F378628

General Info

Members Datasets Scaffolds Average Seq Length
272 180 544 143

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0403408|Ga0496112_0403408_368_853
Length 161
Sequence MWATTYDADRPAPARSSVCAMSDESLRAVDIERTGSRHFQVRNARGGVIEIGSGDGDTFTPVELFLAAIGACGAIDVDAITGKRAEPTVFQVRVTGDKIRDGAGNRMENLAVEFTVTFPEGEPGDAARAMLDRSVQMSHDRLCTVSRTVEVGTPVAARLTT

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
99 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
109 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
173 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
174 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 2643221561 Nocardioides sp. Root151 Isolate Unclassified
178 2643221696 Nocardioides sp. Root140 Isolate Unclassified
179 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
180 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 1.84
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 6.99
Rhizosphere 81.62
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0403408 3300048915 Bacteria 1307
2 JGI24740J21852_10013002 3300001979 Bacteria 3122
3 JGI24740J21852_10035115 3300001979 Bacteria 1571
4 JGI24739J22299_10021271 3300001989 Bacteria 2311
5 JGI24739J22299_10071346 3300001989 Bacteria 1080
6 JGI24737J22298_10055196 3300001990 Bacteria 1201
7 JGI24737J22298_10245642 3300001990 Bacteria 528
8 JGI25406J46586_10001461 3300003203 Bacteria 11138
9 JGI25406J46586_10055517 3300003203 Bacteria 1305
10 JGI25406J46586_10213064 3300003203 Bacteria 565
11 rootH1_10132905 3300003316 Bacteria 2737
12 rootH2_10015270 3300003320 Bacteria 1250
13 rootH2_10054853 3300003320 Bacteria 4163
14 Ga0070658_10002520 3300005327 Bacteria 15288
15 Ga0070683_100001365 3300005329 Bacteria 18685
16 Ga0070683_100067195 3300005329 Bacteria 3339
17 Ga0070670_100295530 3300005331 Bacteria 1416
18 Ga0070682_100227157 3300005337 Bacteria 1332
19 Ga0070682_100232904 3300005337 Bacteria 1318
20 Ga0070660_100114980 3300005339 Bacteria 2144
21 Ga0070661_100205695 3300005344 Unclassified 1505
22 Ga0070668_100004309 3300005347 Bacteria 10559
23 Ga0070668_100056231 3300005347 Bacteria 3038
24 Ga0070669_100774727 3300005353 Bacteria 814
25 Ga0070674_100104015 3300005356 Bacteria 2074
26 Ga0070659_100305298 3300005366 Bacteria 1328
27 Ga0070667_100082912 3300005367 Bacteria 2745
28 Ga0070667_101395679 3300005367 Bacteria 657
29 Ga0070709_10147639 3300005434 Bacteria 1622
30 Ga0070714_100084850 3300005435 Bacteria 2765
31 Ga0070713_101417573 3300005436 Bacteria 674
32 Ga0070678_100764487 3300005456 Bacteria 875
33 Ga0070681_10125345 3300005458 Bacteria 2501
34 Ga0070681_10254459 3300005458 Bacteria 1668
35 Ga0070681_10990915 3300005458 Unclassified 760
36 Ga0070679_100390148 3300005530 Bacteria 1338
37 Ga0070684_100002957 3300005535 Bacteria 12651
38 Ga0070684_100039145 3300005535 Bacteria 4077
39 Ga0070684_100176815 3300005535 Bacteria 1940
40 Ga0068853_101945526 3300005539 Bacteria 570
41 Ga0070665_100213605 3300005548 Bacteria 1930
42 Ga0070664_100071273 3300005564 Bacteria 2978
43 Ga0070664_100071769 3300005564 Bacteria 2968
