F378715

General Info

Members Datasets Scaffolds Average Seq Length
272 166 251 289

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541302|2738856443
Length 339
Sequence VHPWLKTLNNNIAPGLARGYLLNLFNLFDLLRDASLYDQLNKGMKSIITTLFLTILISSNMEANAQSFKTVETTNLKLEVYNASENAFGVASVIVSGKTDAVLIDAQFTLADAEKVASEIKKSGKKLTVIYVSHADPDYYFGLEVFKKYFPEVTAYASPATVEAIKATSQKKLDVWGERLGKAITSNVVLPQVLKGNSIDLEGQKLEIFGLDEFPAKTFVWVPSIKAVIGGINVFGTTFNLWMADAQTADARKNWITVLDKIEALHPSIVIPAHANNASPFDVSAVKHTKSYIQFYEEALKTNKTSEELIKAIKAKYPALTFETALQIGAKVNTGEMKW

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
3 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
4 2738541278 Niastella sp. CF465 Isolate Unclassified
5 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
6 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
11 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
12 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
13 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
14 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
15 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
16 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
17 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
18 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
19 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
20 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
21 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
22 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
118 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
119 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
143 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
144 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
147 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
153 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
154 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
155 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
156 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
157 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
158 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
159 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
160 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
161 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
164 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
165 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
166 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.28
Metatranscriptomes 0
Isolates 7.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.03
Nodule 0
Rhizoplane 0.37
Rhizosphere 72.06
Stem 0
Stem Tuber 0
Unclassified 16.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004587 3300001904 Bacteria 2354
2 JGI24737J22298_10002469 3300001990 Bacteria 6590
3 JGI24744J21845_10003782 3300002077 Bacteria 3124
4 rootH1_10001009 3300003316 Bacteria 29528
5 rootH1_10017673 3300003316 Bacteria 4366
6 rootH2_10024913 3300003320 Bacteria 12176
7 rootH2_10235425 3300003320 Bacteria 1975
8 rootH2_10310471 3300003320 Bacteria 1339
9 rootL2_10000188 3300003322 Bacteria 10550
10 rootL2_10037024 3300003322 Bacteria 12129
11 rootL2_10112630 3300003322 Bacteria 20226
12 rootL2_10316809 3300003322 Bacteria 1210
13 rootH1_10008215 3300003323 Bacteria 11575
14 rootH1_10088246 3300003323 Bacteria 3904
15 rootH1_10089992 3300003323 Bacteria 2926
16 Ga0055535_1000938 3300003761 Bacteria 19469
17 Ga0055531_10000696 3300003794 Bacteria 28673
18 Ga0065714_10067888 3300005288 Bacteria 5128
19 Ga0065714_10085693 3300005288 Bacteria 2136
20 Ga0065714_10092887 3300005288 Bacteria 1847
21 Ga0065714_10098617 3300005288 Bacteria 1706
22 Ga0065714_10157769 3300005288 Bacteria 1058
23 Ga0070676_10036526 3300005328 Bacteria 2831
24 Ga0070683_100001053 3300005329 Bacteria 20720
25 Ga0070666_10000146 3300005335 Bacteria 48247
26 Ga0068868_100035559 3300005338 Bacteria 3851
27 Ga0068868_100092625 3300005338 Bacteria 2436
28 Ga0070660_100051537 3300005339 Bacteria 3170
29 Ga0070671_100036761 3300005355 Bacteria 4061
