509823_133_501 117
242 3300049583 Ga0501067_0122010 Ga0501067_0122010_35_403 117
243 3300049583 Ga0501067_0830623 Ga0501067_0830623_138_497 117
244 3300049584 Ga0501068_0057134 Ga0501068_0057134_1973_2341 117
245 3300049587 Ga0501071_0198583 Ga0501071_0198583_954_1322 117
246 3300049588 Ga0501072_0986173 Ga0501072_0986173_196_564 117
247 3300049589 Ga0501073_0013615 Ga0501073_0013615_4647_5015 117
248 3300049590 Ga0501074_0147136 Ga0501074_0147136_800_1168 117
249 3300049592 Ga0501076_0245474 Ga0501076_0245474_700_1068 117
250 3300049593 Ga0501077_0156484 Ga0501077_0156484_527_895 117
251 3300049741 Ga0501079_0094821 Ga0501079_0094821_215_583 117
252 3300049742 Ga0501080_0062883 Ga0501080_0062883_2206_2574 117
253 3300049744 Ga0501083_0094376 Ga0501083_0094376_1325_1693 117
254 3300050511 nmdc:mga08y16_317469_c1 nmdc:mga08y16_317469_c1_892_1260 117
255 3300050511 nmdc:mga08y16_59710_c1 nmdc:mga08y16_59710_c1_3029_3382 117
256 3300054114 Ga0501084_0094482 Ga0501084_0094482_1717_2085 117
257 3300060353 Ga0501082_0173271 Ga0501082_0173271_1160_1528 117
258 3300061734 Ga0530510_0555072 Ga0530510_0555072_30_398 117
259 3300003322 rootL2_10185055 rootL2_101850552 118
260 3300005337 Ga0070682_100016133 Ga0070682_1000161333 118
261 3300005338 Ga0068868_100584017 Ga0068868_1005840172 118
262 3300005345 Ga0070692_10779904 Ga0070692_107799041 118
263 3300005719 Ga0068861_100231059 Ga0068861_1002310592 118
264 3300006195 Ga0075366_10523293 Ga0075366_105232932 118
265 3300026118 Ga0207675_100071010 Ga0207675_1000710102 118
266 3300026121 Ga0207683_11102103 Ga0207683_111021032 118
267 3300031548 Ga0307408_101399539 Ga0307408_1013995392 118
268 3300031731 Ga0307405_10646233 Ga0307405_106462332 118
269 3300031852 Ga0307410_10126513 Ga0307410_101265132 118
270 3300031903 Ga0307407_10094417 Ga0307407_100944172 118
271 3300031995 Ga0307409_100299023 Ga0307409_1002990232 118
272 3300032005 Ga0307411_10009093 Ga0307411_100090932 118
273 3300032126 Ga0307415_100649571 Ga0307415_1006495712 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

18

112

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e0m-assembly2.cif.gz_F homotrimeric variant of tctrp9, bgl15 0.5197 10 80
8agb-assembly1.cif.gz_D structure of yeast oligosaccharylransferase complex with lipid-linked oligosaccharide bound 0.4669 17 104
8agb-assembly1.cif.gz_D structure of yeast oligosaccharylransferase complex with lipid-linked oligosaccharide bound 0.387 17 104
6tdv-assembly1.cif.gz_e cryo-em structure of euglena gracilis mitochondrial atp synthase, membrane region 0.3696 29 115
8e0m-assembly2.cif.gz_F homotrimeric variant of tctrp9, bgl15 0.3433 10 80
ID Description Score Start End Superfamily
af_Q57879_1_79_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6383 16 79 1.10.287.3510
af_O44746_1_178_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6223 17 76 1.20.140.150
af_O53313_1_187_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6052 30 83 2.60.40.10
af_A0A0R0FWV5_59_180_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5442 33 100 1.20.140.150
af_Q57879_1_79_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5231 16 79 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A537R0I0-F1-model_v4 DUF962 domain-containing protein 0.7795 15 82 GO:0016020
AF-A0A358IWU8-F1-model_v4 DUF962 domain-containing protein 0.7339 13 81 GO:0016020
AF-A0A2V8HTX1-F1-model_v4 DUF962 domain-containing protein 0.7297 13 87 GO:0016020
AF-A0A356HIV5-F1-model_v4 deleted 0.7217 17 95
AF-A0A2E8XV71-F1-model_v4 DUF962 domain-containing protein 0.7042 13 88 GO:0016020

Feature Viewer

pLDDT pTM Quality
69.73 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map