F378316

General Info

Members Datasets Scaffolds Average Seq Length
272 169 544 233

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10156279|Ga0105245_101562792
Length 260
Sequence LSPQQSGCVAIADQFDSLPQSTQNPGEIMHPTVKAARIAGFIYLSMIIVAPFCLLYIPSKLIVRGNAAATAENILAHETLFRVSIFGDLVGQVIFICLGVALYRLLRDVNKTWALLMLSLVLASAAVCFLNVLNDVAALILFRGSDFLVAFDKPQRDALAMFFLRLYNHGQFIAEIFWGLWLFPLGLLVYRSGFIPRFIGVWLMTNCFGWLVLSFTALFFQERYNALLGYSQPVLFGEMVFMLWLLIKGANVPVLATATS

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
63 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.35
Rhizosphere 92.28
Stem 0
Stem Tuber 0
Unclassified 24.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10156279 3300009098 Bacteria 2160
2 Ga0065707_10005718 3300005295 Bacteria 4475
3 Ga0070676_10001514 3300005328 Bacteria 11747
4 Ga0070680_100095052 3300005336 Bacteria 2470
5 Ga0068868_100042950 3300005338 Bacteria 3530
6 Ga0070689_100157854 3300005340 Bacteria 1832
7 Ga0070687_100002501 3300005343 Bacteria 6917
8 Ga0070661_100300047 3300005344 Bacteria 1250
9 Ga0070668_100013458 3300005347 Bacteria 6107
10 Ga0070669_100004571 3300005353 Bacteria 9992
11 Ga0070675_100001318 3300005354 Bacteria 18141
12 Ga0070675_100430932 3300005354 Unclassified 1180
13 Ga0070673_100140369 3300005364 Bacteria 2037
14 Ga0070688_100254268 3300005365 Bacteria 1252
15 Ga0070659_100008839 3300005366 Bacteria 7381
16 Ga0070659_100256623 3300005366 Bacteria 1450
17 Ga0070709_10081493 3300005434 Unclassified 2112
18 Ga0070709_10262105 3300005434 Bacteria 1249
19 Ga0070714_100399782 3300005435 Bacteria 1298
20 Ga0070714_100612413 3300005435 Bacteria 1046
21 Ga0070713_100052761 3300005436 Unclassified 3368
22 Ga0070713_100186228 3300005436 Bacteria 1868
23 Ga0070713_100327533 3300005436 Bacteria 1416
24 Ga0070713_100407053 3300005436 Bacteria 1271
25 Ga0070710_10157681 3300005437 Bacteria 1405
26 Ga0070711_100015738 3300005439 Bacteria 4789
27 Ga0070711_100203485 3300005439 Unclassified 1529
28 Ga0070711_100306074 3300005439 Bacteria 1265
29 Ga0070694_100527089 3300005444 Bacteria 943
30 Ga0070708_100015831 3300005445 Bacteria 6237
31 Ga0070708_100041247 3300005445 Unclassified 4046
32 Ga0070708_100178299 3300005445 Unclassified 1985
33 Ga0070663_100136025 3300005455 Bacteria 1871
34 Ga0070662_100003687 3300005457 Bacteria 9578
35 Ga0070681_10101506 3300005458 Unclassified 2822
36 Ga0070706_100000308 3300005467 Bacteria 59403
37 Ga0070706_100254442 3300005467 Bacteria 1640
38 Ga0070706_100363848 3300005467 Bacteria 1348
39 Ga0070707_100000306 3300005468 Bacteria 48065
40 Ga0070707_100154298 3300005468 Bacteria 2237
41 Ga0070707_100344935 3300005468 Bacteria 1446
42 Ga0070707_100387195 3300005468 Unclassified 1358
43 Ga0070707_100427941 3300005468 Bacteria 1284
44 Ga0070698_100002499 3300005471 Bacteria 20266
45 Ga0070698_100018620 3300005471 Bacteria 7310
46 Ga0070699_100167772 3300005518 Bacteria 1945
47 Ga0070679_100066442 3300005530 Unclassified 3594
48 Ga0070697_100002643 3300005536 Bacteria 13785
49 Ga0070697_100029798 3300005536 Bacteria 4379
50 Ga0070697_100079010 3300005536 Bacteria 2708