30 Ga0070673_100055742 3300005364 Bacteria 3115
31 Ga0070673_100162662 3300005364 Bacteria 1899
32 Ga0070659_100000844 3300005366 Bacteria 22367
33 Ga0070659_100072355 3300005366 Bacteria 2743
34 Ga0070667_100003381 3300005367 Bacteria 13606
35 Ga0070662_100000020 3300005457 Bacteria 99425
36 Ga0068867_100000495 3300005459 Bacteria 26352
37 Ga0068867_100016808 3300005459 Bacteria 5199
38 Ga0070684_100000997 3300005535 Bacteria 20187
39 Ga0068853_100137895 3300005539 Bacteria 2188
40 Ga0068853_100167577 3300005539 Bacteria 1986
41 Ga0070672_100432934 3300005543 Bacteria 1131
42 Ga0070665_100000006 3300005548 Bacteria 718034
43 Ga0068855_100000302 3300005563 Bacteria 61501
44 Ga0068855_100019329 3300005563 Bacteria 8185
45 Ga0068855_100025220 3300005563 Bacteria 7118
46 Ga0068855_100188889 3300005563 Bacteria 2325
47 Ga0068857_100020432 3300005577 Bacteria 5823
48 Ga0068856_100043338 3300005614 Unclassified 4427
49 Ga0068856_100098570 3300005614 Bacteria 2913
50 Ga0068856_100159767 3300005614 Unclassified 2264
51 Ga0068856_100219698 3300005614 Unclassified 1916
52 Ga0068859_100003931 3300005617 Bacteria 15178
53 Ga0068859_100014563 3300005617 Bacteria 7899
54 Ga0068859_100173049 3300005617 Bacteria 2241
55 Ga0068863_100030678 3300005841 Bacteria 5133
56 Ga0068860_100000034 3300005843 Bacteria 243128
57 Ga0068860_100010052 3300005843 Bacteria 9375
58 Ga0068860_100010563 3300005843 Bacteria 9123
59 Ga0068860_100104383 3300005843 Bacteria 2706
60 Ga0068862_100635702 3300005844 Bacteria 1028
61 Ga0097621_100002757 3300006237 Bacteria 12014
62 Ga0068871_100020296 3300006358 Bacteria 5089
63 Ga0068865_100000874 3300006881 Bacteria 17075
64 Ga0068865_100020515 3300006881 Unclassified 4286
65 Ga0097620_100003931 3300006931 Bacteria 15178
66 Ga0097620_100014564 3300006931 Bacteria 7899
67 Ga0097620_100173044 3300006931 Bacteria 2241
68 Ga0105244_10000057 3300009036 Bacteria 129775
69 Ga0105240_10000954 3300009093 Bacteria 51582
70 Ga0105240_10021095 3300009093 Bacteria 8672
71 Ga0105240_10049178 3300009093 Bacteria 5323
72 Ga0105240_10473209 3300009093 Bacteria 1398
73 Ga0114129_10004115 3300009147 Bacteria 20550
74 Ga0105241_10001158 3300009174 Bacteria 20034
75 Ga0105241_10020110 3300009174 Unclassified 4931
76 Ga0105241_10167052 3300009174 Bacteria 1814
77 Ga0105241_10220494 3300009174 Unclassified 1594
78 Ga0105242_10072172 3300009176 Bacteria 2866
79 Ga0105237_10000056 3300009545 Bacteria 151313
80 Ga0105237_10000171 3300009545 Bacteria 90778
81 Ga0105237_10005233 3300009545 Bacteria 14677
82 Ga0105237_10015495 3300009545 Bacteria 7931
83 Ga0105237_10023468 3300009545 Bacteria 6320
84 Ga0105237_10027897 3300009545 Bacteria 5754
85 Ga0105237_10029846 3300009545 Bacteria 5538
86 Ga0105238_10005189 3300009551 Bacteria 12873
87 Ga0105238_10042541 3300009551 Unclassified 4600
88 Ga0105249_10583263 3300009553 Unclassified 1171
89 Ga0105239_10000047 3300010375 Bacteria 179834
90 Ga0105239_10000064 3300010375 Bacteria 151674
91 Ga0105239_10000609 3300010375 Bacteria 50949
92 Ga0105239_10002280 3300010375 Bacteria 24494
93 Ga0105239_10004842 3300010375 Bacteria 15928
94 Ga0105239_10022305 3300010375 Bacteria 6980
95 Ga0105239_10070516 3300010375 Bacteria 3839
96 Ga0105239_10102058 3300010375 Unclassified 3175
97 Ga0105239_10184834 3300010375 Unclassified 2332
98 Ga0157371_10071938 3300013102 Bacteria 2448
99 Ga0157369_10055395 3300013105 Bacteria 4281
100 Ga0157374_10010710 3300013296 Bacteria 7898
101 Ga0157374_10255283 3300013296 Unclassified 1726
102 Ga0157374_10419054 3300013296 Unclassified 1337
103 Ga0157378_10037931 3300013297 Bacteria 4270
104 Ga0157378_10047748 3300013297 Bacteria 3806
105 Ga0163162_10001344 3300013306 Bacteria 22904
106 Ga0163162_10298075 3300013306 Bacteria 1744
107 Ga0163162_10335910 3300013306 Bacteria 1643
108 Ga0157372_10226791 3300013307 Bacteria 2166
109 Ga0157375_10100753 3300013308 Bacteria 2970
110 Ga0157375_10589118 3300013308 Bacteria 1272
111 Ga0157377_10013291 3300014745 Bacteria 4165
112 Ga0157379_10226548 3300014968 Bacteria 1694
