F378358

General Info

Members Datasets Scaffolds Average Seq Length
272 157 544 203

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10327865|Ga0157369_103278652
Length 221
Sequence MTRPTRSPRSPHATALSRALCVAAVLLGLSSTSSLAQDANAPTYNIELIVFRANGALGGAENWATEGGGIDDTLAGGESAGDSSQVGRFVGLLPPSQFQLNDIENKLRASGAYAPVAHIAWTQTASAWGTRAGFPLARLGADVPGLTGNVFLERGQYLHLGMSISYSEATPPAGIGASAATTFVMNQSRRIRFYERNYYDHPAFGVIALVTPTQGKRPPGR

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 2.57
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10327865 3300013105 Unclassified 1591
2 rootL2_10211637 3300003322 Bacteria 1503
3 Ga0070683_100176677 3300005329 Bacteria 2027
4 Ga0070690_100232034 3300005330 Bacteria 1298
5 Ga0070670_100033794 3300005331 Bacteria 4403
6 Ga0070670_100599483 3300005331 Bacteria 986
7 Ga0070677_10000800 3300005333 Bacteria 10441
8 Ga0068869_100019630 3300005334 Bacteria 4623
9 Ga0070666_10068278 3300005335 Unclassified 2415
10 Ga0070660_100813840 3300005339 Unclassified 786
11 Ga0070689_100019218 3300005340 Bacteria 5049
12 Ga0070689_100410729 3300005340 Bacteria 1146
13 Ga0070689_100677524 3300005340 Bacteria 899
14 Ga0070687_100060220 3300005343 Bacteria 2002
15 Ga0070675_100034018 3300005354 Bacteria 4134
16 Ga0070675_100171188 3300005354 Bacteria 1873
17 Ga0070675_100879407 3300005354 Bacteria 821
18 Ga0070674_100113659 3300005356 Bacteria 1992
19 Ga0070674_100980490 3300005356 Bacteria 740
20 Ga0070673_100028008 3300005364 Bacteria 4185
21 Ga0070688_100347872 3300005365 Unclassified 1084
22 Ga0070688_100745213 3300005365 Bacteria 762
23 Ga0070667_100000068 3300005367 Bacteria 127663
24 Ga0070714_100348128 3300005435 Bacteria 1391
25 Ga0070701_10007938 3300005438 Bacteria 4564
26 Ga0070701_10440272 3300005438 Unclassified 834
27 Ga0070700_100066954 3300005441 Bacteria 2281
28 Ga0070700_100068066 3300005441 Bacteria 2263
29 Ga0070700_100125335 3300005441 Bacteria 1726
30 Ga0070700_100165831 3300005441 Bacteria 1525
31 Ga0070700_100473942 3300005441 Bacteria 957
32 Ga0070694_100422901 3300005444 Unclassified 1047
33 Ga0070678_100204917 3300005456 Bacteria 1630
34 Ga0070662_100238661 3300005457 Bacteria 1457
35 Ga0070681_10000935 3300005458 Bacteria 24583
36 Ga0070681_10007836 3300005458 Bacteria 10444
37 Ga0068867_100512505 3300005459 Bacteria 1033
38 Ga0068867_100639920 3300005459 Unclassified 932
39 Ga0070679_100003192 3300005530 Bacteria 14978
40 Ga0070679_100275509 3300005530 Bacteria 1636
41 Ga0070679_100731618 3300005530 Bacteria 932
42 Ga0070672_100005291 3300005543 Bacteria 8540
43 Ga0070672_100005715 3300005543 Bacteria 8286
44 Ga0070672_100069380 3300005543 Bacteria 2798
45 Ga0070672_100167270 3300005543 Bacteria 1827
46 Ga0070672_100266424 3300005543 Bacteria 1446
47 Ga0070686_100028123 3300005544 Bacteria 3407
48 Ga0070686_100458137 3300005544 Bacteria 982
49 Ga0070695_100050717 3300005545 Bacteria 2661
50 Ga0070665_100007335 3300005548 Bacteria 11217
51 Ga0070665_100011391 3300005548 Bacteria 8992
52 Ga0070665_100024550 3300005548 Bacteria 6074
53 Ga0070665_100137354 3300005548 Bacteria 2448