51 Ga0070697_100176675 3300005536 Bacteria 1809
52 Ga0070697_100317866 3300005536 Bacteria 1340
53 Ga0070695_100216793 3300005545 Bacteria 1377
54 Ga0070695_100309109 3300005545 Unclassified 1171
55 Ga0070695_100514970 3300005545 Unclassified 927
56 Ga0070665_100022119 3300005548 Bacteria 6396
57 Ga0068855_100789558 3300005563 Bacteria 1010
58 Ga0068857_100579113 3300005577 Bacteria 1059
59 Ga0068856_100307567 3300005614 Bacteria 1603
60 Ga0068856_100365042 3300005614 Bacteria 1462
61 Ga0068863_100003564 3300005841 Bacteria 15362
62 Ga0068860_100077457 3300005843 Bacteria 3162
63 Ga0068860_100295592 3300005843 Unclassified 1586
64 Ga0068862_100011204 3300005844 Bacteria 7404
65 Ga0070717_10038978 3300006028 Bacteria 3864
66 Ga0070717_10053280 3300006028 Bacteria 3334
67 Ga0070717_10135387 3300006028 Bacteria 2121
68 Ga0070717_10382362 3300006028 Bacteria 1262
69 Ga0070715_10180325 3300006163 Unclassified 1058
70 Ga0070716_100097207 3300006173 Bacteria 1797
71 Ga0070716_100252854 3300006173 Unclassified 1201
72 Ga0070712_100057003 3300006175 Bacteria 2742
73 Ga0070712_100057682 3300006175 Bacteria 2729
74 Ga0070712_100344764 3300006175 Unclassified 1217
75 Ga0075433_10023716 3300006852 Bacteria 5168
76 Ga0075433_10463821 3300006852 Bacteria 1116
77 Ga0075434_100166977 3300006871 Bacteria 2221
78 Ga0075436_100284721 3300006914 Bacteria 1182
79 Ga0075435_100215156 3300007076 Bacteria 1631
80 Ga0114129_10167777 3300009147 Bacteria 2994
81 Ga0114129_10491815 3300009147 Unclassified 1603
82 Ga0105237_10134251 3300009545 Bacteria 2469
83 Ga0105249_10001454 3300009553 Bacteria 20753
84 Ga0099796_10007205 3300010159 Bacteria 2896
85 Ga0099796_10044709 3300010159 Unclassified 1514
86 Ga0099796_10087752 3300010159 Unclassified 1151
87 Ga0099796_10146168 3300010159 Unclassified 927
88 Ga0099796_10192661 3300010159 Unclassified 823
89 Ga0105239_10020114 3300010375 Bacteria 7364
90 Ga0105239_10787476 3300010375 Unclassified 1089
91 Ga0157371_10059917 3300013102 Bacteria 2699
92 Ga0157369_10042103 3300013105 Bacteria 4983
93 Ga0157374_10001376 3300013296 Bacteria 20664
94 Ga0157374_10228008 3300013296 Bacteria 1829
95 Ga0157378_10013776 3300013297 Bacteria 7073
96 Ga0163162_10179323 3300013306 Bacteria 2244
97 Ga0163162_10195226 3300013306 Bacteria 2153
98 Ga0157372_10256235 3300013307 Bacteria 2031
99 Ga0157375_10001199 3300013308 Bacteria 22351
100 Ga0157375_10227266 3300013308 Bacteria 2025
101 Ga0157375_10380956 3300013308 Bacteria 1577
102 Ga0157375_10707636 3300013308 Bacteria 1161
103 Ga0157376_10026961 3300014969 Bacteria 4548
104 Ga0157376_10242716 3300014969 Bacteria 1679
105 Ga0163161_10259028 3300017792 Bacteria 1358
106 Ga0213872_10023724 3300021361 Unclassified 2822
107 Ga0228598_1007396 3300024227 Bacteria 2238
108 Ga0207666_1000829 3300025271 Bacteria 3709
109 Ga0207697_10000305 3300025315 Bacteria 27530
110 Ga0207653_10023526 3300025885 Bacteria 1963
111 Ga0207647_10000763 3300025904 Bacteria 25154
112 Ga0207685_10006846 3300025905 Bacteria 3135
113 Ga0207699_10117111 3300025906 Bacteria 1717
114 Ga0207699_10247754 3300025906 Unclassified 1227