113 Ga0157376_10018856 3300014969 Bacteria 5304
114 Ga0157376_10025489 3300014969 Bacteria 4658
115 Ga0163161_10000012 3300017792 Bacteria 264639
116 Ga0163161_10003462 3300017792 Bacteria 11058
117 Ga0209258_100278 3300025242 Bacteria 86316
118 Ga0209646_1002118 3300025246 Bacteria 4621
119 Ga0209026_1002815 3300025250 Bacteria 6161
120 Ga0209148_1000248 3300025254 Bacteria 86083
121 Ga0209257_1000005 3300025304 Bacteria 1592528
122 Ga0207655_1000038 3300025728 Bacteria 348340
123 Ga0207680_10002328 3300025903 Bacteria 8840
124 Ga0207647_10000117 3300025904 Bacteria 61849
125 Ga0207645_10041862 3300025907 Bacteria 2931
126 Ga0207645_10045356 3300025907 Bacteria 2810
127 Ga0207654_10000524 3300025911 Bacteria 21970
128 Ga0207654_10021395 3300025911 Unclassified 3439
129 Ga0207654_10108994 3300025911 Unclassified 1719
130 Ga0207695_10062908 3300025913 Bacteria 3828
131 Ga0207695_10268973 3300025913 Unclassified 1600
132 Ga0207671_10001166 3300025914 Bacteria 31300
133 Ga0207671_10008588 3300025914 Bacteria 8636
134 Ga0207671_10009264 3300025914 Bacteria 8246
135 Ga0207671_10010161 3300025914 Bacteria 7795
136 Ga0207671_10013322 3300025914 Bacteria 6555
137 Ga0207671_10046076 3300025914 Unclassified 3226
138 Ga0207671_10129073 3300025914 Bacteria 1939
139 Ga0207657_10062736 3300025919 Bacteria 3180
140 Ga0207694_10100425 3300025924 Bacteria 2292
141 Ga0207650_10010140 3300025925 Bacteria 6457
142 Ga0207690_10000988 3300025932 Bacteria 18219
143 Ga0207690_10124791 3300025932 Bacteria 1876
144 Ga0207706_10000044 3300025933 Bacteria 123576
145 Ga0207686_10063111 3300025934 Bacteria 2355
146 Ga0207704_10000011 3300025938 Bacteria 180140
147 Ga0207704_10371839 3300025938 Bacteria 1119
148 Ga0207689_10135836 3300025942 Bacteria 2025
149 Ga0207689_10180980 3300025942 Bacteria 1738
150 Ga0207661_10004794 3300025944 Bacteria 9471
151 Ga0207667_10003734 3300025949 Bacteria 18783
152 Ga0207667_10046661 3300025949 Unclassified 4588
153 Ga0207651_10299271 3300025960 Bacteria 1337
154 Ga0207658_10003573 3300025986 Bacteria 10976
155 Ga0207677_10042456 3300026023 Bacteria 3015
156 Ga0207677_10065918 3300026023 Bacteria 2529
157 Ga0207702_10037026 3300026078 Bacteria 4082
158 Ga0207641_10023162 3300026088 Bacteria 5117
159 Ga0207641_10109086 3300026088 Unclassified 2451
160 Ga0207648_10000588 3300026089 Bacteria 40775
161 Ga0207648_10016182 3300026089 Bacteria 6825
162 Ga0207674_10053417 3300026116 Bacteria 4118
163 Ga0268266_10000010 3300028379 Bacteria 1030233
164 Ga0268264_10000052 3300028381 Bacteria 321218
165 Ga0268264_10012681 3300028381 Bacteria 6938
166 Ga0268264_10021596 3300028381 Bacteria 5256
167 Ga0268264_10064457 3300028381 Bacteria 3084
168 Ga0268264_10586291 3300028381 Bacteria 1097
169 Ga0307517_10005359 3300028786 Bacteria 19372
170 Ga0307515_10000010 3300028794 Bacteria 651586
171 Ga0307515_10001436 3300028794 Bacteria 53821
172 Ga0307515_10002625 3300028794 Bacteria 38659
173 Ga0307515_10014841 3300028794 Bacteria 14401
174 Ga0307515_10016588 3300028794 Bacteria 13477
175 Ga0307515_10070810 3300028794 Plasmid 4739
176 Ga0307515_10234421 3300028794 Bacteria 1620
177 Ga0307515_10247227 3300028794 Bacteria 1543
178 Ga0307511_10009116 3300030521 Bacteria 9892
179 Ga0307509_10060704 3300031507 Bacteria 3995
180 Ga0307509_10061940 3300031507 Bacteria 3947
181 Ga0307509_10153579 3300031507 Bacteria 2213
182 Ga0307509_10205289 3300031507 Bacteria 1802
183 Ga0307414_10014948 3300032004 Bacteria 4673
184 Ga0307414_10022041 3300032004 Bacteria 4009
185 Ga0307411_10000012 3300032005 Bacteria 161467
186 Ga0307507_10084184 3300033179 Bacteria 2775
187 Ga0307510_10128474 3300033180 Bacteria 2216
188 Ga0439447_004198 3300041407 Bacteria 5001
189 Ga0451804_1010488 3300041463 Bacteria 1003
190 Ga0451855_0880849 3300041511 Bacteria 967
191 Ga0453684_0012058 3300044712 Bacteria 14361
192 Ga0453684_0023357 3300044712 Bacteria 9116
193 Ga0495592_0345332 3300046454 Bacteria 956
194 Ga0495638_0097038 3300046460 Bacteria 1768
195 Ga0495651_0326499 3300046462 Bacteria 1021