54 Ga0070665_100617489 3300005548 Bacteria 1097
55 Ga0068855_100001761 3300005563 Bacteria 27049
56 Ga0068855_100003497 3300005563 Bacteria 19239
57 Ga0068855_100272579 3300005563 Bacteria 1881
58 Ga0068855_100590934 3300005563 Bacteria 1198
59 Ga0070664_100020024 3300005564 Bacteria 5508
60 Ga0070702_100031779 3300005615 Bacteria 2891
61 Ga0070702_100434901 3300005615 Bacteria 948
62 Ga0068852_101165868 3300005616 Unclassified 791
63 Ga0068859_100003724 3300005617 Bacteria 15547
64 Ga0068859_100053967 3300005617 Bacteria 4042
65 Ga0068859_100539027 3300005617 Unclassified 1262
66 Ga0068859_100990764 3300005617 Bacteria 923
67 Ga0068864_100792263 3300005618 Unclassified 931
68 Ga0068866_10067263 3300005718 Bacteria 1880
69 Ga0068861_100013272 3300005719 Bacteria 5764
70 Ga0068861_100104398 3300005719 Bacteria 2261
71 Ga0068861_100120180 3300005719 Bacteria 2118
72 Ga0068861_100221737 3300005719 Bacteria 1599
73 Ga0068861_100662448 3300005719 Bacteria 965
74 Ga0068870_10252006 3300005840 Unclassified 1095
75 Ga0068863_100040502 3300005841 Bacteria 4430
76 Ga0068863_100058095 3300005841 Bacteria 3661
77 Ga0068863_100171173 3300005841 Bacteria 2083
78 Ga0068860_100327134 3300005843 Bacteria 1505
79 Ga0068862_100081194 3300005844 Bacteria 2812
80 Ga0081455_10002524 3300005937 Bacteria 21743
81 Ga0070712_100169080 3300006175 Bacteria 1695
82 Ga0097621_100023122 3300006237 Bacteria 4835
83 Ga0097621_100693735 3300006237 Bacteria 937
84 Ga0068871_100146623 3300006358 Bacteria 2010
85 Ga0068871_100240018 3300006358 Bacteria 1575
86 Ga0068865_100025368 3300006881 Bacteria 3899
87 Ga0068865_100158043 3300006881 Bacteria 1726
88 Ga0068865_100483871 3300006881 Bacteria 1029
89 Ga0068865_100579543 3300006881 Bacteria 946
90 Ga0097620_100003724 3300006931 Bacteria 15547
91 Ga0097620_100053967 3300006931 Bacteria 4042
92 Ga0097620_100539075 3300006931 Unclassified 1262
93 Ga0097620_100990687 3300006931 Bacteria 923
94 Ga0105240_10001356 3300009093 Bacteria 42000
95 Ga0105240_10009013 3300009093 Bacteria 14172
96 Ga0105240_10015285 3300009093 Bacteria 10446
97 Ga0105240_10157412 3300009093 Bacteria 2701
98 Ga0105240_10160904 3300009093 Bacteria 2666
99 Ga0105240_10166443 3300009093 Bacteria 2614
100 Ga0111539_10024081 3300009094 Bacteria 7476
101 Ga0111539_10430276 3300009094 Bacteria 1537
102 Ga0105245_10406523 3300009098 Bacteria 1362
103 Ga0105245_10675851 3300009098 Bacteria 1064
104 Ga0105247_10266255 3300009101 Unclassified 1177
105 Ga0105243_10484535 3300009148 Bacteria 1168
106 Ga0105248_10074136 3300009177 Unclassified 3825
107 Ga0105248_10774975 3300009177 Bacteria 1082
108 Ga0105237_10084845 3300009545 Bacteria 3157
109 Ga0105238_10030754 3300009551 Bacteria 5466
110 Ga0105238_10108049 3300009551 Bacteria 2763
111 Ga0105238_10169123 3300009551 Bacteria 2162
112 Ga0105238_10950392 3300009551 Bacteria 879
113 Ga0105249_10029961 3300009553 Bacteria 4916
114 Ga0105249_10373898 3300009553 Bacteria 1449
115 Ga0157369_10002299 3300013105 Bacteria 22992
116 Ga0157369_10812471 3300013105 Bacteria 960