115 Ga0207699_10450030 3300025906 Bacteria 924
116 Ga0207645_10010498 3300025907 Bacteria 6359
117 Ga0207705_10251665 3300025909 Bacteria 1347
118 Ga0207684_10000018 3300025910 Bacteria 361536
119 Ga0207684_10143796 3300025910 Bacteria 2051
120 Ga0207684_10223807 3300025910 Unclassified 1624
121 Ga0207684_10396992 3300025910 Bacteria 1186
122 Ga0207684_10471839 3300025910 Bacteria 1077
123 Ga0207707_10033505 3300025912 Bacteria 4495
124 Ga0207693_10003735 3300025915 Bacteria 12985
125 Ga0207693_10315062 3300025915 Unclassified 1225
126 Ga0207693_10439434 3300025915 Unclassified 1020
127 Ga0207663_10104579 3300025916 Bacteria 1909
128 Ga0207663_10256051 3300025916 Bacteria 1290
129 Ga0207663_10266563 3300025916 Bacteria 1267
130 Ga0207663_10549542 3300025916 Bacteria 903
131 Ga0207662_10018557 3300025918 Unclassified 3950
132 Ga0207649_10234427 3300025920 Unclassified 1314
133 Ga0207652_10036858 3300025921 Unclassified 4136
134 Ga0207646_10119913 3300025922 Bacteria 2363
135 Ga0207646_10348784 3300025922 Bacteria 1338
136 Ga0207681_10002664 3300025923 Bacteria 11317
137 Ga0207687_10326014 3300025927 Bacteria 1244
138 Ga0207700_10000681 3300025928 Bacteria 19778
139 Ga0207700_10389254 3300025928 Bacteria 1220
140 Ga0207700_10498665 3300025928 Unclassified 1077
141 Ga0207700_10814034 3300025928 Bacteria 836
142 Ga0207664_10034447 3300025929 Bacteria 3900
143 Ga0207706_10000989 3300025933 Bacteria 28922
144 Ga0207706_10028980 3300025933 Bacteria 4943
145 Ga0207670_10195735 3300025936 Bacteria 1532
146 Ga0207669_10746952 3300025937 Bacteria 808
147 Ga0207665_10016147 3300025939 Bacteria 4904
148 Ga0207665_10359368 3300025939 Unclassified 1101
149 Ga0207665_10516225 3300025939 Bacteria 925
150 Ga0207668_10002954 3300025972 Bacteria 9963
151 Ga0207677_10021083 3300026023 Bacteria 3974
152 Ga0207702_10295394 3300026078 Bacteria 1536
153 Ga0207641_10014683 3300026088 Bacteria 6422
154 Ga0209969_1004381 3300027360 Bacteria 1973
155 Ga0209981_1018581 3300027378 Bacteria 985
156 Ga0209996_1008130 3300027395 Bacteria 1372
157 Ga0210000_1003515 3300027462 Bacteria 2258
158 Ga0209968_1000365 3300027526 Bacteria 7479
159 Ga0209999_1001213 3300027543 Bacteria 4422
160 Ga0209970_1000402 3300027614 Bacteria 7334
161 Ga0210002_1005559 3300027617 Bacteria 1895
162 Ga0209983_1000217 3300027665 Bacteria 11496
163 Ga0209588_1106333 3300027671 Unclassified 902
164 Ga0209971_1000093 3300027682 Bacteria 27033
165 Ga0209966_1017045 3300027695 Bacteria 1380
166 Ga0209998_10033327 3300027717 Unclassified 1148
167 Ga0209974_10003052 3300027876 Bacteria 6058
168 Ga0268266_10146080 3300028379 Bacteria 2126
169 Ga0268265_10014127 3300028380 Bacteria 5442
170 Ga0268264_10195472 3300028381 Bacteria 1846
171 Ga0265338_10014614 3300028800 Bacteria 8713
172 Ga0265338_10091213 3300028800 Bacteria 2518
173 Ga0265338_10106253 3300028800 Bacteria 2273
174 Ga0265762_1000769 3300030760 Bacteria 5727
175 Ga0265762_1001751 3300030760 Bacteria 3946
176 Ga0265760_10000106 3300031090 Bacteria 21052
177 Ga0265325_10003512 3300031241 Bacteria 10201
178 Ga0265325_10011740 3300031241 Bacteria 5025
