F378559

General Info

Members Datasets Scaffolds Average Seq Length
272 146 544 145

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0063413|Ga0466970_0063413_1198_1677
Length 159
Sequence MGDTLERVSVLCQGVVVDLQEISDRLEIEAALVRYTRAVDTGDWNLLDTVFTPDAQVDYTESGGVADGYPAVRSWLAEVLPAFFPRRMHTLGQVHVDLRGDEADVTAYFHNPMPLADAAAPGGERVVEFGGFYHHSFVRTADGWRSCRLREEIVWRRGI

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
85 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
86 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
87 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
88 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
89 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
90 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
91 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
130 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
131 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
132 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
134 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
135 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 2643221615 Nocardioides sp. Root224 Isolate Unclassified
141 2643221617 Nocardioides sp. Root79 Isolate Unclassified
142 2643221620 Nocardioides sp. Root240 Isolate Unclassified
143 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
144 2738541305 Nocardioides sp. CF167 Isolate Unclassified
145 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
146 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.06
Metatranscriptomes 0.37
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 42.28
Nodule 0
Rhizoplane 1.1
Rhizosphere 51.47
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0063413 3300044765 Bacteria 1981
2 Ga0006562J51391_1076230 3300003578 Bacteria 1251
3 Ga0070676_10190508 3300005328 Bacteria 1338
4 Ga0070670_100170261 3300005331 Bacteria 1889
5 Ga0068869_100832891 3300005334 Unclassified 795
6 Ga0070680_100824290 3300005336 Bacteria 800
7 Ga0070669_100435103 3300005353 Bacteria 1079
8 Ga0070669_100572248 3300005353 Bacteria 944
9 Ga0070674_101369891 3300005356 Bacteria 633
10 Ga0070659_100663121 3300005366 Bacteria 900
11 Ga0070667_100431320 3300005367 Bacteria 1202
12 Ga0070667_100502784 3300005367 Bacteria 1111
13 Ga0070667_101539575 3300005367 Bacteria 625
14 Ga0070700_100585265 3300005441 Bacteria 872
15 Ga0070663_101249481 3300005455 Bacteria 654
16 Ga0070662_100130410 3300005457 Bacteria 1937
17 Ga0070672_100158039 3300005543 Bacteria 1879
18 Ga0070672_100177556 3300005543 Bacteria 1773
19 Ga0070672_101556703 3300005543 Bacteria 593
20 Ga0070665_101240655 3300005548 Bacteria 756
21 Ga0068854_100101493 3300005578 Bacteria 2158
22 Ga0070702_101289037 3300005615 Bacteria 593
23 Ga0068866_10225557 3300005718 Bacteria 1133
24 Ga0068860_100004584 3300005843 Bacteria 14106
