F378356

General Info

Members Datasets Scaffolds Average Seq Length
272 173 544 307

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10462920|Ga0157370_104629201
Length 344
Sequence LPGLAPGNFFDTVDQLFFIGRGNRRGYTSRRFIGVSIMRIAAMAAGGVGGYYGARLAAAGHDVFFIARGAHKDAIEKDGLKVESVNGDVHIAKANVTDDPAKVGPVDVVLFAVKLWDTEKAAEACRPLLGPNTRVITMQNGVDSYERIAPIVGAQRAIPAVTYVVTVIDRPGVIRQDSKFQSIICGAHDNRDDAALKAFVEAAKAAKIDITLSDEIQRDRWHKFIFLTGTSGATAVTRETMGPILKDPDTRNLFHNIMRETLKVGQAKGVKLSDSYADERLVFADGHVPASMKASMANDLDRGNRLELDWLAGTVSRMGKELGVPTPVNDTVYAALKLHRMGKH

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
106 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 2.21
Rhizosphere 90.81
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10462920 3300013104 Unclassified 1165
2 JGI25153J46596_10006364 3300003215 Bacteria 5993
3 Ga0070658_10004719 3300005327 Bacteria 11081
4 Ga0070658_10006910 3300005327 Bacteria 9162
5 Ga0070683_100304567 3300005329 Unclassified 1516
6 Ga0070680_100003470 3300005336 Bacteria 11772
7 Ga0070680_100008905 3300005336 Bacteria 7694
8 Ga0070680_100067699 3300005336 Bacteria 2929
9 Ga0070680_100232698 3300005336 Bacteria 1556
10 Ga0070680_100430524 3300005336 Unclassified 1126
11 Ga0070660_100001863 3300005339 Bacteria 14518
12 Ga0070660_100017602 3300005339 Bacteria 5211
13 Ga0070668_100087452 3300005347 Bacteria 2452
14 Ga0070668_100248416 3300005347 Unclassified 1476
15 Ga0070688_100153724 3300005365 Bacteria 1575
16 Ga0070714_100074525 3300005435 Bacteria 2942
17 Ga0070714_100150860 3300005435 Bacteria 2094
18 Ga0070663_100095945 3300005455 Unclassified 2205
19 Ga0070681_10009006 3300005458 Bacteria 9813
20 Ga0070681_10063506 3300005458 Bacteria 3665
21 Ga0070681_10106318 3300005458 Bacteria 2747
22 Ga0070681_10120170 3300005458 Bacteria 2563
23 Ga0070679_100006683 3300005530 Bacteria 10755
24 Ga0070679_100058480 3300005530 Bacteria 3841
25 Ga0070679_100327760 3300005530 Unclassified 1480
26 Ga0070684_100305702 3300005535 Bacteria 1460
27 Ga0070686_100043664 3300005544 Bacteria 2813
28 Ga0070693_100059798 3300005547 Bacteria 2210
29 Ga0068855_100015368 3300005563 Bacteria 9215
30 Ga0068855_100017733 3300005563 Bacteria 8558
31 Ga0068855_100103895 3300005563 Bacteria 3268
32 Ga0068855_100118680 3300005563 Bacteria 3029
33 Ga0068855_100172837 3300005563 Bacteria 2446
34 Ga0068855_100181728 3300005563 Bacteria 2377
35 Ga0068856_100260135 3300005614 Bacteria 1751
36 Ga0068852_100042364 3300005616 Bacteria 3854
37 Ga0068852_100100782 3300005616 Bacteria 2606
38 Ga0068852_100105066 3300005616 Bacteria 2558
39 Ga0068852_100187286 3300005616 Unclassified 1950
40 Ga0068852_100390115 3300005616 Bacteria 1367
41 Ga0068864_100020725 3300005618 Bacteria 5502
42 Ga0068861_100129242 3300005719 Bacteria 2048
43 Ga0081538_10014081 3300005981 Bacteria 6284
44 Ga0081540_1043627 3300005983 Bacteria 2298
45 Ga0075368_10003831 3300006042 Bacteria 5058
46 Ga0075368_10084423 3300006042 Bacteria 1294
47 Ga0075363_100080082 3300006048 Unclassified 1785
48 Ga0075367_10017316 3300006178 Bacteria 3953
49 Ga0075366_10004499 3300006195 Bacteria 7480
50 Ga0075370_10027028 3300006353 Bacteria 3182
51 Ga0068871_100057559 3300006358 Bacteria 3163
52 Ga0075428_100002338 3300006844 Bacteria 20574
53 Ga0075428_100028741 3300006844 Bacteria 6152
54 Ga0075428_100798872 3300006844 Bacteria 1003
55 Ga0075430_100131601 3300006846 Bacteria 2085