117 Ga0163162_10023007 3300013306 Bacteria 6146
118 Ga0157372_10034968 3300013307 Bacteria 5529
119 Ga0157372_10279333 3300013307 Bacteria 1941
120 Ga0163163_10452826 3300014325 Bacteria 1344
121 Ga0163163_10550865 3300014325 Unclassified 1216
122 Ga0163163_11125166 3300014325 Bacteria 848
123 Ga0157380_10054449 3300014326 Bacteria 3175
124 Ga0157377_10331432 3300014745 Unclassified 1015
125 Ga0157379_10098224 3300014968 Bacteria 2629
126 Ga0157376_10089547 3300014969 Bacteria 2661
127 Ga0157376_10094962 3300014969 Bacteria 2592
128 Ga0157376_10124830 3300014969 Bacteria 2287
129 Ga0163161_10158317 3300017792 Bacteria 1725
130 Ga0163161_10264359 3300017792 Bacteria 1345
131 Ga0163161_10506378 3300017792 Unclassified 984
132 Ga0163161_10702517 3300017792 Bacteria 842
133 Ga0207682_10000686 3300025893 Bacteria 15721
134 Ga0207682_10001879 3300025893 Bacteria 9568
135 Ga0207642_10081895 3300025899 Bacteria 1570
136 Ga0207642_10239120 3300025899 Unclassified 1024
137 Ga0207688_10235882 3300025901 Unclassified 1105
138 Ga0207680_10081969 3300025903 Unclassified 2029
139 Ga0207643_10008625 3300025908 Bacteria 5467
140 Ga0207643_10123240 3300025908 Bacteria 1537
141 Ga0207707_10012574 3300025912 Bacteria 7356
142 Ga0207707_10054480 3300025912 Bacteria 3481
143 Ga0207695_10009074 3300025913 Bacteria 12354
144 Ga0207695_10011724 3300025913 Bacteria 10587
145 Ga0207695_10016558 3300025913 Bacteria 8619
146 Ga0207695_10064288 3300025913 Bacteria 3779
147 Ga0207693_10043159 3300025915 Bacteria 3549
148 Ga0207660_10548450 3300025917 Bacteria 940
149 Ga0207662_10027323 3300025918 Bacteria 3293
150 Ga0207662_10044931 3300025918 Bacteria 2610
151 Ga0207657_10670786 3300025919 Unclassified 806
152 Ga0207652_10000331 3300025921 Bacteria 49024
153 Ga0207652_10088782 3300025921 Bacteria 2713
154 Ga0207694_10089368 3300025924 Bacteria 2430
155 Ga0207650_10067295 3300025925 Bacteria 2688
156 Ga0207650_10095366 3300025925 Bacteria 2281
157 Ga0207659_10161802 3300025926 Bacteria 1758
158 Ga0207659_10205051 3300025926 Bacteria 1577
159 Ga0207687_10480968 3300025927 Bacteria 1034
160 Ga0207700_10253552 3300025928 Unclassified 1504
161 Ga0207644_10175844 3300025931 Bacteria 1675
162 Ga0207670_10090681 3300025936 Bacteria 2160
163 Ga0207670_10390295 3300025936 Bacteria 1111
164 Ga0207669_10019072 3300025937 Bacteria 3562
165 Ga0207669_10138268 3300025937 Bacteria 1686
166 Ga0207704_10005591 3300025938 Bacteria 5798
167 Ga0207704_10084708 3300025938 Bacteria 2061
168 Ga0207704_10121208 3300025938 Bacteria 1790
169 Ga0207704_10239446 3300025938 Bacteria 1355
170 Ga0207704_10537656 3300025938 Unclassified 948
171 Ga0207691_10005555 3300025940 Bacteria 12181
172 Ga0207691_10007023 3300025940 Bacteria 10862
173 Ga0207691_10199045 3300025940 Bacteria 1744
174 Ga0207691_10204120 3300025940 Bacteria 1719
175 Ga0207711_10827100 3300025941 Bacteria 862
176 Ga0207689_10115833 3300025942 Bacteria 2203
177 Ga0207661_10656551 3300025944 Bacteria 964
178 Ga0207679_10011438 3300025945 Bacteria 5750
179 Ga0207667_10001105 3300025949 Bacteria 34029