25 Ga0068862_100139161 3300005844 Bacteria 2153
26 Ga0081455_10204934 3300005937 Bacteria 1474
27 Ga0081539_10083765 3300005985 Bacteria 1669
28 Ga0075365_10002024 3300006038 Bacteria 9622
29 Ga0075365_10016500 3300006038 Bacteria 4493
30 Ga0075365_10023164 3300006038 Bacteria 3902
31 Ga0075365_10051213 3300006038 Bacteria 2726
32 Ga0075365_10057971 3300006038 Bacteria 2577
33 Ga0075365_10070472 3300006038 Bacteria 2351
34 Ga0075365_10074093 3300006038 Bacteria 2296
35 Ga0075365_10084249 3300006038 Bacteria 2157
36 Ga0075365_10087023 3300006038 Bacteria 2124
37 Ga0075365_10088480 3300006038 Bacteria 2107
38 Ga0075365_10102110 3300006038 Bacteria 1965
39 Ga0075365_10190718 3300006038 Bacteria 1434
40 Ga0075365_10204543 3300006038 Bacteria 1383
41 Ga0075365_10281692 3300006038 Bacteria 1170
42 Ga0075365_10394207 3300006038 Bacteria 977
43 Ga0075365_10520780 3300006038 Bacteria 841
44 Ga0075368_10001591 3300006042 Bacteria 7291
45 Ga0075368_10005924 3300006042 Bacteria 4235
46 Ga0075368_10053487 3300006042 Bacteria 1607
47 Ga0075368_10059568 3300006042 Bacteria 1527
48 Ga0075363_100016374 3300006048 Bacteria 3662
49 Ga0075363_100019002 3300006048 Bacteria 3430
50 Ga0075363_100076250 3300006048 Bacteria 1827
51 Ga0075363_100102136 3300006048 Bacteria 1587
52 Ga0075363_100135618 3300006048 Bacteria 1383
53 Ga0075364_10028737 3300006051 Bacteria 3561
54 Ga0075364_10030797 3300006051 Bacteria 3445
55 Ga0075364_10035460 3300006051 Bacteria 3223
56 Ga0075364_10041801 3300006051 Bacteria 2978
57 Ga0075364_10060016 3300006051 Bacteria 2494
58 Ga0075364_10188184 3300006051 Bacteria 1398
59 Ga0075364_10337556 3300006051 Bacteria 1027
60 Ga0075364_10458029 3300006051 Bacteria 871
61 Ga0075364_10525980 3300006051 Bacteria 809
62 Ga0075364_10972295 3300006051 Bacteria 577
63 Ga0075362_10052139 3300006177 Bacteria 1833
64 Ga0075362_10074729 3300006177 Bacteria 1553
65 Ga0075367_10007167 3300006178 Bacteria 5691
66 Ga0075367_10081139 3300006178 Bacteria 1962
67 Ga0075367_10098338 3300006178 Bacteria 1786
68 Ga0075367_10260384 3300006178 Bacteria 1089
69 Ga0075367_10409547 3300006178 Bacteria 858
70 Ga0075369_10338492 3300006186 Unclassified 705
71 Ga0075370_10013107 3300006353 Bacteria 4398
72 Ga0075370_10060730 3300006353 Bacteria 2153
73 Ga0075370_10062099 3300006353 Bacteria 2129
74 Ga0075370_10231657 3300006353 Bacteria 1093
75 Ga0075428_100025061 3300006844 Bacteria 6600
76 Ga0075430_100097780 3300006846 Bacteria 2452
77 Ga0075431_100064719 3300006847 Bacteria 3775
78 Ga0075431_100231098 3300006847 Bacteria 1884
79 Ga0075431_100262458 3300006847 Bacteria 1752
80 Ga0068865_100259638 3300006881 Bacteria 1375
81 Ga0111539_10026611 3300009094 Bacteria 7071
82 Ga0111539_10151358 3300009094 Bacteria 2716
83 Ga0105243_11494754 3300009148 Bacteria 699
84 Ga0105242_11013518 3300009176 Bacteria 839
85 Ga0105242_13280138 3300009176 Bacteria 503