56 Ga0075431_100000560 3300006847 Bacteria 31320
57 Ga0075431_100124201 3300006847 Bacteria 2663
58 Ga0075431_100136330 3300006847 Bacteria 2531
59 Ga0075434_100658026 3300006871 Bacteria 1066
60 Ga0068865_100169386 3300006881 Bacteria 1673
61 Ga0105240_10013804 3300009093 Bacteria 11065
62 Ga0111539_10117436 3300009094 Bacteria 3118
63 Ga0111539_10465727 3300009094 Unclassified 1472
64 Ga0105245_10276633 3300009098 Bacteria 1639
65 Ga0114129_10023906 3300009147 Bacteria 8660
66 Ga0114129_10029493 3300009147 Bacteria 7771
67 Ga0105243_10022936 3300009148 Bacteria 4746
68 Ga0105248_10039702 3300009177 Bacteria 5275
69 Ga0105248_10054447 3300009177 Bacteria 4486
70 Ga0105248_10655400 3300009177 Bacteria 1184
71 Ga0105238_10185686 3300009551 Bacteria 2055
72 Ga0105246_10217553 3300011119 Bacteria 1495
73 Ga0157371_10040201 3300013102 Bacteria 3341
74 Ga0157370_10008959 3300013104 Bacteria 10743
75 Ga0157370_10040699 3300013104 Bacteria 4486
76 Ga0157370_10158837 3300013104 Bacteria 2104
77 Ga0157378_10096398 3300013297 Bacteria 2695
78 Ga0163162_10002427 3300013306 Bacteria 17557
79 Ga0163162_10256778 3300013306 Bacteria 1879
80 Ga0157372_10238636 3300013307 Bacteria 2109
81 Ga0157372_10250378 3300013307 Bacteria 2056
82 Ga0157375_10005788 3300013308 Bacteria 10753
83 Ga0157375_10620963 3300013308 Bacteria 1239
84 Ga0163163_10062209 3300014325 Bacteria 3698
85 Ga0206356_11266266 3300020070 Bacteria 5495
86 Ga0206353_10192893 3300020082 Bacteria 3884
87 Ga0213876_10075287 3300021384 Bacteria 1783
88 Ga0209758_1000157 3300025297 Bacteria 156173
89 Ga0207682_10069530 3300025893 Bacteria 1489
90 Ga0207680_10063991 3300025903 Bacteria 2253
91 Ga0207645_10084560 3300025907 Bacteria 2036
92 Ga0207643_10076213 3300025908 Bacteria 1937
93 Ga0207705_10007904 3300025909 Bacteria 7809
94 Ga0207705_10024268 3300025909 Bacteria 4329
95 Ga0207705_10058139 3300025909 Bacteria 2790
96 Ga0207707_10021935 3300025912 Bacteria 5581
97 Ga0207707_10086939 3300025912 Bacteria 2732
98 Ga0207695_10104632 3300025913 Bacteria 2819
99 Ga0207695_10371617 3300025913 Bacteria 1316
100 Ga0207660_10103918 3300025917 Bacteria 2126
101 Ga0207660_10258168 3300025917 Bacteria 1377
102 Ga0207662_10277762 3300025918 Bacteria 1107
103 Ga0207657_10003229 3300025919 Bacteria 17451
104 Ga0207657_10057059 3300025919 Bacteria 3367
105 Ga0207652_10018592 3300025921 Bacteria 5701
106 Ga0207652_10134365 3300025921 Unclassified 2208
107 Ga0207652_10143995 3300025921 Bacteria 2132
108 Ga0207652_10173335 3300025921 Bacteria 1936
109 Ga0207652_10186199 3300025921 Bacteria 1867
110 Ga0207694_10194498 3300025924 Bacteria 1649
111 Ga0207659_10169634 3300025926 Bacteria 1721
112 Ga0207664_10252229 3300025929 Unclassified 1540
113 Ga0207670_10005994 3300025936 Bacteria 6716
114 Ga0207704_10038973 3300025938 Bacteria 2762
115 Ga0207665_10187694 3300025939 Bacteria 1500
116 Ga0207711_10049229 3300025941 Bacteria 3608
117 Ga0207667_10010788 3300025949 Bacteria 10657
118 Ga0207667_10112730 3300025949 Bacteria 2804
119 Ga0207667_10300998 3300025949 Bacteria 1639
120 Ga0207667_10496397 3300025949 Unclassified 1238
121 Ga0207668_10160550 3300025972 Unclassified 1751
122 Ga0207668_10194866 3300025972 Unclassified 1609
123 Ga0207640_10129726 3300025981 Bacteria 1820
124 Ga0207658_10349680 3300025986 Bacteria 1287