180 Ga0207667_10007483 3300025949 Bacteria 13113
181 Ga0207667_10019065 3300025949 Bacteria 7669
182 Ga0207651_10152987 3300025960 Bacteria 1798
183 Ga0207712_10241487 3300025961 Bacteria 1455
184 Ga0207668_10777144 3300025972 Unclassified 846
185 Ga0207658_10000455 3300025986 Bacteria 38353
186 Ga0207658_10348588 3300025986 Bacteria 1289
187 Ga0207678_10435850 3300026067 Viruses 1138
188 Ga0207708_10016634 3300026075 Bacteria 5533
189 Ga0207708_10071141 3300026075 Bacteria 2664
190 Ga0207708_10137293 3300026075 Bacteria 1916
191 Ga0207708_10431136 3300026075 Bacteria 1095
192 Ga0207641_10046704 3300026088 Bacteria 3651
193 Ga0207641_10312538 3300026088 Bacteria 1487
194 Ga0207648_10446397 3300026089 Bacteria 1177
195 Ga0207648_10487792 3300026089 Bacteria 1126
196 Ga0207676_10024080 3300026095 Bacteria 4502
197 Ga0207676_10452093 3300026095 Unclassified 1211
198 Ga0207676_10497980 3300026095 Bacteria 1157
199 Ga0207676_10921956 3300026095 Bacteria 858
200 Ga0207675_100017825 3300026118 Bacteria 6625
201 Ga0207675_100023073 3300026118 Bacteria 5786
202 Ga0207675_100024447 3300026118 Bacteria 5617
203 Ga0207675_100443335 3300026118 Bacteria 1285
204 Ga0207683_10020646 3300026121 Bacteria 5637
205 Ga0207683_10056045 3300026121 Bacteria 3456
206 Ga0268266_10002522 3300028379 Bacteria 19488
207 Ga0268266_10004566 3300028379 Bacteria 13232
208 Ga0268266_10015239 3300028379 Bacteria 6600
209 Ga0268266_10130202 3300028379 Bacteria 2250
210 Ga0268265_10074258 3300028380 Bacteria 2659
211 Ga0265338_10013036 3300028800 Bacteria 9426
212 Ga0307408_100069494 3300031548 Bacteria 2597
213 Ga0307413_10021677 3300031824 Bacteria 3445
214 Ga0307406_10027175 3300031901 Bacteria 3445
215 Ga0307407_10004581 3300031903 Bacteria 5888
216 Ga0307407_10048046 3300031903 Bacteria 2426
217 Ga0307412_10050053 3300031911 Bacteria 2756
218 Ga0307412_10338948 3300031911 Unclassified 1203
219 Ga0307409_100006931 3300031995 Bacteria 6725
220 Ga0307409_100089358 3300031995 Bacteria 2518
221 Ga0307416_100691688 3300032002 Unclassified 1108
222 Ga0307411_10001365 3300032005 Bacteria 9881
223 Ga0307411_10015324 3300032005 Bacteria 4301
224 Ga0307415_100099379 3300032126 Bacteria 2130
225 Ga0307510_10000014 3300033180 Bacteria 271607
226 Ga0373937_0731567 3300036401 Bacteria 936
227 Ga0395898_0016284 3300037466 Bacteria 7608
228 Ga0436360_1211347 3300039438 Bacteria 3810
229 Ga0436361_0788702 3300039447 Bacteria 2673
230 Ga0436363_1322878 3300039450 Bacteria 4500
231 Ga0451789_1035707 3300041443 Bacteria 1183
232 Ga0451791_1837905 3300041451 Bacteria 5165
233 Ga0451807_0671832 3300041486 Bacteria 7508
234 Ga0451833_0928206 3300041491 Bacteria 1665
235 Ga0451853_3725255 3300041512 Unclassified 912
236 Ga0439435_0034690 3300042436 Bacteria 1388
237 Ga0451577_0286054 3300042876 Bacteria 1494
238 Ga0466972_0178794 3300044658 Bacteria 995
239 Ga0466966_0007137 3300044684 Bacteria 7405
240 Ga0466961_0000757 3300044693 Bacteria 20226
241 Ga0466964_0000124 3300044706 Bacteria 20126
242 Ga0466971_0001906 3300044719 Bacteria 8851