179 Ga0265316_10020142 3300031344 Bacteria 5684
180 Ga0265313_10095573 3300031595 Unclassified 1326
181 Ga0265314_10127355 3300031711 Bacteria 1593
182 Ga0265314_10154181 3300031711 Unclassified 1405
183 Ga0373954_0225474 3300035118 Bacteria 922
184 Ga0373943_0045210 3300035170 Unclassified 2145
185 Ga0373931_0290148 3300035691 Unclassified 1007
186 Ga0373935_0036621 3300035692 Bacteria 3069
187 Ga0373927_0005276 3300035695 Bacteria 8939
188 Ga0373927_0041955 3300035695 Bacteria 2967
189 Ga0373947_0040255 3300035725 Unclassified 2783
190 Ga0373937_0402699 3300036401 Bacteria 1298
191 Ga0373937_0665033 3300036401 Bacteria 987
192 Ga0373925_0041358 3300037068 Bacteria 3417
193 Ga0436361_0168990 3300039447 Bacteria 11230
194 Ga0451577_0577052 3300042876 Bacteria 1021
195 Ga0451576_0082311 3300045051 Bacteria 3347
196 Ga0451576_0769387 3300045051 Bacteria 1011
197 Ga0495603_0344557 3300046455 Unclassified 855
198 Ga0495629_0023086 3300046459 Bacteria 4433
199 Ga0495629_0120342 3300046459 Bacteria 1829
200 Ga0495580_0000172 3300046472 Bacteria 48147
201 Ga0495580_0003976 3300046472 Bacteria 12478
202 Ga0495580_0004753 3300046472 Bacteria 11366
203 Ga0495580_0033017 3300046472 Bacteria 3730
204 Ga0495580_0070143 3300046472 Unclassified 2448
205 Ga0495580_0070826 3300046472 Bacteria 2436
206 Ga0495582_0000243 3300046473 Bacteria 30324
207 Ga0495582_0023182 3300046473 Unclassified 3395
208 Ga0495582_0098426 3300046473 Unclassified 1636
209 Ga0495582_0110665 3300046473 Unclassified 1543
210 Ga0495582_0316026 3300046473 Unclassified 898
211 Ga0495639_0008556 3300046475 Unclassified 4390
212 Ga0495639_0036151 3300046475 Bacteria 2211
213 Ga0495639_0064495 3300046475 Bacteria 1683
214 Ga0495662_0065660 3300046476 Bacteria 1754
215 Ga0495662_0267946 3300046476 Bacteria 841
216 Ga0495664_0021328 3300046477 Unclassified 3742
217 Ga0495584_0037783 3300046491 Bacteria 2441
218 Ga0495594_0029146 3300046499 Unclassified 2982
219 Ga0495594_0130474 3300046499 Bacteria 1423
220 Ga0495630_0022988 3300046517 Unclassified 4606
221 Ga0495630_0040075 3300046517 Bacteria 3500
222 Ga0495663_0085086 3300046525 Bacteria 1024
223 Ga0495666_0002751 3300046526 Bacteria 8787
224 Ga0495640_0242278 3300046533 Unclassified 1131
225 Ga0495640_0386131 3300046533 Bacteria 861
226 Ga0495586_0029514 3300046535 Bacteria 2935
227 Ga0495586_0130050 3300046535 Bacteria 1409
228 Ga0495645_0088719 3300046543 Unclassified 2212
229 Ga0495622_0257889 3300046557 Unclassified 766
230 Ga0495625_0104575 3300046660 Unclassified 1941
231 Ga0495635_0048067 3300046663 Bacteria 2941
232 Ga0495635_0523822 3300046663 Bacteria 779
233 Ga0495588_0070880 3300046674 Bacteria 1812
234 Ga0495647_0007145 3300046681 Bacteria 3730
235 Ga0495658_0071855 3300046683 Unclassified 2011
236 Ga0495658_0181072 3300046683 Bacteria 1307
237 Ga0495613_0019483 3300046689 Bacteria 5057
238 Ga0495613_0056045 3300046689 Bacteria 2895
239 Ga0495581_0011148 3300047315 Bacteria 5194
240 Ga0495581_0163076 3300047315 Unclassified 1303
241 Ga0495674_0165325 3300047319 Bacteria 1849
242 Ga0495674_0286082 3300047319 Bacteria 1349