86 Ga0105248_11641664 3300009177 Bacteria 728
87 Ga0105249_11609473 3300009553 Bacteria 722
88 Ga0105239_11089085 3300010375 Bacteria 920
89 Ga0105246_11354910 3300011119 Bacteria 662
90 Ga0157378_12311731 3300013297 Bacteria 589
91 Ga0163162_12373021 3300013306 Bacteria 610
92 Ga0157375_10138081 3300013308 Bacteria 2563
93 Ga0157375_10256033 3300013308 Bacteria 1912
94 Ga0157375_10980858 3300013308 Bacteria 985
95 Ga0157380_10165039 3300014326 Bacteria 1929
96 Ga0157380_10471388 3300014326 Bacteria 1211
97 Ga0163161_10450359 3300017792 Bacteria 1040
98 Ga0207642_10188592 3300025899 Bacteria 1129
99 Ga0207645_10006981 3300025907 Bacteria 8039
100 Ga0207643_10323782 3300025908 Bacteria 963
101 Ga0207643_10668680 3300025908 Bacteria 670
102 Ga0207681_10026851 3300025923 Bacteria 3717
103 Ga0207659_10676203 3300025926 Bacteria 883
104 Ga0207706_10006347 3300025933 Bacteria 10983
105 Ga0207706_10367273 3300025933 Bacteria 1250
106 Ga0207686_10651518 3300025934 Bacteria 833
107 Ga0207709_10568204 3300025935 Bacteria 894
108 Ga0207709_11453201 3300025935 Bacteria 568
109 Ga0207669_11602813 3300025937 Bacteria 556
110 Ga0207704_10009929 3300025938 Bacteria 4618
111 Ga0207691_10005601 3300025940 Bacteria 12139
112 Ga0207691_10265248 3300025940 Bacteria 1480
113 Ga0207691_10384259 3300025940 Bacteria 1198
114 Ga0207668_10009973 3300025972 Bacteria 5716
115 Ga0207658_10023019 3300025986 Bacteria 4344
116 Ga0207658_10060446 3300025986 Bacteria 2828
117 Ga0207708_10748389 3300026075 Bacteria 839
118 Ga0207674_10828239 3300026116 Bacteria 893
119 Ga0207675_100006878 3300026118 Bacteria 10772
120 Ga0209973_1020699 3300027252 Bacteria 870
121 Ga0209981_1017964 3300027378 Bacteria 1000
122 Ga0209996_1042308 3300027395 Unclassified 679
123 Ga0209982_1010820 3300027552 Bacteria 1355
124 Ga0210002_1006485 3300027617 Bacteria 1767
125 Ga0209971_1050685 3300027682 Bacteria 1003
126 Ga0209998_10009686 3300027717 Bacteria 1999
127 Ga0209813_10000964 3300027866 Bacteria 6462
128 Ga0209813_10023772 3300027866 Bacteria 1745
129 Ga0209813_10072323 3300027866 Bacteria 1124
130 Ga0209974_10004050 3300027876 Bacteria 5239
131 Ga0207428_10322871 3300027907 Bacteria 1140
132 Ga0207428_10415073 3300027907 Bacteria 984
133 Ga0268264_10000249 3300028381 Bacteria 101309
134 Ga0307405_10551811 3300031731 Bacteria 933
135 Ga0307413_10716814 3300031824 Bacteria 833
136 Ga0307406_10821990 3300031901 Bacteria 786
137 Ga0307406_11187970 3300031901 Bacteria 662
138 Ga0307412_10122805 3300031911 Bacteria 1873
139 Ga0307409_100679254 3300031995 Bacteria 1027
140 Ga0307415_100036263 3300032126 Bacteria 3230
141 Ga0395899_0378654 3300037312 Bacteria 941
142 Ga0395900_0603869 3300037418 Bacteria 1038
143 Ga0395900_1170654 3300037418 Bacteria 685
144 Ga0395900_1182795 3300037418 Bacteria 680
145 Ga0395898_0432706 3300037466 Bacteria 1254