243 Ga0466970_0002113 3300044765 Bacteria 9590
244 Ga0466957_0037919 3300044842 Bacteria 2902
245 Ga0466959_0006776 3300045049 Bacteria 7979
246 Ga0451576_0066891 3300045051 Bacteria 3740
247 Ga0495644_0098346 3300046523 Unclassified 1107
248 Ga0495667_0534903 3300046559 Bacteria 733
249 Ga0495625_0220783 3300046660 Unclassified 1242
250 Ga0495649_0030279 3300046694 Bacteria 2990
251 Ga0495684_0698647 3300047471 Unclassified 673
252 Ga0496102_0002578 3300048905 Bacteria 15455
253 Ga0496104_0168540 3300048907 Bacteria 2100
254 Ga0496114_0043499 3300048917 Bacteria 3724
255 Ga0496114_0366251 3300048917 Bacteria 1275
256 Ga0496117_0000228 3300048920 Bacteria 106070
257 Ga0496118_0000005 3300048921 Bacteria 697350
258 Ga0496119_0002586 3300048922 Bacteria 19668
259 Ga0496120_0004968 3300048923 Bacteria 10803
260 Ga0496120_0041257 3300048923 Bacteria 2705
261 Ga0496120_0138922 3300048923 Bacteria 1235
262 Ga0496121_0012127 3300048924 Bacteria 9461
263 Ga0496125_0048221 3300048928 Bacteria 3554
264 Ga0496126_0174135 3300048929 Bacteria 1831
265 Ga0496126_0174136 3300048929 Bacteria 1831
266 Ga0501031_0280990 3300049568 Unclassified 1080
267 Ga0501040_0692484 3300049576 Bacteria 737
268 Ga0501076_0538371 3300049592 Unclassified 963
269 Ga0501076_0699387 3300049592 Bacteria 837
270 nmdc:mga08y16_11537_c1 3300050511 Bacteria 9285
271 Ga0500583_0104620 3300053092 Unclassified 1389
272 Ga0466962_0000297 3300061719 Bacteria 21249
273 Ga0157369_10327865
274 rootL2_10211637
275 Ga0070683_100176677
276 Ga0070690_100232034
277 Ga0070670_100033794
278 Ga0070670_100599483
279 Ga0070677_10000800
280 Ga0068869_100019630
281 Ga0070666_10068278
282 Ga0070660_100813840
283 Ga0070689_100019218
284 Ga0070689_100410729
285 Ga0070689_100677524
286 Ga0070687_100060220
287 Ga0070675_100034018
288 Ga0070675_100171188
289 Ga0070675_100879407
290 Ga0070674_100113659
291 Ga0070674_100980490
292 Ga0070673_100028008
293 Ga0070688_100347872
294 Ga0070688_100745213
295 Ga0070667_100000068
296 Ga0070714_100348128
297 Ga0070701_10007938
298 Ga0070701_10440272
299 Ga0070700_100066954
300 Ga0070700_100068066
301 Ga0070700_100125335
302 Ga0070700_100165831
303 Ga0070700_100473942
304 Ga0070694_100422901
305 Ga0070678_100204917
306 Ga0070662_100238661
307 Ga0070681_10000935
308 Ga0070681_10007836
309 Ga0068867_100512505
310 Ga0068867_100639920
311 Ga0070679_100003192
312 Ga0070679_100275509
313 Ga0070679_100731618
314 Ga0070672_100005291
315 Ga0070672_100005715
316 Ga0070672_100069380
317 Ga0070672_100167270
318 Ga0070672_100266424
319 Ga0070686_100028123
320 Ga0070686_100458137
321 Ga0070695_100050717
322 Ga0070665_100007335
323 Ga0070665_100011391
324 Ga0070665_100024550
325 Ga0070665_100137354
326 Ga0070665_100617489
327 Ga0068855_100001761
328 Ga0068855_100003497
329 Ga0068855_100272579
330 Ga0068855_100590934
331 Ga0070664_100020024
332 Ga0070702_100031779
333 Ga0070702_100434901
334 Ga0068852_101165868
335 Ga0068859_100003724
336 Ga0068859_100053967
337 Ga0068859_100539027
338 Ga0068859_100990764
339 Ga0068864_100792263
340 Ga0068866_10067263
341 Ga0068861_100013272