125 Ga0207677_10103812 3300026023 Bacteria 2099
126 Ga0207639_10114950 3300026041 Bacteria 2200
127 Ga0207678_10111151 3300026067 Unclassified 2337
128 Ga0207702_10082458 3300026078 Bacteria 2796
129 Ga0207676_10654050 3300026095 Bacteria 1014
130 Ga0207675_100336499 3300026118 Bacteria 1477
131 Ga0207698_10010694 3300026142 Bacteria 5918
132 Ga0207698_10139414 3300026142 Unclassified 2086
133 Ga0265337_1003687 3300028556 Bacteria 6558
134 Ga0265338_10319078 3300028800 Bacteria 1125
135 Ga0265330_10112267 3300031235 Unclassified 1163
136 Ga0265325_10001240 3300031241 Bacteria 18214
137 Ga0265325_10099959 3300031241 Unclassified 1421
138 Ga0265325_10110164 3300031241 Bacteria 1339
139 Ga0265325_10133920 3300031241 Bacteria 1184
140 Ga0265340_10045298 3300031247 Unclassified 2149
141 Ga0265340_10051504 3300031247 Bacteria 1993
142 Ga0265313_10016364 3300031595 Bacteria 4265
143 Ga0265313_10018418 3300031595 Bacteria 3921
144 Ga0316575_10083045 3300031665 Bacteria 1293
145 Ga0265314_10161087 3300031711 Unclassified 1365
146 Ga0265342_10001313 3300031712 Bacteria 23333
147 Ga0265342_10001792 3300031712 Bacteria 19528
148 Ga0316583_10001485 3300032133 Bacteria 7857
149 Ga0373926_0025934 3300035083 Bacteria 2048
150 Ga0373943_0003026 3300035170 Bacteria 7631
151 Ga0373943_0126148 3300035170 Bacteria 1365
152 Ga0373955_0222977 3300035172 Bacteria 1126
153 Ga0373962_0006479 3300035242 Bacteria 2838
154 Ga0373931_0007679 3300035691 Bacteria 5090
155 Ga0373931_0012673 3300035691 Bacteria 4088
156 Ga0373935_0032873 3300035692 Unclassified 3225
157 Ga0373927_0029575 3300035695 Unclassified 3571
158 Ga0373927_0141658 3300035695 Bacteria 1573
159 Ga0373947_0001878 3300035725 Bacteria 12817
160 Ga0373925_0004369 3300037068 Bacteria 10695
161 Ga0373925_0029583 3300037068 Bacteria 4019
162 Ga0395899_0010711 3300037312 Bacteria 7028
163 Ga0395899_0087166 3300037312 Bacteria 2266
164 Ga0395900_0013186 3300037418 Bacteria 8448
165 Ga0395900_0059616 3300037418 Bacteria 3929
166 Ga0395900_0436826 3300037418 Bacteria 1267
167 Ga0395898_0024284 3300037466 Bacteria 6113
168 Ga0395898_0126080 3300037466 Bacteria 2453
169 Ga0395901_0031667 3300038443 Bacteria 5452
170 Ga0395901_0093040 3300038443 Bacteria 3156
171 Ga0436365_1169115 3300039437 Bacteria 3187
172 Ga0439456_013126 3300042013 Bacteria 1722
173 Ga0439459_0009773 3300042438 Bacteria 1662
174 Ga0466966_0010678 3300044684 Bacteria 6105
175 Ga0466963_0031311 3300044694 Bacteria 3438
176 Ga0453684_0684940 3300044712 Bacteria 1115
177 Ga0466957_0030510 3300044842 Bacteria 3219
178 Ga0466957_0117730 3300044842 Bacteria 1691
179 Ga0466967_0036788 3300045976 Bacteria 4182
180 Ga0466967_0466432 3300045976 Bacteria 1236
181 Ga0495638_0021845 3300046460 Bacteria 4206
182 Ga0495605_0019990 3300046474 Bacteria 3564
183 Ga0495664_0044977 3300046477 Bacteria 2618
184 Ga0495585_0012467 3300046492 Bacteria 5008
185 Ga0495607_0022734 3300046501 Bacteria 3934
186 Ga0495628_0052903 3300046516 Bacteria 3206
187 Ga0495630_0014345 3300046517 Bacteria 5771
188 Ga0495642_0008394 3300046528 Bacteria 3953
189 Ga0495665_0006177 3300046531 Bacteria 6468
190 Ga0495640_0183740 3300046533 Unclassified 1331
191 Ga0495635_0126324 3300046663 Bacteria 1744
192 Ga0495613_0047392 3300046689 Unclassified 3175
193 Ga0495670_0010111 3300046691 Bacteria 4640
194 Ga0495674_0364616 3300047319 Bacteria 1171