196 Ga0495580_0149870 3300046472 Bacteria 1616
197 Ga0495582_0079055 3300046473 Unclassified 1825
198 Ga0495596_0021240 3300046500 Bacteria 2651
199 Ga0495606_0003840 3300046507 Bacteria 15525
200 Ga0495632_0046338 3300046519 Bacteria 2161
201 Ga0495648_0004436 3300046524 Bacteria 11991
202 Ga0495652_0067500 3300046529 Bacteria 2999
203 Ga0495654_0046337 3300046530 Bacteria 2142
204 Ga0495586_0073150 3300046535 Bacteria 1875
205 Ga0495609_0008929 3300046538 Bacteria 4876
206 Ga0495633_0000263 3300046558 Bacteria 62381
207 Ga0495668_0000054 3300046616 Bacteria 203960
208 Ga0495668_0002622 3300046616 Bacteria 14470
209 Ga0495625_0000663 3300046660 Bacteria 49012
210 Ga0495625_0002868 3300046660 Bacteria 18060
211 Ga0495625_0073848 3300046660 Bacteria 2390
212 Ga0495625_0075226 3300046660 Bacteria 2363
213 Ga0495625_0097477 3300046660 Bacteria 2024
214 Ga0495625_0158298 3300046660 Bacteria 1519
215 Ga0495647_0155803 3300046681 Bacteria 982
216 Ga0495674_0265010 3300047319 Bacteria 1411
217 Ga0495676_0135476 3300047321 Bacteria 1772
218 Ga0495687_000541 3300047443 Bacteria 45129
219 Ga0496122_0000123 3300048925 Bacteria 180420
220 Ga0501217_001363 3300049661 Unclassified 4554
221 Ga0501223_001322 3300049663 Bacteria 5735
222 Ga0501247_000622 3300049677 Bacteria 2946
223 Ga0501249_000001 3300049679 Bacteria 268580
224 Ga0501264_000055 3300049761 Bacteria 16054
225 Ga0501271_004860 3300049768 Unclassified 1291
226 nmdc:mga05p37_3826_c1 3300050507 Bacteria 17602
227 Ga0500644_0000017 3300053088 Bacteria 106518
228 Ga0500646_0003815 3300053090 Bacteria 3848
229 Ga0500583_0001003 3300053092 Bacteria 8013
230 Ga0500583_0126396 3300053092 Bacteria 1267
231 Ga0500583_0191258 3300053092 Bacteria 1018
232 Ga0500641_0000009 3300053096 Bacteria 173260
233 Ga0500641_0000311 3300053096 Bacteria 17965
234 Ga0500562_002326 3300053108 Bacteria 4771
235 Ga0500569_001326 3300053109 Bacteria 4632
236 Ga0500594_0043597 3300053118 Bacteria 1238
237 Ga0500608_000479 3300053122 Bacteria 14975
238 Ga0500618_000015 3300053125 Bacteria 175864
239 Ga0500658_0000009 3300053134 Bacteria 270303
240 Ga0500573_0197402 3300053140 Bacteria 1071
241 Ga0500589_039144 3300053147 Bacteria 2213
242 Ga0500604_0003431 3300053151 Unclassified 4269
243 Ga0500604_0005236 3300053151 Bacteria 3428
244 Ga0500616_0037400 3300053153 Bacteria 2628
245 Ga0500622_0000004 3300053156 Bacteria 557587
246 Ga0500622_0033286 3300053156 Bacteria 2702
247 Ga0500622_0064367 3300053156 Bacteria 1865
248 Ga0500624_000332 3300053157 Bacteria 15932
249 Ga0500624_001089 3300053157 Bacteria 5170
250 Ga0500633_0002007 3300053160 Bacteria 4061
251 Ga0500636_0012664 3300053177 Bacteria 4944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10098617 Ga0065714_100986172 259
2 3300046660 Ga0495625_0000663 Ga0495625_0000663_29588_30478 259
3 3300005843 Ga0068860_100000034 Ga0068860_10000003459 270
4 3300028381 Ga0268264_10000052 Ga0268264_10000052249 270
5 3300013296 Ga0157374_10419054 Ga0157374_104190542 272
6 3300009545 Ga0105237_10015495 Ga0105237_100154958 274
7 3300010375 Ga0105239_10022305 Ga0105239_100223052 274
8 3300025914 Ga0207671_10010161 Ga0207671_100101613 274
9 iso_pu_bacteria 2946019816 2946022801 274
10 iso_pu_bacteria 2929150217 2929153483 275
11 3300003322 rootL2_10037024 rootL2_100370244 277
12 3300049663 Ga0501223_001322 Ga0501223_001322_918_1751 277
13 3300049761 Ga0501264_000055 Ga0501264_000055_5789_6622 277
14 3300050507 nmdc:mga05p37_3826_c1 nmdc:mga05p37_3826_c1_9301_10134 277
15 3300048925 Ga0496122_0000123 Ga0496122_0000123_132880_133779 278
16 3300053156 Ga0500622_0033286 Ga0500622_0033286_590_1477 278
17 3300001904 JGI24736J21556_1004587 JGI24736J21556_10045874 279
18 3300001990 JGI24737J22298_10002469 JGI24737J22298_100024695 279
19 3300002077 JGI24744J21845_10003782 JGI24744J21845_100037822 279
20 3300003316 rootH1_10001009 rootH1_100010096 279
21 3300003316 rootH1_10017673 rootH1_100176734 279
22 3300003320 rootH2_10024913 rootH2_100249136 279
23 3300003320 rootH2_10235425 rootH2_102354251 279