342 Ga0068861_100104398
343 Ga0068861_100120180
344 Ga0068861_100221737
345 Ga0068861_100662448
346 Ga0068870_10252006
347 Ga0068863_100040502
348 Ga0068863_100058095
349 Ga0068863_100171173
350 Ga0068860_100327134
351 Ga0068862_100081194
352 Ga0081455_10002524
353 Ga0070712_100169080
354 Ga0097621_100023122
355 Ga0097621_100693735
356 Ga0068871_100146623
357 Ga0068871_100240018
358 Ga0068865_100025368
359 Ga0068865_100158043
360 Ga0068865_100483871
361 Ga0068865_100579543
362 Ga0097620_100003724
363 Ga0097620_100053967
364 Ga0097620_100539075
365 Ga0097620_100990687
366 Ga0105240_10001356
367 Ga0105240_10009013
368 Ga0105240_10015285
369 Ga0105240_10157412
370 Ga0105240_10160904
371 Ga0105240_10166443
372 Ga0111539_10024081
373 Ga0111539_10430276
374 Ga0105245_10406523
375 Ga0105245_10675851
376 Ga0105247_10266255
377 Ga0105243_10484535
378 Ga0105248_10074136
379 Ga0105248_10774975
380 Ga0105237_10084845
381 Ga0105238_10030754
382 Ga0105238_10108049
383 Ga0105238_10169123
384 Ga0105238_10950392
385 Ga0105249_10029961
386 Ga0105249_10373898
387 Ga0157369_10002299
388 Ga0157369_10812471
389 Ga0163162_10023007
390 Ga0157372_10034968
391 Ga0157372_10279333
392 Ga0163163_10452826
393 Ga0163163_10550865
394 Ga0163163_11125166
395 Ga0157380_10054449
396 Ga0157377_10331432
397 Ga0157379_10098224
398 Ga0157376_10089547
399 Ga0157376_10094962
400 Ga0157376_10124830
401 Ga0163161_10158317
402 Ga0163161_10264359
403 Ga0163161_10506378
404 Ga0163161_10702517
405 Ga0207682_10000686
406 Ga0207682_10001879
407 Ga0207642_10081895
408 Ga0207642_10239120
409 Ga0207688_10235882
410 Ga0207680_10081969
411 Ga0207643_10008625
412 Ga0207643_10123240
413 Ga0207707_10012574
414 Ga0207707_10054480
415 Ga0207695_10009074
416 Ga0207695_10011724
417 Ga0207695_10016558
418 Ga0207695_10064288
419 Ga0207693_10043159
420 Ga0207660_10548450
421 Ga0207662_10027323
422 Ga0207662_10044931
423 Ga0207657_10670786
424 Ga0207652_10000331
425 Ga0207652_10088782
426 Ga0207694_10089368
427 Ga0207650_10067295
428 Ga0207650_10095366
429 Ga0207659_10161802
430 Ga0207659_10205051
431 Ga0207687_10480968
432 Ga0207700_10253552
433 Ga0207644_10175844
434 Ga0207670_10090681
435 Ga0207670_10390295
436 Ga0207669_10019072
437 Ga0207669_10138268
438 Ga0207704_10005591
439 Ga0207704_10084708
440 Ga0207704_10121208
441 Ga0207704_10239446
442 Ga0207704_10537656
443 Ga0207691_10005555
444 Ga0207691_10007023
445 Ga0207691_10199045
446 Ga0207691_10204120
447 Ga0207711_10827100
448 Ga0207689_10115833
449 Ga0207661_10656551
450 Ga0207679_10011438
451 Ga0207667_10001105
452 Ga0207667_10007483
453 Ga0207667_10019065
454 Ga0207651_10152987
455 Ga0207712_10241487
456 Ga0207668_10777144
457 Ga0207658_10000455
458 Ga0207658_10348588
459 Ga0207678_10435850
460 Ga0207708_10016634
461 Ga0207708_10071141
462 Ga0207708_10137293
463 Ga0207708_10431136
464 Ga0207641_10046704
465 Ga0207641_10312538
466 Ga0207648_10446397
467 Ga0207648_10487792
468 Ga0207676_10024080
469 Ga0207676_10452093
470 Ga0207676_10497980
471 Ga0207676_10921956
472 Ga0207675_100017825