195 Ga0495676_0072589 3300047321 Bacteria 2642
196 Ga0495684_0022521 3300047471 Plasmid 4846
197 Ga0495593_0065423 3300047673 Bacteria 1896
198 Ga0496101_0201775 3300048904 Bacteria 1538
199 Ga0496103_0168938 3300048906 Bacteria 1404
200 Ga0496104_0212281 3300048907 Unclassified 1847
201 Ga0496109_0173569 3300048912 Bacteria 2023
202 Ga0496112_0371663 3300048915 Bacteria 1371
203 Ga0496114_0034614 3300048917 Bacteria 4168
204 Ga0501031_0002996 3300049568 Bacteria 10804
205 Ga0501032_0003864 3300049569 Bacteria 11372
206 Ga0501033_0006752 3300049570 Bacteria 8961
207 Ga0501033_0012934 3300049570 Bacteria 6365
208 Ga0501033_0104000 3300049570 Bacteria 2070
209 Ga0501034_0121259 3300049571 Bacteria 2601
210 Ga0501036_0010754 3300049572 Bacteria 7565
211 Ga0501037_0018069 3300049573 Bacteria 5194
212 Ga0501038_0026616 3300049574 Bacteria 5150
213 Ga0501038_0065540 3300049574 Bacteria 3094
214 Ga0501038_0144704 3300049574 Bacteria 1942
215 Ga0501038_0211027 3300049574 Bacteria 1553
216 Ga0501040_0171043 3300049576 Bacteria 1538
217 Ga0501042_0212559 3300049578 Bacteria 1395
218 Ga0501043_0043816 3300049579 Bacteria 3517
219 Ga0501043_0054725 3300049579 Bacteria 3134
220 Ga0501043_0105356 3300049579 Bacteria 2216
221 Ga0501047_0003612 3300049581 Bacteria 14579
222 Ga0501047_0037840 3300049581 Bacteria 4666
223 Ga0501047_0078790 3300049581 Bacteria 3168
224 Ga0501047_0089395 3300049581 Bacteria 2957
225 Ga0501047_0165688 3300049581 Bacteria 2080
226 Ga0501048_0100886 3300049582 Bacteria 2036
227 Ga0501068_0053405 3300049584 Bacteria 2446
228 Ga0501070_0044923 3300049586 Bacteria 3674
229 Ga0501070_0062791 3300049586 Bacteria 3077
230 Ga0501070_0126865 3300049586 Bacteria 2108
231 Ga0501070_0299159 3300049586 Bacteria 1311
232 Ga0501070_0442145 3300049586 Bacteria 1049
233 Ga0501071_0019593 3300049587 Bacteria 4696
234 Ga0501072_0002952 3300049588 Bacteria 12805
235 Ga0501074_0009300 3300049590 Bacteria 7137
236 Ga0501074_0076989 3300049590 Bacteria 2394
237 Ga0501076_0005769 3300049592 Bacteria 8929
238 Ga0501076_0376400 3300049592 Unclassified 1167
239 Ga0501079_0021484 3300049741 Bacteria 4937
240 Ga0501079_0081534 3300049741 Bacteria 2502
241 Ga0501079_0118481 3300049741 Bacteria 2058
242 Ga0501081_0098654 3300049743 Bacteria 2063
243 Ga0501083_0022206 3300049744 Bacteria 4404
244 Ga0501083_0027413 3300049744 Bacteria 3931
245 Ga0501035_0002901 3300049822 Bacteria 16504
246 Ga0501035_0116589 3300049822 Bacteria 2337
247 Ga0501035_0130786 3300049822 Bacteria 2188
248 Ga0501044_0000266 3300049823 Bacteria 66205
249 Ga0501044_0005518 3300049823 Bacteria 14043
250 Ga0501044_0023238 3300049823 Bacteria 6596
251 Ga0501044_0027407 3300049823 Bacteria 6022
252 Ga0501044_0042631 3300049823 Bacteria 4718
253 Ga0501044_0093476 3300049823 Bacteria 3032
254 nmdc:mga03683_51815_c1 3300050489 Bacteria 1714
255 nmdc:mga03n38_17428_c1 3300050490 Bacteria 2813
256 nmdc:mga00v17_5769_c1 3300050491 Bacteria 6542
257 nmdc:mga06z11_74562_c1 3300050494 Bacteria 1804
258 nmdc:mga05p37_29493_c1 3300050507 Bacteria 6694
259 nmdc:mga0qj67_131606_c1 3300050509 Bacteria 2026
260 nmdc:mga06r32_18613_c1 3300050510 Bacteria 6362
261 nmdc:mga06r32_236151_c1 3300050510 Bacteria 1816
262 nmdc:mga06r32_47255_c1 3300050510 Bacteria 4110
263 nmdc:mga06r32_49115_c1 3300050510 Bacteria 4034
264 nmdc:mga08y16_361878_c1 3300050511 Unclassified 1489