44 Ga0070664_100110466 3300005564 Bacteria 2399
45 Ga0068857_100034809 3300005577 Bacteria 4456
46 Ga0068857_100572387 3300005577 Bacteria 1066
47 Ga0068857_101233476 3300005577 Bacteria 725
48 Ga0068857_101493054 3300005577 Bacteria 658
49 Ga0068854_100304615 3300005578 Bacteria 1290
50 Ga0068856_100409008 3300005614 Bacteria 1376
51 Ga0070702_101257719 3300005615 Bacteria 599
52 Ga0068859_100827888 3300005617 Bacteria 1012
53 Ga0068864_100000902 3300005618 Bacteria 24961
54 Ga0068864_100937335 3300005618 Bacteria 856
55 Ga0068864_101079640 3300005618 Bacteria 798
56 Ga0068861_100594118 3300005719 Bacteria 1015
57 Ga0068851_10625143 3300005834 Bacteria 657
58 Ga0068863_100057509 3300005841 Bacteria 3681
59 Ga0068863_100101330 3300005841 Bacteria 2737
60 Ga0068863_101346663 3300005841 Bacteria 721
61 Ga0068858_100537140 3300005842 Bacteria 1131
62 Ga0068860_100057573 3300005843 Bacteria 3695
63 Ga0068860_101178648 3300005843 Bacteria 786
64 Ga0068862_100014483 3300005844 Bacteria 6544
65 Ga0081455_10031686 3300005937 Bacteria 4777
66 Ga0081540_1014452 3300005983 Bacteria 5055
67 Ga0081539_10000027 3300005985 Bacteria 328691
68 Ga0081539_10002366 3300005985 Bacteria 27035
69 Ga0081539_10003120 3300005985 Bacteria 21168
70 Ga0070716_100562404 3300006173 Bacteria 852
71 Ga0070712_101030193 3300006175 Bacteria 713
72 Ga0097621_100713836 3300006237 Bacteria 924
73 Ga0075428_100534783 3300006844 Bacteria 1253
74 Ga0097620_100827890 3300006931 Bacteria 1012
75 Ga0105250_10182622 3300009092 Unclassified 880
76 Ga0114129_10001242 3300009147 Bacteria 33950
77 Ga0114129_10219852 3300009147 Bacteria 2563
78 Ga0105243_10969115 3300009148 Bacteria 851
79 Ga0105243_11346665 3300009148 Bacteria 733
80 Ga0105243_11469935 3300009148 Bacteria 704
81 Ga0105243_11924447 3300009148 Bacteria 624
82 Ga0105248_10065557 3300009177 Bacteria 4077
83 Ga0105239_10386915 3300010375 Bacteria 1582
84 Ga0105239_10863030 3300010375 Bacteria 1038
85 Ga0105246_10147309 3300011119 Bacteria 1778
86 Ga0157370_10475712 3300013104 Bacteria 1148
87 Ga0157370_11089313 3300013104 Bacteria 722
88 Ga0157369_10007372 3300013105 Bacteria 12665
89 Ga0163162_10982133 3300013306 Bacteria 954
90 Ga0157372_10150868 3300013307 Bacteria 2683
91 Ga0157372_10968979 3300013307 Bacteria 986
92 Ga0157375_11133459 3300013308 Bacteria 916
93 Ga0157375_11790671 3300013308 Bacteria 728
94 Ga0163163_10016775 3300014325 Bacteria 6815
95 Ga0163163_10708893 3300014325 Bacteria 1070
96 Ga0157379_10280146 3300014968 Bacteria 1517
97 Ga0157379_10946862 3300014968 Bacteria 819
98 Ga0157376_11397987 3300014969 Bacteria 731
99 Ga0206354_10584154 3300020081 Bacteria 1510
100 Ga0206353_10427246 3300020082 Bacteria 3892
101 Ga0206353_10603279 3300020082 Bacteria 4396
102 Ga0224712_10089184 3300022467 Bacteria 1289
103 Ga0207688_10233157 3300025901 Bacteria 1111
104 Ga0207647_10002517 3300025904 Bacteria 13867
105 Ga0207647_10339585 3300025904 Bacteria 851
106 Ga0207699_10534101 3300025906 Bacteria 849
107 Ga0207705_10024220 3300025909 Bacteria 4332