146 Ga0395901_0079010 3300038443 Bacteria 3435
147 Ga0395901_0331990 3300038443 Bacteria 1572
148 Ga0451797_1325270 3300041453 Bacteria 683
149 Ga0451833_0719447 3300041491 Bacteria 631
150 Ga0451835_0162719 3300041492 Bacteria 727
151 Ga0451849_0776814 3300041505 Bacteria 633
152 Ga0451843_0317002 3300041509 Bacteria 1925
153 Ga0451843_1625993 3300041509 Bacteria 591
154 Ga0450905_041459 3300042142 Bacteria 733
155 Ga0439435_0008405 3300042436 Bacteria 2392
156 Ga0439460_0025531 3300042461 Bacteria 1646
157 Ga0466965_0003153 3300044683 Bacteria 7193
158 Ga0466965_0100063 3300044683 Bacteria 1482
159 Ga0466961_0285957 3300044693 Bacteria 1009
160 Ga0466968_0338398 3300044735 Bacteria 729
161 Ga0466960_0000373 3300044901 Bacteria 15315
162 Ga0466967_0168564 3300045976 Bacteria 2059
163 Ga0466967_1592536 3300045976 Bacteria 651
164 Ga0495590_0108164 3300046457 Bacteria 991
165 Ga0496102_0753432 3300048905 Bacteria 897
166 Ga0496114_0117922 3300048917 Bacteria 2280
167 Ga0496124_0687585 3300048927 Bacteria 651
168 Ga0501031_0404951 3300049568 Bacteria 882
169 Ga0501034_0650468 3300049571 Bacteria 956
170 Ga0501034_1205612 3300049571 Bacteria 636
171 Ga0501036_0101672 3300049572 Bacteria 2432
172 Ga0501039_0730488 3300049575 Bacteria 774
173 Ga0501040_0168141 3300049576 Bacteria 1552
174 Ga0501041_0149245 3300049577 Bacteria 1459
175 Ga0501042_0160543 3300049578 Bacteria 1622
176 Ga0501068_0130604 3300049584 Bacteria 1571
177 Ga0501070_0119704 3300049586 Bacteria 2176
178 Ga0501070_0432399 3300049586 Bacteria 1062
179 Ga0501070_0590338 3300049586 Bacteria 886
180 Ga0501071_0253730 3300049587 Bacteria 1328
181 Ga0501072_0323057 3300049588 Bacteria 1226
182 Ga0501072_0337989 3300049588 Bacteria 1196
183 Ga0501072_0554260 3300049588 Bacteria 908
184 Ga0501073_0037182 3300049589 Bacteria 3458
185 Ga0501074_0388882 3300049590 Bacteria 989
186 Ga0501075_0055288 3300049591 Bacteria 2987
187 Ga0501079_0127448 3300049741 Bacteria 1980
188 Ga0501081_0429353 3300049743 Bacteria 980
189 Ga0501081_0770656 3300049743 Bacteria 723
190 Ga0501083_0634220 3300049744 Unclassified 695
191 Ga0501045_0016368 3300049824 Bacteria 5265
192 nmdc:mga03n38_14044_c1 3300050490 Bacteria 3061
193 nmdc:mga03n38_142683_c1 3300050490 Bacteria 1198
194 nmdc:mga03n38_294480_c1 3300050490 Bacteria 870
195 nmdc:mga03n38_436097_c1 3300050490 Bacteria 727
196 nmdc:mga03n38_505311_c1 3300050490 Bacteria 679
197 nmdc:mga03n38_58072_c1 3300050490 Bacteria 1752
198 nmdc:mga00v17_117262_c1 3300050491 Bacteria 1693
199 nmdc:mga00v17_146672_c1 3300050491 Bacteria 1515
200 nmdc:mga00v17_15619_c1 3300050491 Bacteria 4264
201 nmdc:mga00v17_195869_c1 3300050491 Bacteria 1306
202 nmdc:mga00v17_48942_c1 3300050491 Bacteria 2563
203 nmdc:mga00v17_6028_c1 3300050491 Bacteria 6412
204 nmdc:mga00v17_611729_c1 3300050491 Bacteria 702