265 nmdc:mga0sz30_81514_c1 3300050516 Bacteria 1401
266 Ga0495619_0118161 3300053085 Bacteria 1816
267 Ga0500595_011755 3300053119 Bacteria 3409
268 Ga0500642_0068213 3300053130 Bacteria 1613
269 Ga0500616_0080045 3300053153 Bacteria 1643
270 Ga0500619_001305 3300053154 Bacteria 4373
271 Ga0501082_0263581 3300060353 Bacteria 1499
272 Ga0530510_0034860 3300061734 Bacteria 3626
273 Ga0157370_10462920
274 JGI25153J46596_10006364
275 Ga0070658_10004719
276 Ga0070658_10006910
277 Ga0070683_100304567
278 Ga0070680_100003470
279 Ga0070680_100008905
280 Ga0070680_100067699
281 Ga0070680_100232698
282 Ga0070680_100430524
283 Ga0070660_100001863
284 Ga0070660_100017602
285 Ga0070668_100087452
286 Ga0070668_100248416
287 Ga0070688_100153724
288 Ga0070714_100074525
289 Ga0070714_100150860
290 Ga0070663_100095945
291 Ga0070681_10009006
292 Ga0070681_10063506
293 Ga0070681_10106318
294 Ga0070681_10120170
295 Ga0070679_100006683
296 Ga0070679_100058480
297 Ga0070679_100327760
298 Ga0070684_100305702
299 Ga0070686_100043664
300 Ga0070693_100059798
301 Ga0068855_100015368
302 Ga0068855_100017733
303 Ga0068855_100103895
304 Ga0068855_100118680
305 Ga0068855_100172837
306 Ga0068855_100181728
307 Ga0068856_100260135
308 Ga0068852_100042364
309 Ga0068852_100100782
310 Ga0068852_100105066
311 Ga0068852_100187286
312 Ga0068852_100390115
313 Ga0068864_100020725
314 Ga0068861_100129242
315 Ga0081538_10014081
316 Ga0081540_1043627
317 Ga0075368_10003831
318 Ga0075368_10084423
319 Ga0075363_100080082
320 Ga0075367_10017316
321 Ga0075366_10004499
322 Ga0075370_10027028
323 Ga0068871_100057559
324 Ga0075428_100002338
325 Ga0075428_100028741
326 Ga0075428_100798872
327 Ga0075430_100131601
328 Ga0075431_100000560
329 Ga0075431_100124201
330 Ga0075431_100136330
331 Ga0075434_100658026
332 Ga0068865_100169386
333 Ga0105240_10013804
334 Ga0111539_10117436
335 Ga0111539_10465727
336 Ga0105245_10276633
337 Ga0114129_10023906
338 Ga0114129_10029493
339 Ga0105243_10022936
340 Ga0105248_10039702
341 Ga0105248_10054447
342 Ga0105248_10655400
343 Ga0105238_10185686
344 Ga0105246_10217553
345 Ga0157371_10040201
346 Ga0157370_10008959
347 Ga0157370_10040699
348 Ga0157370_10158837
349 Ga0157378_10096398
350 Ga0163162_10002427
351 Ga0163162_10256778
352 Ga0157372_10238636
353 Ga0157372_10250378
354 Ga0157375_10005788
355 Ga0157375_10620963
356 Ga0163163_10062209
357 Ga0206356_11266266
358 Ga0206353_10192893
359 Ga0213876_10075287
360 Ga0209758_1000157
361 Ga0207682_10069530
362 Ga0207680_10063991
363 Ga0207645_10084560
364 Ga0207643_10076213
365 Ga0207705_10007904
366 Ga0207705_10024268
367 Ga0207705_10058139
368 Ga0207707_10021935
369 Ga0207707_10086939
370 Ga0207695_10104632
371 Ga0207695_10371617
372 Ga0207660_10103918
373 Ga0207660_10258168
374 Ga0207662_10277762
375 Ga0207657_10003229
376 Ga0207657_10057059
377 Ga0207652_10018592
378 Ga0207652_10134365
379 Ga0207652_10143995
380 Ga0207652_10173335
381 Ga0207652_10186199
382 Ga0207694_10194498
383 Ga0207659_10169634
384 Ga0207664_10252229
385 Ga0207670_10005994
386 Ga0207704_10038973
387 Ga0207665_10187694
388 Ga0207711_10049229
389 Ga0207667_10010788
390 Ga0207667_10112730
391 Ga0207667_10300998
392 Ga0207667_10496397
393 Ga0207668_10160550
394 Ga0207668_10194866
395 Ga0207640_10129726
396 Ga0207658_10349680
397 Ga0207677_10103812
398 Ga0207639_10114950