24 3300003320 rootH2_10310471 rootH2_103104712 279
25 3300003322 rootL2_10000188 rootL2_100001885 279
26 3300003322 rootL2_10112630 rootL2_1011263012 279
27 3300003322 rootL2_10316809 rootL2_103168091 279
28 3300003323 rootH1_10008215 rootH1_1000821510 279
29 3300003323 rootH1_10088246 rootH1_100882462 279
30 3300003323 rootH1_10089992 rootH1_100899923 279
31 3300003761 Ga0055535_1000938 Ga0055535_10009387 279
32 3300003794 Ga0055531_10000696 Ga0055531_1000069625 279
33 3300005288 Ga0065714_10067888 Ga0065714_100678886 279
34 3300005288 Ga0065714_10085693 Ga0065714_100856933 279
35 3300005288 Ga0065714_10092887 Ga0065714_100928871 279
36 3300005288 Ga0065714_10157769 Ga0065714_101577691 279
37 3300005328 Ga0070676_10036526 Ga0070676_100365263 279
38 3300005329 Ga0070683_100001053 Ga0070683_1000010538 279
39 3300005335 Ga0070666_10000146 Ga0070666_1000014642 279
40 3300005338 Ga0068868_100035559 Ga0068868_1000355592 279
41 3300005338 Ga0068868_100092625 Ga0068868_1000926253 279
42 3300005339 Ga0070660_100051537 Ga0070660_1000515373 279
43 3300005355 Ga0070671_100036761 Ga0070671_1000367613 279
44 3300005364 Ga0070673_100055742 Ga0070673_1000557422 279
45 3300005364 Ga0070673_100162662 Ga0070673_1001626622 279
46 3300005366 Ga0070659_100000844 Ga0070659_10000084411 279
47 3300005366 Ga0070659_100072355 Ga0070659_1000723553 279
48 3300005367 Ga0070667_100003381 Ga0070667_10000338114 279
49 3300005457 Ga0070662_100000020 Ga0070662_10000002016 279
50 3300005459 Ga0068867_100000495 Ga0068867_10000049519 279
51 3300005459 Ga0068867_100016808 Ga0068867_1000168085 279
52 3300005535 Ga0070684_100000997 Ga0070684_10000099710 279
53 3300005539 Ga0068853_100137895 Ga0068853_1001378951 279
54 3300005539 Ga0068853_100167577 Ga0068853_1001675772 279
55 3300005543 Ga0070672_100432934 Ga0070672_1004329342 279
56 3300005548 Ga0070665_100000006 Ga0070665_100000006522 279
57 3300005563 Ga0068855_100000302 Ga0068855_10000030263 279
58 3300005563 Ga0068855_100019329 Ga0068855_1000193297 279
59 3300005563 Ga0068855_100025220 Ga0068855_1000252204 279
60 3300005563 Ga0068855_100188889 Ga0068855_1001888893 279
61 3300005577 Ga0068857_100020432 Ga0068857_1000204322 279
62 3300005614 Ga0068856_100043338 Ga0068856_1000433382 279
63 3300005614 Ga0068856_100098570 Ga0068856_1000985705 279
64 3300005614 Ga0068856_100159767 Ga0068856_1001597672 279
65 3300005614 Ga0068856_100219698 Ga0068856_1002196982 279
66 3300005617 Ga0068859_100003931 Ga0068859_10000393119 279
67 3300005617 Ga0068859_100014563 Ga0068859_1000145635 279
68 3300005617 Ga0068859_100173049 Ga0068859_1001730493 279
69 3300005841 Ga0068863_100030678 Ga0068863_1000306783 279
70 3300005843 Ga0068860_100010052 Ga0068860_1000100527 279
71 3300005843 Ga0068860_100010563 Ga0068860_10001056310 279
72 3300005843 Ga0068860_100104383 Ga0068860_1001043834 279
73 3300005844 Ga0068862_100635702 Ga0068862_1006357022 279
74 3300006237 Ga0097621_100002757 Ga0097621_1000027579 279
75 3300006358 Ga0068871_100020296 Ga0068871_1000202962 279
76 3300006881 Ga0068865_100000874 Ga0068865_1000008746 279
77 3300006881 Ga0068865_100020515 Ga0068865_1000205154 279
78 3300006931 Ga0097620_100003931 Ga0097620_10000393119 279
79 3300006931 Ga0097620_100014564 Ga0097620_1000145645 279
80 3300006931 Ga0097620_100173044 Ga0097620_1001730443 279
81 3300009036 Ga0105244_10000057 Ga0105244_1000005735 279
82 3300009093 Ga0105240_10000954 Ga0105240_1000095419 279
83 3300009093 Ga0105240_10021095 Ga0105240_100210958 279
84 3300009093 Ga0105240_10049178 Ga0105240_100491783 279
85 3300009093 Ga0105240_10473209 Ga0105240_104732092 279
86 3300009147 Ga0114129_10004115 Ga0114129_1000411510 279
87 3300009174 Ga0105241_10001158 Ga0105241_100011582 279
88 3300009174 Ga0105241_10020110 Ga0105241_100201105 279
89 3300009174 Ga0105241_10167052 Ga0105241_101670522 279
90 3300009174 Ga0105241_10220494 Ga0105241_102204942 279
91 3300009176 Ga0105242_10072172 Ga0105242_100721722 279
92 3300009545 Ga0105237_10000056 Ga0105237_1000005653 279
93 3300009545 Ga0105237_10000171 Ga0105237_100001717 279