205 nmdc:mga00v17_61898_c1 3300050491 Bacteria 2301
206 nmdc:mga00v17_77639_c1 3300050491 Bacteria 2068
207 nmdc:mga00v17_917916_c1 3300050491 Bacteria 554
208 nmdc:mga00v17_988530_c1 3300050491 Bacteria 530
209 nmdc:mga0yw44_1004547_c1 3300050492 Bacteria 565
210 nmdc:mga0yw44_112041_c1 3300050492 Bacteria 1749
211 nmdc:mga0yw44_11344_c1 3300050492 Bacteria 4594
212 nmdc:mga0yw44_135200_c1 3300050492 Bacteria 1599
213 nmdc:mga0yw44_15880_c1 3300050492 Bacteria 4050
214 nmdc:mga0yw44_164483_c1 3300050492 Bacteria 1454
215 nmdc:mga0yw44_17226_c1 3300050492 Bacteria 3927
216 nmdc:mga0yw44_17478_c1 3300050492 Bacteria 3904
217 nmdc:mga0yw44_204885_c1 3300050492 Bacteria 1304
218 nmdc:mga0yw44_232243_c1 3300050492 Bacteria 1224
219 nmdc:mga0yw44_258629_c1 3300050492 Bacteria 1160
220 nmdc:mga0yw44_271213_c1 3300050492 Bacteria 1133
221 nmdc:mga0yw44_328660_c1 3300050492 Bacteria 1027
222 nmdc:mga0yw44_488863_c1 3300050492 Bacteria 835
223 nmdc:mga0yw44_58040_c1 3300050492 Bacteria 2363
224 nmdc:mga0yw44_638965_c1 3300050492 Bacteria 723
225 nmdc:mga0yw44_75564_c1 3300050492 Bacteria 2101
226 nmdc:mga0yw44_7822_c1 3300050492 Bacteria 5289
227 nmdc:mga0yw44_858902_c1 3300050492 Bacteria 616
228 nmdc:mga0yw44_950651_c1 3300050492 Bacteria 582
229 nmdc:mga06z11_17058_c1 3300050494 Bacteria 3287
230 nmdc:mga06z11_23543_c1 3300050494 Bacteria 2895
231 nmdc:mga06z11_235860_c1 3300050494 Bacteria 1073
232 nmdc:mga06z11_257546_c1 3300050494 Bacteria 1029
233 nmdc:mga06z11_26419_c1 3300050494 Bacteria 2763
234 nmdc:mga06z11_435114_c1 3300050494 Bacteria 792
235 nmdc:mga06z11_601699_c1 3300050494 Bacteria 669
236 nmdc:mga04h51_277771_c1 3300050495 Bacteria 678
237 nmdc:mga04h51_28382_c1 3300050495 Bacteria 1745
238 nmdc:mga04h51_4697_c1 3300050495 Bacteria 3422
239 nmdc:mga04h51_536448_c1 3300050495 Bacteria 503
240 nmdc:mga07m45_174182_c1 3300050496 Bacteria 1251
241 nmdc:mga07m45_25569_c1 3300050496 Bacteria 3239
242 nmdc:mga07m45_444576_c1 3300050496 Bacteria 752
243 nmdc:mga07m45_486612_c1 3300050496 Bacteria 715
244 nmdc:mga07m45_77729_c1 3300050496 Bacteria 1893
245 nmdc:mga07m45_8079_c1 3300050496 Bacteria 5396
246 nmdc:mga09592_195970_c1 3300050508 Bacteria 1749
247 nmdc:mga09592_91829_c1 3300050508 Bacteria 2595
248 nmdc:mga0qj67_1198163_c1 3300050509 Bacteria 591
249 nmdc:mga06r32_1896566_c1 3300050510 Bacteria 530
250 nmdc:mga06r32_290501_c1 3300050510 Bacteria 1622
251 nmdc:mga06r32_65457_c1 3300050510 Bacteria 3506
252 nmdc:mga08y16_31172_c1 3300050511 Bacteria 5609
253 nmdc:mga0sz30_386655_c1 3300050516 Unclassified 626
254 Ga0500644_0000275 3300053088 Bacteria 28638
255 Ga0500644_0124262 3300053088 Bacteria 1009
256 Ga0500641_0004575 3300053096 Bacteria 4888
257 Ga0500554_058745 3300053102 Bacteria 1229
258 Ga0500556_0001103 3300053104 Bacteria 13473
259 Ga0500593_000832 3300053117 Bacteria 11534