399 Ga0207678_10111151
400 Ga0207702_10082458
401 Ga0207676_10654050
402 Ga0207675_100336499
403 Ga0207698_10010694
404 Ga0207698_10139414
405 Ga0265337_1003687
406 Ga0265338_10319078
407 Ga0265330_10112267
408 Ga0265325_10001240
409 Ga0265325_10099959
410 Ga0265325_10110164
411 Ga0265325_10133920
412 Ga0265340_10045298
413 Ga0265340_10051504
414 Ga0265313_10016364
415 Ga0265313_10018418
416 Ga0316575_10083045
417 Ga0265314_10161087
418 Ga0265342_10001313
419 Ga0265342_10001792
420 Ga0316583_10001485
421 Ga0373926_0025934
422 Ga0373943_0003026
423 Ga0373943_0126148
424 Ga0373955_0222977
425 Ga0373962_0006479
426 Ga0373931_0007679
427 Ga0373931_0012673
428 Ga0373935_0032873
429 Ga0373927_0029575
430 Ga0373927_0141658
431 Ga0373947_0001878
432 Ga0373925_0004369
433 Ga0373925_0029583
434 Ga0395899_0010711
435 Ga0395899_0087166
436 Ga0395900_0013186
437 Ga0395900_0059616
438 Ga0395900_0436826
439 Ga0395898_0024284
440 Ga0395898_0126080
441 Ga0395901_0031667
442 Ga0395901_0093040
443 Ga0436365_1169115
444 Ga0439456_013126
445 Ga0439459_0009773
446 Ga0466966_0010678
447 Ga0466963_0031311
448 Ga0453684_0684940
449 Ga0466957_0030510
450 Ga0466957_0117730
451 Ga0466967_0036788
452 Ga0466967_0466432
453 Ga0495638_0021845
454 Ga0495605_0019990
455 Ga0495664_0044977
456 Ga0495585_0012467
457 Ga0495607_0022734
458 Ga0495628_0052903
459 Ga0495630_0014345
460 Ga0495642_0008394
461 Ga0495665_0006177
462 Ga0495640_0183740
463 Ga0495635_0126324
464 Ga0495613_0047392
465 Ga0495670_0010111
466 Ga0495674_0364616
467 Ga0495676_0072589
468 Ga0495684_0022521
469 Ga0495593_0065423
470 Ga0496101_0201775
471 Ga0496103_0168938
472 Ga0496104_0212281
473 Ga0496109_0173569
474 Ga0496112_0371663
475 Ga0496114_0034614
476 Ga0501031_0002996
477 Ga0501032_0003864
478 Ga0501033_0006752
479 Ga0501033_0012934
480 Ga0501033_0104000
481 Ga0501034_0121259
482 Ga0501036_0010754
483 Ga0501037_0018069
484 Ga0501038_0026616
485 Ga0501038_0065540
486 Ga0501038_0144704
487 Ga0501038_0211027
488 Ga0501040_0171043
489 Ga0501042_0212559
490 Ga0501043_0043816
491 Ga0501043_0054725
492 Ga0501043_0105356
493 Ga0501047_0003612
494 Ga0501047_0037840
495 Ga0501047_0078790
496 Ga0501047_0089395
497 Ga0501047_0165688
498 Ga0501048_0100886
499 Ga0501068_0053405
500 Ga0501070_0044923
501 Ga0501070_0062791
502 Ga0501070_0126865
503 Ga0501070_0299159
504 Ga0501070_0442145
505 Ga0501071_0019593
506 Ga0501072_0002952
507 Ga0501074_0009300
508 Ga0501074_0076989
509 Ga0501076_0005769
510 Ga0501076_0376400
511 Ga0501079_0021484
512 Ga0501079_0081534
513 Ga0501079_0118481
514 Ga0501081_0098654
515 Ga0501083_0022206
516 Ga0501083_0027413
517 Ga0501035_0002901
518 Ga0501035_0116589
519 Ga0501035_0130786
520 Ga0501044_0000266
521 Ga0501044_0005518
522 Ga0501044_0023238
523 Ga0501044_0027407
524 Ga0501044_0042631
525 Ga0501044_0093476
526 nmdc:mga03683_51815_c1
527 nmdc:mga03n38_17428_c1
528 nmdc:mga00v17_5769_c1
529 nmdc:mga06z11_74562_c1
530 nmdc:mga05p37_29493_c1
531 nmdc:mga0qj67_131606_c1
532 nmdc:mga06r32_18613_c1
533 nmdc:mga06r32_236151_c1
534 nmdc:mga06r32_47255_c1
535 nmdc:mga06r32_49115_c1
536 nmdc:mga08y16_361878_c1
537 nmdc:mga0sz30_81514_c1
538 Ga0495619_0118161
539 Ga0500595_011755
540 Ga0500642_0068213
541 Ga0500616_0080045
542 Ga0500619_001305
543 Ga0501082_0263581
544 Ga0530510_0034860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