108 Ga0207707_10387119 3300025912 Bacteria 1201
109 Ga0207657_10159781 3300025919 Bacteria 1831
110 Ga0207657_10916532 3300025919 Bacteria 675
111 Ga0207649_10216813 3300025920 Unclassified 1361
112 Ga0207652_10155811 3300025921 Bacteria 2046
113 Ga0207681_10953749 3300025923 Bacteria 719
114 Ga0207700_10328066 3300025928 Bacteria 1328
115 Ga0207690_10238959 3300025932 Bacteria 1398
116 Ga0207690_11329004 3300025932 Bacteria 601
117 Ga0207709_10538851 3300025935 Bacteria 916
118 Ga0207691_10636267 3300025940 Bacteria 902
119 Ga0207711_10048187 3300025941 Bacteria 3646
120 Ga0207661_10005033 3300025944 Bacteria 9271
121 Ga0207661_10006447 3300025944 Bacteria 8297
122 Ga0207661_10128269 3300025944 Bacteria 2169
123 Ga0207679_10054724 3300025945 Bacteria 2939
124 Ga0207679_10207910 3300025945 Bacteria 1639
125 Ga0207679_10588766 3300025945 Unclassified 1001
126 Ga0207667_11169985 3300025949 Bacteria 750
127 Ga0207668_10001704 3300025972 Bacteria 12867
128 Ga0207668_10058807 3300025972 Bacteria 2689
129 Ga0207668_10595701 3300025972 Bacteria 962
130 Ga0207640_10459852 3300025981 Bacteria 1051
131 Ga0207658_10559504 3300025986 Bacteria 1024
132 Ga0207703_10622576 3300026035 Bacteria 1022
133 Ga0207678_10351969 3300026067 Bacteria 1270
134 Ga0207702_10462473 3300026078 Bacteria 1232
135 Ga0207641_10068026 3300026088 Bacteria 3053
136 Ga0207641_10213606 3300026088 Bacteria 1785
137 Ga0207641_11043884 3300026088 Bacteria 815
138 Ga0207676_11210014 3300026095 Bacteria 749
139 Ga0207676_11486318 3300026095 Bacteria 674
140 Ga0207674_10055507 3300026116 Bacteria 4026
141 Ga0207674_10082460 3300026116 Bacteria 3217
142 Ga0207698_11062750 3300026142 Bacteria 821
143 Ga0268266_10151025 3300028379 Bacteria 2094
144 Ga0268265_10174182 3300028380 Bacteria 1842
145 Ga0268264_11101428 3300028381 Bacteria 803
146 Ga0307517_10201336 3300028786 Bacteria 1244
147 Ga0307515_10071194 3300028794 Bacteria 4716
148 Ga0307515_10938281 3300028794 Bacteria 500
149 Ga0307512_10024350 3300030522 Bacteria 5388
150 Ga0314311_1012458 3300030733 Bacteria 783
151 Ga0307513_10008567 3300031456 Bacteria 13067
152 Ga0307513_10019868 3300031456 Bacteria 7983
153 Ga0307509_10004170 3300031507 Bacteria 21124
154 Ga0307509_10081663 3300031507 Bacteria 3338
155 Ga0307509_10224615 3300031507 Bacteria 1687
156 Ga0307508_10158325 3300031616 Unclassified 1868
157 Ga0307508_10342708 3300031616 Bacteria 1086
158 Ga0307508_10397247 3300031616 Bacteria 970
159 Ga0316576_10000841 3300031727 Bacteria 15543
160 Ga0307516_10001943 3300031730 Bacteria 28350
161 Ga0307516_10002977 3300031730 Bacteria 22128
162 Ga0307516_10010084 3300031730 Bacteria 10449
163 Ga0307516_10964137 3300031730 Bacteria 523
164 Ga0307406_10674166 3300031901 Bacteria 861
165 Ga0307416_100337119 3300032002 Bacteria 1519
166 Ga0307415_100071644 3300032126 Bacteria 2438
167 Ga0307415_100127724 3300032126 Bacteria 1919
168 Ga0307415_100599601 3300032126 Bacteria 980
169 Ga0316580_10068240 3300032139 Bacteria 1090
170 Ga0316593_10074902 3300032168 Bacteria 1174
171 Ga0307507_10025695 3300033179 Bacteria 6377