94 3300009545 Ga0105237_10005233 Ga0105237_100052336 279
95 3300009545 Ga0105237_10023468 Ga0105237_100234685 279
96 3300009545 Ga0105237_10027897 Ga0105237_100278975 279
97 3300009545 Ga0105237_10029846 Ga0105237_100298464 279
98 3300009551 Ga0105238_10005189 Ga0105238_100051897 279
99 3300009551 Ga0105238_10042541 Ga0105238_100425416 279
100 3300009553 Ga0105249_10583263 Ga0105249_105832632 279
101 3300010375 Ga0105239_10000047 Ga0105239_10000047133 279
102 3300010375 Ga0105239_10000064 Ga0105239_100000643 279
103 3300010375 Ga0105239_10000609 Ga0105239_1000060928 279
104 3300010375 Ga0105239_10002280 Ga0105239_100022805 279
105 3300010375 Ga0105239_10004842 Ga0105239_100048424 279
106 3300010375 Ga0105239_10070516 Ga0105239_100705163 279
107 3300010375 Ga0105239_10102058 Ga0105239_101020583 279
108 3300010375 Ga0105239_10184834 Ga0105239_101848343 279
109 3300013102 Ga0157371_10071938 Ga0157371_100719384 279
110 3300013105 Ga0157369_10055395 Ga0157369_100553952 279
111 3300013296 Ga0157374_10010710 Ga0157374_100107103 279
112 3300013296 Ga0157374_10255283 Ga0157374_102552832 279
113 3300013297 Ga0157378_10037931 Ga0157378_100379313 279
114 3300013297 Ga0157378_10047748 Ga0157378_100477483 279
115 3300013306 Ga0163162_10001344 Ga0163162_100013444 279
116 3300013306 Ga0163162_10298075 Ga0163162_102980752 279
117 3300013306 Ga0163162_10335910 Ga0163162_103359101 279
118 3300013307 Ga0157372_10226791 Ga0157372_102267913 279
119 3300013308 Ga0157375_10100753 Ga0157375_101007532 279
120 3300013308 Ga0157375_10589118 Ga0157375_105891182 279
121 3300014745 Ga0157377_10013291 Ga0157377_100132915 279
122 3300014968 Ga0157379_10226548 Ga0157379_102265482 279
123 3300014969 Ga0157376_10018856 Ga0157376_100188565 279
124 3300014969 Ga0157376_10025489 Ga0157376_100254893 279
125 3300017792 Ga0163161_10000012 Ga0163161_10000012220 279
126 3300017792 Ga0163161_10003462 Ga0163161_100034623 279
127 3300025242 Ga0209258_100278 Ga0209258_1002787 279
128 3300025246 Ga0209646_1002118 Ga0209646_10021182 279
129 3300025250 Ga0209026_1002815 Ga0209026_10028156 279
130 3300025254 Ga0209148_1000248 Ga0209148_10002487 279
131 3300025304 Ga0209257_1000005 Ga0209257_10000051202 279
132 3300025728 Ga0207655_1000038 Ga0207655_1000038301 279
133 3300025903 Ga0207680_10002328 Ga0207680_100023285 279
134 3300025904 Ga0207647_10000117 Ga0207647_1000011711 279
135 3300025907 Ga0207645_10041862 Ga0207645_100418621 279
136 3300025907 Ga0207645_10045356 Ga0207645_100453563 279
137 3300025911 Ga0207654_10000524 Ga0207654_100005249 279
138 3300025911 Ga0207654_10021395 Ga0207654_100213952 279
139 3300025911 Ga0207654_10108994 Ga0207654_101089941 279
140 3300025913 Ga0207695_10062908 Ga0207695_100629083 279
141 3300025913 Ga0207695_10268973 Ga0207695_102689732 279
142 3300025914 Ga0207671_10001166 Ga0207671_1000116624 279
143 3300025914 Ga0207671_10008588 Ga0207671_100085885 279
144 3300025914 Ga0207671_10009264 Ga0207671_100092644 279
145 3300025914 Ga0207671_10013322 Ga0207671_100133224 279
146 3300025914 Ga0207671_10046076 Ga0207671_100460763 279
147 3300025914 Ga0207671_10129073 Ga0207671_101290733 279
148 3300025919 Ga0207657_10062736 Ga0207657_100627364 279
149 3300025924 Ga0207694_10100425 Ga0207694_101004252 279
150 3300025925 Ga0207650_10010140 Ga0207650_100101404 279
151 3300025932 Ga0207690_10000988 Ga0207690_1000098813 279
152 3300025932 Ga0207690_10124791 Ga0207690_101247911 279
153 3300025933 Ga0207706_10000044 Ga0207706_1000004439 279
154 3300025934 Ga0207686_10063111 Ga0207686_100631111 279
155 3300025938 Ga0207704_10000011 Ga0207704_10000011105 279
156 3300025938 Ga0207704_10371839 Ga0207704_103718392 279
157 3300025942 Ga0207689_10135836 Ga0207689_101358362 279
158 3300025942 Ga0207689_10180980 Ga0207689_101809802 279
159 3300025944 Ga0207661_10004794 Ga0207661_100047942 279
160 3300025949 Ga0207667_10003734 Ga0207667_1000373414 279
161 3300025949 Ga0207667_10046661 Ga0207667_100466614 279
162 3300025960 Ga0207651_10299271 Ga0207651_102992712 279