243 Ga0495676_0005055 3300047321 Bacteria 12100
244 Ga0495684_0059214 3300047471 Bacteria 2917
245 Ga0495684_0189865 3300047471 Bacteria 1519
246 Ga0495593_0029845 3300047673 Bacteria 2987
247 Ga0496100_0594537 3300048903 Bacteria 859
248 Ga0496102_0884082 3300048905 Unclassified 815
249 Ga0496104_0771745 3300048907 Unclassified 868
250 Ga0496105_0336452 3300048908 Bacteria 1208
251 Ga0496105_0540192 3300048908 Unclassified 911
252 Ga0496107_0515583 3300048910 Bacteria 886
253 Ga0496108_0044893 3300048911 Bacteria 3690
254 Ga0496109_0022395 3300048912 Bacteria 5595
255 Ga0496109_0045378 3300048912 Unclassified 3988
256 Ga0496110_0167999 3300048913 Bacteria 1990
257 Ga0496112_0080827 3300048915 Bacteria 3214
258 Ga0496112_0360597 3300048915 Unclassified 1395
259 Ga0496112_0401126 3300048915 Unclassified 1311
260 Ga0496112_0481039 3300048915 Bacteria 1178
261 Ga0496113_0028922 3300048916 Bacteria 3993
262 Ga0496113_0321615 3300048916 Unclassified 1240
263 Ga0496114_0032266 3300048917 Bacteria 4309
264 Ga0496114_0388283 3300048917 Unclassified 1236
265 Ga0496115_0025189 3300048918 Unclassified 4630
266 Ga0496115_0074444 3300048918 Bacteria 2757
267 Ga0496120_0194376 3300048923 Unclassified 987
268 nmdc:mga05p37_683879_c1 3300050507 Unclassified 1143
269 nmdc:mga0n895_77821_c1 3300050512 Bacteria 3300
270 nmdc:mga0a205_283979_c1 3300050515 Bacteria 1530
271 nmdc:mga0a205_59428_c1 3300050515 Unclassified 3692
272 Ga0495619_0076388 3300053085 Bacteria 2249
273 Ga0105245_10156279
274 Ga0065707_10005718
275 Ga0070676_10001514
276 Ga0070680_100095052
277 Ga0068868_100042950
278 Ga0070689_100157854
279 Ga0070687_100002501
280 Ga0070661_100300047
281 Ga0070668_100013458
282 Ga0070669_100004571
283 Ga0070675_100001318
284 Ga0070675_100430932
285 Ga0070673_100140369
286 Ga0070688_100254268
287 Ga0070659_100008839
288 Ga0070659_100256623
289 Ga0070709_10081493
290 Ga0070709_10262105
291 Ga0070714_100399782
292 Ga0070714_100612413
293 Ga0070713_100052761
294 Ga0070713_100186228
295 Ga0070713_100327533
296 Ga0070713_100407053
297 Ga0070710_10157681
298 Ga0070711_100015738
299 Ga0070711_100203485
300 Ga0070711_100306074
301 Ga0070694_100527089
302 Ga0070708_100015831
303 Ga0070708_100041247
304 Ga0070708_100178299
305 Ga0070663_100136025
306 Ga0070662_100003687
307 Ga0070681_10101506
308 Ga0070706_100000308
309 Ga0070706_100254442
310 Ga0070706_100363848
311 Ga0070707_100000306
312 Ga0070707_100154298
313 Ga0070707_100344935
314 Ga0070707_100387195
315 Ga0070707_100427941
316 Ga0070698_100002499
317 Ga0070698_100018620
318 Ga0070699_100167772
319 Ga0070679_100066442
320 Ga0070697_100002643
321 Ga0070697_100029798
322 Ga0070697_100079010
323 Ga0070697_100176675
324 Ga0070697_100317866
325 Ga0070695_100216793
326 Ga0070695_100309109
327 Ga0070695_100514970
328 Ga0070665_100022119
329 Ga0068855_100789558
330 Ga0068857_100579113
331 Ga0068856_100307567
332 Ga0068856_100365042
333 Ga0068863_100003564
334 Ga0068860_100077457
335 Ga0068860_100295592
336 Ga0068862_100011204
337 Ga0070717_10038978
338 Ga0070717_10053280
339 Ga0070717_10135387
340 Ga0070717_10382362
341 Ga0070715_10180325