172 Ga0307510_10200977 3300033180 Bacteria 1528
173 Ga0373935_0492535 3300035692 Unclassified 889
174 Ga0373927_0363833 3300035695 Unclassified 953
175 Ga0373947_0071731 3300035725 Bacteria 2125
176 Ga0316584_0236900 3300036712 Bacteria 1337
177 Ga0373925_0356499 3300037068 Unclassified 1188
178 Ga0466969_0000790 3300044656 Bacteria 17294
179 Ga0466969_0039579 3300044656 Bacteria 2366
180 Ga0466966_0006603 3300044684 Bacteria 7682
181 Ga0466966_0009207 3300044684 Bacteria 6537
182 Ga0466966_0051163 3300044684 Bacteria 2626
183 Ga0466961_0013984 3300044693 Bacteria 5144
184 Ga0466961_0052193 3300044693 Bacteria 2609
185 Ga0466961_0074792 3300044693 Bacteria 2148
186 Ga0466961_0166275 3300044693 Bacteria 1373
187 Ga0466961_0211821 3300044693 Bacteria 1196
188 Ga0466963_0155151 3300044694 Bacteria 1591
189 Ga0466963_0281322 3300044694 Bacteria 1169
190 Ga0466971_0070857 3300044719 Bacteria 1583
191 Ga0466971_0563624 3300044719 Bacteria 566
192 Ga0466968_0195330 3300044735 Bacteria 946
193 Ga0466970_0285840 3300044765 Bacteria 928
194 Ga0466970_0752533 3300044765 Bacteria 569
195 Ga0466960_0024007 3300044901 Bacteria 2746
196 Ga0466960_0703148 3300044901 Bacteria 606
197 Ga0466959_0008750 3300045049 Bacteria 7167
198 Ga0466959_0013341 3300045049 Bacteria 5956
199 Ga0466959_0220875 3300045049 Bacteria 1314
200 Ga0466959_0291231 3300045049 Bacteria 1119
201 Ga0466959_0361370 3300045049 Bacteria 989
202 Ga0466958_0213133 3300045836 Bacteria 1231
203 Ga0466967_1787401 3300045976 Bacteria 612
204 Ga0495592_0044427 3300046454 Bacteria 3320
205 Ga0495629_0013114 3300046459 Bacteria 5987
206 Ga0495629_0463945 3300046459 Bacteria 857
207 Ga0495629_0701525 3300046459 Bacteria 672
208 Ga0495651_0003688 3300046462 Bacteria 11729
209 Ga0495582_0166861 3300046473 Bacteria 1253
210 Ga0495664_0258761 3300046477 Bacteria 1052
211 Ga0495585_0187104 3300046492 Bacteria 1061
212 Ga0495608_0042957 3300046511 Bacteria 3022
213 Ga0495628_0024389 3300046516 Bacteria 4951
214 Ga0495652_0000885 3300046529 Bacteria 34425
215 Ga0495665_0187023 3300046531 Unclassified 1075
216 Ga0495640_0587565 3300046533 Unclassified 673
217 Ga0495634_0352514 3300046642 Bacteria 881
218 Ga0495625_0470438 3300046660 Bacteria 773
219 Ga0495635_0003844 3300046663 Bacteria 10434
220 Ga0495635_0433718 3300046663 Bacteria 870
221 Ga0495661_0145860 3300046665 Bacteria 1283
222 Ga0495599_0149091 3300046678 Bacteria 1449
223 Ga0495623_0031587 3300046679 Bacteria 3404
224 Ga0495646_0007564 3300046680 Bacteria 6905
225 Ga0495613_0290414 3300046689 Bacteria 1134
226 Ga0495649_0465300 3300046694 Bacteria 631
227 Ga0495600_0012982 3300046809 Bacteria 5223
228 Ga0495600_0215358 3300046809 Bacteria 1230
229 Ga0495581_0095155 3300047315 Bacteria 1729
230 Ga0495581_0297060 3300047315 Bacteria 944
231 Ga0495680_0121160 3300047322 Bacteria 1931
232 Ga0495593_0258715 3300047673 Unclassified 871
233 Ga0495602_0815594 3300048088 Bacteria 626
234 Ga0496102_0378554 3300048905 Bacteria 1332
235 Ga0496104_0024106 3300048907 Bacteria 5599
236 Ga0496104_0051753 3300048907 Bacteria 3877