163 3300025986 Ga0207658_10003573 Ga0207658_100035735 279
164 3300026023 Ga0207677_10042456 Ga0207677_100424564 279
165 3300026023 Ga0207677_10065918 Ga0207677_100659182 279
166 3300026078 Ga0207702_10037026 Ga0207702_100370265 279
167 3300026088 Ga0207641_10023162 Ga0207641_100231624 279
168 3300026088 Ga0207641_10109086 Ga0207641_101090863 279
169 3300026089 Ga0207648_10000588 Ga0207648_1000058818 279
170 3300026089 Ga0207648_10016182 Ga0207648_100161824 279
171 3300026116 Ga0207674_10053417 Ga0207674_100534174 279
172 3300028379 Ga0268266_10000010 Ga0268266_10000010601 279
173 3300028381 Ga0268264_10012681 Ga0268264_100126818 279
174 3300028381 Ga0268264_10021596 Ga0268264_100215963 279
175 3300028381 Ga0268264_10064457 Ga0268264_100644573 279
176 3300028381 Ga0268264_10586291 Ga0268264_105862911 279
177 3300028786 Ga0307517_10005359 Ga0307517_100053593 279
178 3300028794 Ga0307515_10000010 Ga0307515_1000001057 279
179 3300028794 Ga0307515_10001436 Ga0307515_1000143624 279
180 3300028794 Ga0307515_10002625 Ga0307515_100026255 279
181 3300028794 Ga0307515_10014841 Ga0307515_1001484119 279
182 3300028794 Ga0307515_10016588 Ga0307515_1001658811 279
183 3300028794 Ga0307515_10070810 Ga0307515_100708103 279
184 3300028794 Ga0307515_10234421 Ga0307515_102344212 279
185 3300028794 Ga0307515_10247227 Ga0307515_102472272 279
186 3300030521 Ga0307511_10009116 Ga0307511_1000911610 279
187 3300031507 Ga0307509_10060704 Ga0307509_100607042 279
188 3300031507 Ga0307509_10061940 Ga0307509_100619404 279
189 3300031507 Ga0307509_10153579 Ga0307509_101535792 279
190 3300031507 Ga0307509_10205289 Ga0307509_102052892 279
191 3300032004 Ga0307414_10014948 Ga0307414_100149482 279
192 3300032004 Ga0307414_10022041 Ga0307414_100220413 279
193 3300032005 Ga0307411_10000012 Ga0307411_1000001279 279
194 3300033179 Ga0307507_10084184 Ga0307507_100841845 279
195 3300033180 Ga0307510_10128474 Ga0307510_101284741 279
196 3300041407 Ga0439447_004198 Ga0439447_004198_1593_2432 279
197 3300041463 Ga0451804_1010488 Ga0451804_1010488_150_989 279
198 3300041511 Ga0451855_0880849 Ga0451855_0880849_88_927 279
199 3300044712 Ga0453684_0012058 Ga0453684_0012058_4381_5271 279
200 3300044712 Ga0453684_0023357 Ga0453684_0023357_5928_6818 279
201 3300046454 Ga0495592_0345332 Ga0495592_0345332_55_945 279
202 3300046460 Ga0495638_0097038 Ga0495638_0097038_653_1543 279
203 3300046462 Ga0495651_0326499 Ga0495651_0326499_33_923 279
204 3300046472 Ga0495580_0149870 Ga0495580_0149870_295_1134 279
205 3300046473 Ga0495582_0079055 Ga0495582_0079055_831_1670 279
206 3300046500 Ga0495596_0021240 Ga0495596_0021240_188_1078 279
207 3300046507 Ga0495606_0003840 Ga0495606_0003840_3720_4610 279
208 3300046519 Ga0495632_0046338 Ga0495632_0046338_710_1600 279
209 3300046524 Ga0495648_0004436 Ga0495648_0004436_1954_2844 279
210 3300046529 Ga0495652_0067500 Ga0495652_0067500_1846_2736 279
211 3300046530 Ga0495654_0046337 Ga0495654_0046337_841_1731 279
212 3300046535 Ga0495586_0073150 Ga0495586_0073150_945_1784 279
213 3300046538 Ga0495609_0008929 Ga0495609_0008929_3774_4664 279
214 3300046558 Ga0495633_0000263 Ga0495633_0000263_43920_44810 279
215 3300046616 Ga0495668_0000054 Ga0495668_0000054_155741_156631 279
216 3300046616 Ga0495668_0002622 Ga0495668_0002622_13201_14091 279
217 3300046660 Ga0495625_0002868 Ga0495625_0002868_19_915 279
218 3300046660 Ga0495625_0073848 Ga0495625_0073848_167_1057 279
219 3300046660 Ga0495625_0075226 Ga0495625_0075226_224_1114 279
220 3300046660 Ga0495625_0097477 Ga0495625_0097477_758_1648 279
221 3300046660 Ga0495625_0158298 Ga0495625_0158298_354_1193 279
222 3300046681 Ga0495647_0155803 Ga0495647_0155803_130_969 279
223 3300047319 Ga0495674_0265010 Ga0495674_0265010_71_910 279
224 3300047321 Ga0495676_0135476 Ga0495676_0135476_248_1087 279
225 3300047443 Ga0495687_000541 Ga0495687_000541_24944_25834 279
226 3300049661 Ga0501217_001363 Ga0501217_001363_75_965 279
227 3300049677 Ga0501247_000622 Ga0501247_000622_1217_2107 279
228 3300049679 Ga0501249_000001 Ga0501249_000001_207658_208551 279