342 Ga0070716_100097207
343 Ga0070716_100252854
344 Ga0070712_100057003
345 Ga0070712_100057682
346 Ga0070712_100344764
347 Ga0075433_10023716
348 Ga0075433_10463821
349 Ga0075434_100166977
350 Ga0075436_100284721
351 Ga0075435_100215156
352 Ga0114129_10167777
353 Ga0114129_10491815
354 Ga0105237_10134251
355 Ga0105249_10001454
356 Ga0099796_10007205
357 Ga0099796_10044709
358 Ga0099796_10087752
359 Ga0099796_10146168
360 Ga0099796_10192661
361 Ga0105239_10020114
362 Ga0105239_10787476
363 Ga0157371_10059917
364 Ga0157369_10042103
365 Ga0157374_10001376
366 Ga0157374_10228008
367 Ga0157378_10013776
368 Ga0163162_10179323
369 Ga0163162_10195226
370 Ga0157372_10256235
371 Ga0157375_10001199
372 Ga0157375_10227266
373 Ga0157375_10380956
374 Ga0157375_10707636
375 Ga0157376_10026961
376 Ga0157376_10242716
377 Ga0163161_10259028
378 Ga0213872_10023724
379 Ga0228598_1007396
380 Ga0207666_1000829
381 Ga0207697_10000305
382 Ga0207653_10023526
383 Ga0207647_10000763
384 Ga0207685_10006846
385 Ga0207699_10117111
386 Ga0207699_10247754
387 Ga0207699_10450030
388 Ga0207645_10010498
389 Ga0207705_10251665
390 Ga0207684_10000018
391 Ga0207684_10143796
392 Ga0207684_10223807
393 Ga0207684_10396992
394 Ga0207684_10471839
395 Ga0207707_10033505
396 Ga0207693_10003735
397 Ga0207693_10315062
398 Ga0207693_10439434
399 Ga0207663_10104579
400 Ga0207663_10256051
401 Ga0207663_10266563
402 Ga0207663_10549542
403 Ga0207662_10018557
404 Ga0207649_10234427
405 Ga0207652_10036858
406 Ga0207646_10119913
407 Ga0207646_10348784
408 Ga0207681_10002664
409 Ga0207687_10326014
410 Ga0207700_10000681
411 Ga0207700_10389254
412 Ga0207700_10498665
413 Ga0207700_10814034
414 Ga0207664_10034447
415 Ga0207706_10000989
416 Ga0207706_10028980
417 Ga0207670_10195735
418 Ga0207669_10746952
419 Ga0207665_10016147
420 Ga0207665_10359368
421 Ga0207665_10516225
422 Ga0207668_10002954
423 Ga0207677_10021083
424 Ga0207702_10295394
425 Ga0207641_10014683
426 Ga0209969_1004381
427 Ga0209981_1018581
428 Ga0209996_1008130
429 Ga0210000_1003515
430 Ga0209968_1000365
431 Ga0209999_1001213
432 Ga0209970_1000402
433 Ga0210002_1005559
434 Ga0209983_1000217
435 Ga0209588_1106333
436 Ga0209971_1000093
437 Ga0209966_1017045
438 Ga0209998_10033327
439 Ga0209974_10003052
440 Ga0268266_10146080
441 Ga0268265_10014127
442 Ga0268264_10195472
443 Ga0265338_10014614
444 Ga0265338_10091213
445 Ga0265338_10106253
446 Ga0265762_1000769
447 Ga0265762_1001751
448 Ga0265760_10000106
449 Ga0265325_10003512
450 Ga0265325_10011740
451 Ga0265316_10020142
452 Ga0265313_10095573
453 Ga0265314_10127355
454 Ga0265314_10154181
455 Ga0373954_0225474
456 Ga0373943_0045210
457 Ga0373931_0290148
458 Ga0373935_0036621
459 Ga0373927_0005276
460 Ga0373927_0041955
461 Ga0373947_0040255
462 Ga0373937_0402699
463 Ga0373937_0665033
464 Ga0373925_0041358
465 Ga0436361_0168990
466 Ga0451577_0577052
467 Ga0451576_0082311
468 Ga0451576_0769387
469 Ga0495603_0344557
470 Ga0495629_0023086
471 Ga0495629_0120342
472 Ga0495580_0000172
473 Ga0495580_0003976
474 Ga0495580_0004753
475 Ga0495580_0033017
476 Ga0495580_0070143
477 Ga0495580_0070826