260 Ga0500655_093941 3300053133 Bacteria 625
261 Ga0500568_0108731 3300053139 Bacteria 1037
262 Ga0500573_0023717 3300053140 Bacteria 3525
263 Ga0500573_0053367 3300053140 Bacteria 2323
264 Ga0501084_0522372 3300054114 Bacteria 1003
265 Ga0501082_0426636 3300060353 Bacteria 1158
266 2644092909 2643221615 Bacteria 5487866
267 2644100565 2643221617 Bacteria 5139111
268 2644116973 2643221620 Bacteria 5134593
269 2644322522 2643221657 Bacteria 5490246
270 2738869452 2738541305 Bacteria 4910150
271 2812330947 2811994874 Bacteria 5367947
272 2855388781 2855386786 Bacteria 4752232
273 Ga0466970_0063413
274 Ga0006562J51391_1076230
275 Ga0070676_10190508
276 Ga0070670_100170261
277 Ga0068869_100832891
278 Ga0070680_100824290
279 Ga0070669_100435103
280 Ga0070669_100572248
281 Ga0070674_101369891
282 Ga0070659_100663121
283 Ga0070667_100431320
284 Ga0070667_100502784
285 Ga0070667_101539575
286 Ga0070700_100585265
287 Ga0070663_101249481
288 Ga0070662_100130410
289 Ga0070672_100158039
290 Ga0070672_100177556
291 Ga0070672_101556703
292 Ga0070665_101240655
293 Ga0068854_100101493
294 Ga0070702_101289037
295 Ga0068866_10225557
296 Ga0068860_100004584
297 Ga0068862_100139161
298 Ga0081455_10204934
299 Ga0081539_10083765
300 Ga0075365_10002024
301 Ga0075365_10016500
302 Ga0075365_10023164
303 Ga0075365_10051213
304 Ga0075365_10057971
305 Ga0075365_10070472
306 Ga0075365_10074093
307 Ga0075365_10084249
308 Ga0075365_10087023
309 Ga0075365_10088480
310 Ga0075365_10102110
311 Ga0075365_10190718
312 Ga0075365_10204543
313 Ga0075365_10281692
314 Ga0075365_10394207
315 Ga0075365_10520780
316 Ga0075368_10001591
317 Ga0075368_10005924
318 Ga0075368_10053487
319 Ga0075368_10059568
320 Ga0075363_100016374
321 Ga0075363_100019002
322 Ga0075363_100076250
323 Ga0075363_100102136
324 Ga0075363_100135618
325 Ga0075364_10028737
326 Ga0075364_10030797
327 Ga0075364_10035460
328 Ga0075364_10041801
329 Ga0075364_10060016
330 Ga0075364_10188184
331 Ga0075364_10337556
332 Ga0075364_10458029
333 Ga0075364_10525980
334 Ga0075364_10972295
335 Ga0075362_10052139
336 Ga0075362_10074729
337 Ga0075367_10007167
338 Ga0075367_10081139
339 Ga0075367_10098338
340 Ga0075367_10260384
341 Ga0075367_10409547
342 Ga0075369_10338492
343 Ga0075370_10013107
344 Ga0075370_10060730
345 Ga0075370_10062099
346 Ga0075370_10231657
347 Ga0075428_100025061
348 Ga0075430_100097780
349 Ga0075431_100064719
350 Ga0075431_100231098
351 Ga0075431_100262458
352 Ga0068865_100259638
353 Ga0111539_10026611
354 Ga0111539_10151358
355 Ga0105243_11494754
356 Ga0105242_11013518
357 Ga0105242_13280138
358 Ga0105248_11641664
359 Ga0105249_11609473
360 Ga0105239_11089085
361 Ga0105246_11354910
362 Ga0157378_12311731
363 Ga0163162_12373021
364 Ga0157375_10138081
365 Ga0157375_10256033
366 Ga0157375_10980858
367 Ga0157380_10165039
368 Ga0157380_10471388