473 Ga0207675_100023073
474 Ga0207675_100024447
475 Ga0207675_100443335
476 Ga0207683_10020646
477 Ga0207683_10056045
478 Ga0268266_10002522
479 Ga0268266_10004566
480 Ga0268266_10015239
481 Ga0268266_10130202
482 Ga0268265_10074258
483 Ga0265338_10013036
484 Ga0307408_100069494
485 Ga0307413_10021677
486 Ga0307406_10027175
487 Ga0307407_10004581
488 Ga0307407_10048046
489 Ga0307412_10050053
490 Ga0307412_10338948
491 Ga0307409_100006931
492 Ga0307409_100089358
493 Ga0307416_100691688
494 Ga0307411_10001365
495 Ga0307411_10015324
496 Ga0307415_100099379
497 Ga0307510_10000014
498 Ga0373937_0731567
499 Ga0395898_0016284
500 Ga0436360_1211347
501 Ga0436361_0788702
502 Ga0436363_1322878
503 Ga0451789_1035707
504 Ga0451791_1837905
505 Ga0451807_0671832
506 Ga0451833_0928206
507 Ga0451853_3725255
508 Ga0439435_0034690
509 Ga0451577_0286054
510 Ga0466972_0178794
511 Ga0466966_0007137
512 Ga0466961_0000757
513 Ga0466964_0000124
514 Ga0466971_0001906
515 Ga0466970_0002113
516 Ga0466957_0037919
517 Ga0466959_0006776
518 Ga0451576_0066891
519 Ga0495644_0098346
520 Ga0495667_0534903
521 Ga0495625_0220783
522 Ga0495649_0030279
523 Ga0495684_0698647
524 Ga0496102_0002578
525 Ga0496104_0168540
526 Ga0496114_0043499
527 Ga0496114_0366251
528 Ga0496117_0000228
529 Ga0496118_0000005
530 Ga0496119_0002586
531 Ga0496120_0004968
532 Ga0496120_0041257
533 Ga0496120_0138922
534 Ga0496121_0012127
535 Ga0496125_0048221
536 Ga0496126_0174135
537 Ga0496126_0174136
538 Ga0501031_0280990
539 Ga0501040_0692484
540 Ga0501076_0538371
541 Ga0501076_0699387
542 nmdc:mga08y16_11537_c1
543 Ga0500583_0104620
544 Ga0466962_0000297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10972

CsiV

Peptidoglycan-binding protein, CsiV

20

213

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fs4-assembly1.cif.gz_B bacteriophage ap205 coat protein 0.5863 134 179
1swg-assembly3.cif.gz_D circular permuted streptavidin e51/a46 in complex with biotin 0.4897 134 198
4gd9-assembly1.cif.gz_C circular permuted streptavidin n49/g48 0.4676 129 198
4gd9-assembly1.cif.gz_A circular permuted streptavidin n49/g48 0.4645 134 198
4gd9-assembly1.cif.gz_D circular permuted streptavidin n49/g48 0.4634 134 198
ID Description Score Start End Superfamily
af_Q54P93_232_322_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.5412 133 178 3.30.160.40
af_Q1G391_89_370_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.5128 134 185 2.120.10.80
2ywqA00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.5118 134 177 3.30.160.100
af_Q650Y6_78_400_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.507 134 188 2.120.10.80
af_Q2QMV6_43_412_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4782 132 183 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2P5LYT1-F1-model_v4 Uncharacterized protein 0.8441 133 199
AF-A0A6L8ACC0-F1-model_v4 Uncharacterized protein 0.8071 82 200
AF-A0A2E5M9K2-F1-model_v4 Uncharacterized protein 0.7961 80 200
AF-A0A6N9B3S5-F1-model_v4 Uncharacterized protein 0.7929 80 200
AF-A0A6L7VQ86-F1-model_v4 Uncharacterized protein 0.7842 80 200

Map