237 Ga0496104_0366983 3300048907 Bacteria 1352
238 Ga0496104_1642619 3300048907 Bacteria 545
239 Ga0496105_0057149 3300048908 Bacteria 3222
240 Ga0496105_0262804 3300048908 Bacteria 1395
241 Ga0496107_1155362 3300048910 Bacteria 558
242 Ga0496108_0000086 3300048911 Bacteria 100279
243 Ga0496108_0110285 3300048911 Bacteria 2352
244 Ga0496109_0067375 3300048912 Bacteria 3279
245 Ga0496110_1200483 3300048913 Bacteria 667
246 Ga0496111_0029841 3300048914 Bacteria 3875
247 Ga0496111_0566690 3300048914 Bacteria 833
248 Ga0496112_1395652 3300048915 Bacteria 615
249 Ga0496113_0277972 3300048916 Unclassified 1338
250 Ga0496113_1341679 3300048916 Bacteria 555
251 Ga0496114_0003234 3300048917 Bacteria 12494
252 Ga0501043_0394584 3300049579 Bacteria 1046
253 Ga0501276_013414 3300049773 Bacteria 718
254 Ga0501044_0195728 3300049823 Bacteria 1982
255 nmdc:mga05p37_2204033_c1 3300050507 Bacteria 511
256 Ga0495601_0000628 3300053077 Bacteria 18834
257 Ga0495612_0001075 3300053078 Bacteria 11182
258 Ga0495612_0260102 3300053078 Bacteria 773
259 Ga0495655_0163901 3300053083 Bacteria 707
260 Ga0495619_0428780 3300053085 Bacteria 912
261 Ga0500644_0065852 3300053088 Bacteria 1291
262 Ga0500644_0094851 3300053088 Bacteria 1124
263 Ga0500654_073333 3300053099 Bacteria 1651
264 Ga0500655_055246 3300053133 Bacteria 795
265 Ga0500577_0030646 3300053142 Bacteria 1874
266 Ga0500577_0198613 3300053142 Unclassified 865
267 Ga0500622_0284138 3300053156 Bacteria 712
268 Ga0466962_0003775 3300061719 Bacteria 7233
269 2643826245 2643221561 Bacteria 4984412
270 2644532222 2643221696 Bacteria 5431823
271 2816425945 2816332119 Bacteria 8120218
272 2995470818 2995463766 Bacteria 8577691
273 Ga0496112_0403408
274 JGI24740J21852_10013002
275 JGI24740J21852_10035115
276 JGI24739J22299_10021271
277 JGI24739J22299_10071346
278 JGI24737J22298_10055196
279 JGI24737J22298_10245642
280 JGI25406J46586_10001461
281 JGI25406J46586_10055517
282 JGI25406J46586_10213064
283 rootH1_10132905
284 rootH2_10015270
285 rootH2_10054853
286 Ga0070658_10002520
287 Ga0070683_100001365
288 Ga0070683_100067195
289 Ga0070670_100295530
290 Ga0070682_100227157
291 Ga0070682_100232904
292 Ga0070660_100114980
293 Ga0070661_100205695
294 Ga0070668_100004309
295 Ga0070668_100056231
296 Ga0070669_100774727
297 Ga0070674_100104015
298 Ga0070659_100305298
299 Ga0070667_100082912
300 Ga0070667_101395679
301 Ga0070709_10147639
302 Ga0070714_100084850
303 Ga0070713_101417573
304 Ga0070678_100764487
305 Ga0070681_10125345
306 Ga0070681_10254459
307 Ga0070681_10990915
308 Ga0070679_100390148
309 Ga0070684_100002957
310 Ga0070684_100039145
311 Ga0070684_100176815
312 Ga0068853_101945526
313 Ga0070665_100213605
314 Ga0070664_100071273
315 Ga0070664_100071769
316 Ga0070664_100110466
317 Ga0068857_100034809
318 Ga0068857_100572387
319 Ga0068857_101233476
320 Ga0068857_101493054
321 Ga0068854_100304615
322 Ga0068856_100409008
323 Ga0070702_101257719
324 Ga0068859_100827888
325 Ga0068864_100000902
326 Ga0068864_100937335
327 Ga0068864_101079640
328 Ga0068861_100594118