369 Ga0163161_10450359
370 Ga0207642_10188592
371 Ga0207645_10006981
372 Ga0207643_10323782
373 Ga0207643_10668680
374 Ga0207681_10026851
375 Ga0207659_10676203
376 Ga0207706_10006347
377 Ga0207706_10367273
378 Ga0207686_10651518
379 Ga0207709_10568204
380 Ga0207709_11453201
381 Ga0207669_11602813
382 Ga0207704_10009929
383 Ga0207691_10005601
384 Ga0207691_10265248
385 Ga0207691_10384259
386 Ga0207668_10009973
387 Ga0207658_10023019
388 Ga0207658_10060446
389 Ga0207708_10748389
390 Ga0207674_10828239
391 Ga0207675_100006878
392 Ga0209973_1020699
393 Ga0209981_1017964
394 Ga0209996_1042308
395 Ga0209982_1010820
396 Ga0210002_1006485
397 Ga0209971_1050685
398 Ga0209998_10009686
399 Ga0209813_10000964
400 Ga0209813_10023772
401 Ga0209813_10072323
402 Ga0209974_10004050
403 Ga0207428_10322871
404 Ga0207428_10415073
405 Ga0268264_10000249
406 Ga0307405_10551811
407 Ga0307413_10716814
408 Ga0307406_10821990
409 Ga0307406_11187970
410 Ga0307412_10122805
411 Ga0307409_100679254
412 Ga0307415_100036263
413 Ga0395899_0378654
414 Ga0395900_0603869
415 Ga0395900_1170654
416 Ga0395900_1182795
417 Ga0395898_0432706
418 Ga0395901_0079010
419 Ga0395901_0331990
420 Ga0451797_1325270
421 Ga0451833_0719447
422 Ga0451835_0162719
423 Ga0451849_0776814
424 Ga0451843_0317002
425 Ga0451843_1625993
426 Ga0450905_041459
427 Ga0439435_0008405
428 Ga0439460_0025531
429 Ga0466965_0003153
430 Ga0466965_0100063
431 Ga0466961_0285957
432 Ga0466968_0338398
433 Ga0466960_0000373
434 Ga0466967_0168564
435 Ga0466967_1592536
436 Ga0495590_0108164
437 Ga0496102_0753432
438 Ga0496114_0117922
439 Ga0496124_0687585
440 Ga0501031_0404951
441 Ga0501034_0650468
442 Ga0501034_1205612
443 Ga0501036_0101672
444 Ga0501039_0730488
445 Ga0501040_0168141
446 Ga0501041_0149245
447 Ga0501042_0160543
448 Ga0501068_0130604
449 Ga0501070_0119704
450 Ga0501070_0432399
451 Ga0501070_0590338
452 Ga0501071_0253730
453 Ga0501072_0323057
454 Ga0501072_0337989
455 Ga0501072_0554260
456 Ga0501073_0037182
457 Ga0501074_0388882
458 Ga0501075_0055288
459 Ga0501079_0127448
460 Ga0501081_0429353
461 Ga0501081_0770656
462 Ga0501083_0634220
463 Ga0501045_0016368
464 nmdc:mga03n38_14044_c1
465 nmdc:mga03n38_142683_c1
466 nmdc:mga03n38_294480_c1
467 nmdc:mga03n38_436097_c1
468 nmdc:mga03n38_505311_c1
469 nmdc:mga03n38_58072_c1
470 nmdc:mga00v17_117262_c1
471 nmdc:mga00v17_146672_c1
472 nmdc:mga00v17_15619_c1
473 nmdc:mga00v17_195869_c1
474 nmdc:mga00v17_48942_c1
475 nmdc:mga00v17_6028_c1
476 nmdc:mga00v17_611729_c1
477 nmdc:mga00v17_61898_c1
478 nmdc:mga00v17_77639_c1
479 nmdc:mga00v17_917916_c1
480 nmdc:mga00v17_988530_c1
481 nmdc:mga0yw44_1004547_c1
482 nmdc:mga0yw44_112041_c1
483 nmdc:mga0yw44_11344_c1
484 nmdc:mga0yw44_135200_c1
485 nmdc:mga0yw44_15880_c1
486 nmdc:mga0yw44_164483_c1
487 nmdc:mga0yw44_17226_c1
488 nmdc:mga0yw44_17478_c1
489 nmdc:mga0yw44_204885_c1