478 Ga0495582_0000243
479 Ga0495582_0023182
480 Ga0495582_0098426
481 Ga0495582_0110665
482 Ga0495582_0316026
483 Ga0495639_0008556
484 Ga0495639_0036151
485 Ga0495639_0064495
486 Ga0495662_0065660
487 Ga0495662_0267946
488 Ga0495664_0021328
489 Ga0495584_0037783
490 Ga0495594_0029146
491 Ga0495594_0130474
492 Ga0495630_0022988
493 Ga0495630_0040075
494 Ga0495663_0085086
495 Ga0495666_0002751
496 Ga0495640_0242278
497 Ga0495640_0386131
498 Ga0495586_0029514
499 Ga0495586_0130050
500 Ga0495645_0088719
501 Ga0495622_0257889
502 Ga0495625_0104575
503 Ga0495635_0048067
504 Ga0495635_0523822
505 Ga0495588_0070880
506 Ga0495647_0007145
507 Ga0495658_0071855
508 Ga0495658_0181072
509 Ga0495613_0019483
510 Ga0495613_0056045
511 Ga0495581_0011148
512 Ga0495581_0163076
513 Ga0495674_0165325
514 Ga0495674_0286082
515 Ga0495676_0005055
516 Ga0495684_0059214
517 Ga0495684_0189865
518 Ga0495593_0029845
519 Ga0496100_0594537
520 Ga0496102_0884082
521 Ga0496104_0771745
522 Ga0496105_0336452
523 Ga0496105_0540192
524 Ga0496107_0515583
525 Ga0496108_0044893
526 Ga0496109_0022395
527 Ga0496109_0045378
528 Ga0496110_0167999
529 Ga0496112_0080827
530 Ga0496112_0360597
531 Ga0496112_0401126
532 Ga0496112_0481039
533 Ga0496113_0028922
534 Ga0496113_0321615
535 Ga0496114_0032266
536 Ga0496114_0388283
537 Ga0496115_0025189
538 Ga0496115_0074444
539 Ga0496120_0194376
540 nmdc:mga05p37_683879_c1
541 nmdc:mga0n895_77821_c1
542 nmdc:mga0a205_283979_c1
543 nmdc:mga0a205_59428_c1
544 Ga0495619_0076388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14329

DUF4386

Domain of unknown function (DUF4386)

38

249

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.5216 11 149
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.504 11 149
7jh6-assembly4.cif.gz_D de novo designed two-domain di-zn(ii) and porphyrin-binding protein 0.4099 4 149
7d3s-assembly1.cif.gz_R human secr in complex with an engineered gs heterotrimer 0.4004 4 216
1fnt-assembly1.cif.gz_g crystal structure of the 20s proteasome from yeast in complex with the proteasome activator pa26 from trypanosome brucei at 3.2 angstroms resolution 0.3975 15 149
ID Description Score Start End Superfamily
af_A0A2R8Q5Z1_5_176_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5811 22 220 1.20.1070.10
af_A0A2R8Q5Z1_5_176_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5648 22 220 1.20.1070.10
af_Q8IM26_1_284_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5646 4 222 1.20.1070.10
af_B5DEF4_7_226_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5419 12 222 1.20.1070.10
af_I1KQF5_10_198_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.5293 12 172 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A2V5YZ10-F1-model_v4 DUF4386 domain-containing protein 0.9857 1 150 GO:0016020
AF-A0A1Q7T9W4-F1-model_v4 DUF4386 domain-containing protein 0.9827 1 228 GO:0016020
AF-A0A2V6EES3-F1-model_v4 DUF4386 domain-containing protein 0.9824 1 106 GO:0016020
AF-A0A2V5Y7S8-F1-model_v4 DUF4386 domain-containing protein 0.974 1 172 GO:0016020
AF-A0A2V5YZ10-F1-model_v4 DUF4386 domain-containing protein 0.9729 1 150 GO:0016020

Map