329 Ga0068851_10625143
330 Ga0068863_100057509
331 Ga0068863_100101330
332 Ga0068863_101346663
333 Ga0068858_100537140
334 Ga0068860_100057573
335 Ga0068860_101178648
336 Ga0068862_100014483
337 Ga0081455_10031686
338 Ga0081540_1014452
339 Ga0081539_10000027
340 Ga0081539_10002366
341 Ga0081539_10003120
342 Ga0070716_100562404
343 Ga0070712_101030193
344 Ga0097621_100713836
345 Ga0075428_100534783
346 Ga0097620_100827890
347 Ga0105250_10182622
348 Ga0114129_10001242
349 Ga0114129_10219852
350 Ga0105243_10969115
351 Ga0105243_11346665
352 Ga0105243_11469935
353 Ga0105243_11924447
354 Ga0105248_10065557
355 Ga0105239_10386915
356 Ga0105239_10863030
357 Ga0105246_10147309
358 Ga0157370_10475712
359 Ga0157370_11089313
360 Ga0157369_10007372
361 Ga0163162_10982133
362 Ga0157372_10150868
363 Ga0157372_10968979
364 Ga0157375_11133459
365 Ga0157375_11790671
366 Ga0163163_10016775
367 Ga0163163_10708893
368 Ga0157379_10280146
369 Ga0157379_10946862
370 Ga0157376_11397987
371 Ga0206354_10584154
372 Ga0206353_10427246
373 Ga0206353_10603279
374 Ga0224712_10089184
375 Ga0207688_10233157
376 Ga0207647_10002517
377 Ga0207647_10339585
378 Ga0207699_10534101
379 Ga0207705_10024220
380 Ga0207707_10387119
381 Ga0207657_10159781
382 Ga0207657_10916532
383 Ga0207649_10216813
384 Ga0207652_10155811
385 Ga0207681_10953749
386 Ga0207700_10328066
387 Ga0207690_10238959
388 Ga0207690_11329004
389 Ga0207709_10538851
390 Ga0207691_10636267
391 Ga0207711_10048187
392 Ga0207661_10005033
393 Ga0207661_10006447
394 Ga0207661_10128269
395 Ga0207679_10054724
396 Ga0207679_10207910
397 Ga0207679_10588766
398 Ga0207667_11169985
399 Ga0207668_10001704
400 Ga0207668_10058807
401 Ga0207668_10595701
402 Ga0207640_10459852
403 Ga0207658_10559504
404 Ga0207703_10622576
405 Ga0207678_10351969
406 Ga0207702_10462473
407 Ga0207641_10068026
408 Ga0207641_10213606
409 Ga0207641_11043884
410 Ga0207676_11210014
411 Ga0207676_11486318
412 Ga0207674_10055507
413 Ga0207674_10082460
414 Ga0207698_11062750
415 Ga0268266_10151025
416 Ga0268265_10174182
417 Ga0268264_11101428
418 Ga0307517_10201336
419 Ga0307515_10071194
420 Ga0307515_10938281
421 Ga0307512_10024350
422 Ga0314311_1012458
423 Ga0307513_10008567
424 Ga0307513_10019868
425 Ga0307509_10004170
426 Ga0307509_10081663
427 Ga0307509_10224615
428 Ga0307508_10158325
429 Ga0307508_10342708
430 Ga0307508_10397247
431 Ga0316576_10000841
432 Ga0307516_10001943
433 Ga0307516_10002977
434 Ga0307516_10010084
435 Ga0307516_10964137
436 Ga0307406_10674166
437 Ga0307416_100337119
438 Ga0307415_100071644
439 Ga0307415_100127724
440 Ga0307415_100599601
441 Ga0316580_10068240
442 Ga0316593_10074902
443 Ga0307507_10025695
444 Ga0307510_10200977
445 Ga0373935_0492535
446 Ga0373927_0363833
447 Ga0373947_0071731
448 Ga0316584_0236900
449 Ga0373925_0356499
450 Ga0466969_0000790
451 Ga0466969_0039579
452 Ga0466966_0006603
453 Ga0466966_0009207
454 Ga0466966_0051163
455 Ga0466961_0013984
456 Ga0466961_0052193
457 Ga0466961_0074792
458 Ga0466961_0166275
459 Ga0466961_0211821
460 Ga0466963_0155151
461 Ga0466963_0281322