490 nmdc:mga0yw44_232243_c1
491 nmdc:mga0yw44_258629_c1
492 nmdc:mga0yw44_271213_c1
493 nmdc:mga0yw44_328660_c1
494 nmdc:mga0yw44_488863_c1
495 nmdc:mga0yw44_58040_c1
496 nmdc:mga0yw44_638965_c1
497 nmdc:mga0yw44_75564_c1
498 nmdc:mga0yw44_7822_c1
499 nmdc:mga0yw44_858902_c1
500 nmdc:mga0yw44_950651_c1
501 nmdc:mga06z11_17058_c1
502 nmdc:mga06z11_23543_c1
503 nmdc:mga06z11_235860_c1
504 nmdc:mga06z11_257546_c1
505 nmdc:mga06z11_26419_c1
506 nmdc:mga06z11_435114_c1
507 nmdc:mga06z11_601699_c1
508 nmdc:mga04h51_277771_c1
509 nmdc:mga04h51_28382_c1
510 nmdc:mga04h51_4697_c1
511 nmdc:mga04h51_536448_c1
512 nmdc:mga07m45_174182_c1
513 nmdc:mga07m45_25569_c1
514 nmdc:mga07m45_444576_c1
515 nmdc:mga07m45_486612_c1
516 nmdc:mga07m45_77729_c1
517 nmdc:mga07m45_8079_c1
518 nmdc:mga09592_195970_c1
519 nmdc:mga09592_91829_c1
520 nmdc:mga0qj67_1198163_c1
521 nmdc:mga06r32_1896566_c1
522 nmdc:mga06r32_290501_c1
523 nmdc:mga06r32_65457_c1
524 nmdc:mga08y16_31172_c1
525 nmdc:mga0sz30_386655_c1
526 Ga0500644_0000275
527 Ga0500644_0124262
528 Ga0500641_0004575
529 Ga0500554_058745
530 Ga0500556_0001103
531 Ga0500593_000832
532 Ga0500655_093941
533 Ga0500568_0108731
534 Ga0500573_0023717
535 Ga0500573_0053367
536 Ga0501084_0522372
537 Ga0501082_0426636
538 2644092909
539 2644100565
540 2644116973
541 2644322522
542 2738869452
543 2812330947
544 2855388781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

20

150

0.95

PF12680

SnoaL_2

SnoaL-like domain

32

144

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a76-assembly1.cif.gz_A the crystal structure of lina 0.904 2 140
3s5c-assembly1.cif.gz_B crystal structure of a hexachlorocyclohexane dehydrochlorinase (lina) type2 0.9 1 140
3ef8-assembly1.cif.gz_A crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.893 5 143
4gb5-assembly1.cif.gz_A crystal structure of kfla4162 protein from kribbella flavida 0.8825 5 142
7kd9-assembly2.cif.gz_C crystal structure of gallic acid decarboxylase from arxula adeninivorans 0.881 1 141
ID Description Score Start End Superfamily
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9591 2 141 3.10.450.50
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9522 2 141 3.10.450.50
3a76A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.904 2 140 3.10.450.50
4gb5A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8814 5 142 3.10.450.50
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8693 5 138 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A5B1LPW5-F1-model_v4 Nuclear transport factor 2 family protein 1.002 1 143
AF-A0A7L9QBY6-F1-model_v4 SnoaL-like domain-containing protein 0.9824 1 143
AF-A0A6H1A256-F1-model_v4 Nuclear transport factor 2 family protein 0.9794 1 141
AF-A0A4P5S300-F1-model_v4 SnoaL-like domain-containing protein 0.9787 1 143
AF-A0A0C1AXL5-F1-model_v4 deleted 0.9755 1 143

Map