40

190

0.95

PF08546

ApbA_C

Ketopantoate reductase PanE/ApbA C terminal

215

340

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hn2-assembly2.cif.gz_D crystal structure of 2-dehydropantoate 2-reductase from geobacter metallireducens gs-15 0.9413 1 300
3hn2-assembly2.cif.gz_D crystal structure of 2-dehydropantoate 2-reductase from geobacter metallireducens gs-15 0.9323 1 300
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.9302 1 302
3hwr-assembly1.cif.gz_B crystal structure of pane/apba family ketopantoate reductase (yp_299159.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.9296 1 302
5hws-assembly1.cif.gz_D crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ 0.9284 1 302
ID Description Score Start End Superfamily
3hn2C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9416 1 177 3.40.50.720
3hn2C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 1 177 3.40.50.720
5hwsD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9338 1 176 3.40.50.720
3g17F02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9256 178 302 1.10.1040.10
5hwsD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9234 1 176 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A127ERF1-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9906 1 306 GO:0005737
GO:0008677
GO:0015940
AF-A0A2V8A2S6-F1-model_v4 2-dehydropantoate 2-reductase 0.9838 1 134 GO:0005737
AF-A0A1F4A1B8-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9814 1 306 GO:0005737
GO:0008677
GO:0015940
AF-A0A7Z9S1R1-F1-model_v4 2-dehydropantoate 2-reductase 0.9813 176 306 GO:0005737
AF-A0A522QHB1-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9805 1 269 GO:0005737
GO:0008677
GO:0015940

Map