462 Ga0466971_0070857
463 Ga0466971_0563624
464 Ga0466968_0195330
465 Ga0466970_0285840
466 Ga0466970_0752533
467 Ga0466960_0024007
468 Ga0466960_0703148
469 Ga0466959_0008750
470 Ga0466959_0013341
471 Ga0466959_0220875
472 Ga0466959_0291231
473 Ga0466959_0361370
474 Ga0466958_0213133
475 Ga0466967_1787401
476 Ga0495592_0044427
477 Ga0495629_0013114
478 Ga0495629_0463945
479 Ga0495629_0701525
480 Ga0495651_0003688
481 Ga0495582_0166861
482 Ga0495664_0258761
483 Ga0495585_0187104
484 Ga0495608_0042957
485 Ga0495628_0024389
486 Ga0495652_0000885
487 Ga0495665_0187023
488 Ga0495640_0587565
489 Ga0495634_0352514
490 Ga0495625_0470438
491 Ga0495635_0003844
492 Ga0495635_0433718
493 Ga0495661_0145860
494 Ga0495599_0149091
495 Ga0495623_0031587
496 Ga0495646_0007564
497 Ga0495613_0290414
498 Ga0495649_0465300
499 Ga0495600_0012982
500 Ga0495600_0215358
501 Ga0495581_0095155
502 Ga0495581_0297060
503 Ga0495680_0121160
504 Ga0495593_0258715
505 Ga0495602_0815594
506 Ga0496102_0378554
507 Ga0496104_0024106
508 Ga0496104_0051753
509 Ga0496104_0366983
510 Ga0496104_1642619
511 Ga0496105_0057149
512 Ga0496105_0262804
513 Ga0496107_1155362
514 Ga0496108_0000086
515 Ga0496108_0110285
516 Ga0496109_0067375
517 Ga0496110_1200483
518 Ga0496111_0029841
519 Ga0496111_0566690
520 Ga0496112_1395652
521 Ga0496113_0277972
522 Ga0496113_1341679
523 Ga0496114_0003234
524 Ga0501043_0394584
525 Ga0501276_013414
526 Ga0501044_0195728
527 nmdc:mga05p37_2204033_c1
528 Ga0495601_0000628
529 Ga0495612_0001075
530 Ga0495612_0260102
531 Ga0495655_0163901
532 Ga0495619_0428780
533 Ga0500644_0065852
534 Ga0500644_0094851
535 Ga0500654_073333
536 Ga0500655_055246
537 Ga0500577_0030646
538 Ga0500577_0198613
539 Ga0500622_0284138
540 Ga0466962_0003775
541 2643826245
542 2644532222
543 2816425945
544 2995470818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

54

158

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8393 5 134
1vla-assembly1.cif.gz_A crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution 0.8184 7 127
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8182 7 132
3gvp-assembly1.cif.gz_B human sahh-like domain of human adenosylhomocysteinase 3 0.7941 4 32
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.7932 3 131
ID Description Score Start End Superfamily
af_Q04601_13_227_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8724 9 29 2.130.10.10
af_Q4DX51_54_194_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.857 9 32 2.40.128.630
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8503 40 132 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8015 7 130 3.30.300.20
1ml8A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.762 7 37 2.20.25.10
ID Description Score Start End GO Terms
AF-A0A4R8A2M6-F1-model_v4 Putative OsmC-like protein 0.9883 1 142
AF-A0A0Q9KW22-F1-model_v4 Oxidoreductase 0.9824 11 141
AF-A0A5C7NAF7-F1-model_v4 OsmC family peroxiredoxin 0.9794 5 141
AF-A0A852X4X5-F1-model_v4 Putative OsmC-like protein 0.9793 7 142
AF-A0A3N9X3N0-F1-model_v4 Oxidoreductase 0.9755 1 142

Map