229 3300049768 Ga0501271_004860 Ga0501271_004860_79_969 279
230 3300053088 Ga0500644_0000017 Ga0500644_0000017_54856_55746 279
231 3300053090 Ga0500646_0003815 Ga0500646_0003815_38_877 279
232 3300053092 Ga0500583_0001003 Ga0500583_0001003_800_1639 279
233 3300053092 Ga0500583_0126396 Ga0500583_0126396_191_1030 279
234 3300053092 Ga0500583_0191258 Ga0500583_0191258_112_1002 279
235 3300053096 Ga0500641_0000009 Ga0500641_0000009_10984_11823 279
236 3300053096 Ga0500641_0000311 Ga0500641_0000311_701_1594 279
237 3300053108 Ga0500562_002326 Ga0500562_002326_2680_3570 279
238 3300053109 Ga0500569_001326 Ga0500569_001326_2687_3577 279
239 3300053118 Ga0500594_0043597 Ga0500594_0043597_148_1038 279
240 3300053122 Ga0500608_000479 Ga0500608_000479_6043_6933 279
241 3300053125 Ga0500618_000015 Ga0500618_000015_90442_91332 279
242 3300053134 Ga0500658_0000009 Ga0500658_0000009_32973_33812 279
243 3300053140 Ga0500573_0197402 Ga0500573_0197402_119_1009 279
244 3300053147 Ga0500589_039144 Ga0500589_039144_203_1093 279
245 3300053151 Ga0500604_0003431 Ga0500604_0003431_916_1848 279
246 3300053151 Ga0500604_0005236 Ga0500604_0005236_2013_2903 279
247 3300053153 Ga0500616_0037400 Ga0500616_0037400_378_1352 279
248 3300053156 Ga0500622_0000004 Ga0500622_0000004_126486_127376 279
249 3300053156 Ga0500622_0064367 Ga0500622_0064367_857_1747 279
250 3300053157 Ga0500624_000332 Ga0500624_000332_12099_12989 279
251 3300053157 Ga0500624_001089 Ga0500624_001089_568_1458 279
252 3300053160 Ga0500633_0002007 Ga0500633_0002007_1228_2118 279
253 3300053177 Ga0500636_0012664 Ga0500636_0012664_2337_3227 279
254 iso_pu_bacteria 2513020052 2513233575 279
255 iso_pu_bacteria 2585428187 2588234826 279
256 iso_pu_bacteria 2643221667 2644373516 279
257 iso_pu_bacteria 2738541278 2738726595 279
258 iso_pu_bacteria 2738541279 2738732289 279
259 iso_pu_bacteria 2738541285 2738764854 279
260 iso_pu_bacteria 2738541302 2738856443 279
261 iso_pu_bacteria 2738543007 2739213869 279
262 iso_pu_bacteria 2739367651 2739589424 279
263 iso_pu_bacteria 2739367857 2740001675 279
264 iso_pu_bacteria 2739367858 2740006491 279
265 iso_pu_bacteria 2833640130 2833643189 279
266 iso_pu_bacteria 2857618242 2857622697 279
267 iso_pu_bacteria 2929177148 2929180379 279
268 iso_pu_bacteria 2929921140 2929925268 279
269 iso_pu_bacteria 2945924605 2945926339 279
270 iso_pu_bacteria 2945977869 2945982772 279
271 iso_pu_bacteria 2946013367 2946017835 279
272 iso_pu_bacteria 2954016120 2954016198 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

86

218

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f9o-assembly1.cif.gz_A crystal structure of the di-zinc carbapenemase cpha from aeromonas hydrophila 0.7754 7 234
3fai-assembly1.cif.gz_A the di zinc carbapenemase cpha n220g mutant 0.7751 7 234
3f9o-assembly1.cif.gz_A crystal structure of the di-zinc carbapenemase cpha from aeromonas hydrophila 0.7574 7 234
7l0b-assembly4.cif.gz_D crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.7553 15 229
3fai-assembly1.cif.gz_A the di zinc carbapenemase cpha n220g mutant 0.7542 7 234
ID Description Score Start End Superfamily
af_Q4DH02_81_447_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7857 6 44 2.130.10.10
1x8gA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7733 7 234 3.60.15.10
af_Q2FY29_1_207_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7661 30 231 3.60.15.10
af_K7MDN4_21_187_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7638 18 160 3.60.15.10
1x8gA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7584 7 234 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A090VHL1-F1-model_v4 Metallo-beta-lactamase superfamily protein PA0057 0.9883 183 279
AF-A0A4R2YQX9-F1-model_v4 deleted 0.9801 1 279
AF-A0A655VQW1-F1-model_v4 Metallo-beta-lactamase family protein 0.9794 175 279
AF-A0A090VHL1-F1-model_v4 Metallo-beta-lactamase superfamily protein PA0057 0.9783 183 279
AF-A0A4R2YQX9-F1-model_v4 deleted 0.9766 1 279

Feature Viewer

pLDDT pTM Quality
91.84 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map