F378215
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 272 | 152 | 272 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100006829|Ga0070697_1000068298 |
| Length | 225 |
| Sequence | MHNLFFTALVFVGATSVASAQQPLSPADVKSLLARIRDKRAAAPYMQANFQEERAVHLMNKPIVSSGKVWFRAPDKFRREVRGSSPSVTVSDGEQLWIYYPNFKSAEHYSLGKRSPVNAGIAAVTAALNLENVEATYHITASRIDSPQAGYELELLPRTPSLKRMFQKFNLRMNDELFVTRTEMLQPNGDGIITTYSNYSNAPIPESTFMFTPPPGTEVTTPLGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 113 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 114 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 118 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 119 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 120 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 123 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 141 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 142 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 143 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 147 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 148 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 149 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.99 |
| Rhizosphere | 93.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000017 | 3300000545 | Bacteria | 35464 |
| 2 | JGI25404J52841_10003628 | 3300003659 | Unclassified | 3065 |
| 3 | Ga0065704_10005395 | 3300005289 | Bacteria | 5808 |
| 4 | Ga0065715_10182724 | 3300005293 | Bacteria | 1465 |
| 5 | Ga0065707_10010208 | 3300005295 | Bacteria | 3509 |
| 6 | Ga0070676_10006154 | 3300005328 | Bacteria | 6409 |
| 7 | Ga0068869_100109566 | 3300005334 | Bacteria | 2099 |
| 8 | Ga0070666_10020404 | 3300005335 | Bacteria | 4283 |
| 9 | Ga0068868_100006255 | 3300005338 | Bacteria | 8421 |
| 10 | Ga0068868_100126510 | 3300005338 | Unclassified | 2088 |
| 11 | Ga0068868_100575669 | 3300005338 | Unclassified | 995 |
| 12 | Ga0070660_100017141 | 3300005339 | Bacteria | 5274 |
| 13 | Ga0070689_100007138 | 3300005340 | Bacteria | 7788 |
| 14 | Ga0070689_100035850 | 3300005340 | Bacteria | 3791 |
| 15 | Ga0070687_100000887 | 3300005343 | Bacteria | 10074 |
| 16 | Ga0070668_100002154 | 3300005347 | Bacteria | 14422 |
| 17 | Ga0070668_100005686 | 3300005347 | Bacteria | 9243 |
| 18 | Ga0070669_100004516 | 3300005353 | Bacteria | 10040 |
| 19 | Ga0070669_100023146 | 3300005353 | Bacteria | 4447 |
| 20 | Ga0070675_100001260 | 3300005354 | Bacteria | 18513 |
| 21 | Ga0070675_100025909 | 3300005354 | Bacteria | 4703 |
| 22 | Ga0070675_100119586 | 3300005354 | Unclassified | 2237 |
| 23 | Ga0070675_100300368 | 3300005354 | Unclassified | 1414 |
| 24 | Ga0070671_100573976 | 3300005355 | Unclassified | 974 |
| 25 | Ga0070671_100602409 | 3300005355 | Unclassified | 949 |
| 26 | Ga0070659_100017913 | 3300005366 | Bacteria | 5336 |
| 27 | Ga0070659_100028453 | 3300005366 | Bacteria | 4316 |
| 28 | Ga0070667_100003659 | 3300005367 | Bacteria | 13085 |
| 29 | Ga0070667_100080482 | 3300005367 | Bacteria | 2786 |
| 30 | Ga0070709_10018983 | 3300005434 | Bacteria | 3968 |
| 31 | Ga0070709_10189868 | 3300005434 | Bacteria | 1448 |
| 32 | Ga0070714_100075823 | 3300005435 | Bacteria | 2918 |
| 33 | Ga0070714_100261103 | 3300005435 | Bacteria | 1604 |
| 34 | Ga0070713_100521001 | 3300005436 | Unclassified | 1123 |
| 35 | Ga0070710_10202451 | 3300005437 | Bacteria | 1254 |
| 36 | Ga0070710_10232057 | 3300005437 | Unclassified | 1179 |
| 37 | Ga0070710_10707324 | 3300005437 | Unclassified | 712 |
| 38 | Ga0070711_100039014 | 3300005439 | Bacteria | 3196 |
| 39 | Ga0070711_100474274 | 3300005439 | Unclassified | 1027 |
| 40 | Ga0070711_100807947 | 3300005439 | Unclassified | 796 |
| 41 | Ga0070705_100058990 | 3300005440 | Bacteria | 2270 |
| 42 | Ga0070705_100159070 | 3300005440 | Unclassified | 1508 |
| 43 | Ga0070708_100037791 | 3300005445 | Bacteria | 4215 |
| 44 | Ga0070708_100054126 | 3300005445 | Bacteria | 3563 |
| 45 | Ga0070708_100145493 | 3300005445 | Unclassified | 2201 |
| 46 | Ga0070708_100258779 | 3300005445 | Bacteria | 1636 |
| 47 | Ga0070708_100464446 | 3300005445 | Bacteria | 1194 |
| 48 | Ga0070708_100481128 | 3300005445 | Bacteria | 1171 |
| 49 | Ga0070678_100180008 | 3300005456 | Bacteria | 1729 |
| 50 | Ga0070678_100366028 | 3300005456 | Bacteria | 1244 |
| 51 | Ga0070662_100000581 | 3300005457 | Bacteria | 22251 |
| 52 | Ga0070662_100037379 | 3300005457 | Bacteria | 3442 |
| 53 | Ga0070662_100049658 | 3300005457 | Bacteria | 3026 |
| 54 | Ga0070662_100878551 | 3300005457 | Unclassified | 764 |
| 55 | Ga0068867_100287827 | 3300005459 | Unclassified | 1350 |
| 56 | Ga0070706_100000339 | 3300005467 | Bacteria | 56563 |
| 57 | Ga0070706_100013043 | 3300005467 | Bacteria | 7691 |
| 58 | Ga0070706_100654367 | 3300005467 | Unclassified | 975 |
| 59 | Ga0070707_100007723 | 3300005468 | Bacteria | 9991 |
| 60 | Ga0070707_100045815 | 3300005468 | Bacteria | 4185 |
| 61 | Ga0070707_100048148 | 3300005468 | Unclassified | 4083 |
| 62 | Ga0070707_100119938 | 3300005468 | Bacteria | 2553 |
| 63 | Ga0070707_100201550 | 3300005468 | Bacteria | 1940 |
| 64 | Ga0070698_100024495 | 3300005471 | Bacteria | 6297 |
| 65 | Ga0070699_100027265 | 3300005518 | Bacteria | 4929 |
| 66 | Ga0070699_100206318 | 3300005518 | Bacteria | 1749 |
| 67 | Ga0070697_100006829 | 3300005536 | Bacteria | 8858 |
| 68 | Ga0070697_100013899 | 3300005536 | Bacteria | 6318 |
| 69 | Ga0070697_100117411 | 3300005536 | Viruses | 2222 |
| 70 | Ga0070697_100150043 | 3300005536 | Bacteria | 1964 |
| 71 | Ga0070672_100016236 | 3300005543 | Bacteria | 5326 |
| 72 | Ga0070672_100063463 | 3300005543 | Bacteria | 2917 |
| 73 | Ga0070695_100005934 | 3300005545 | Bacteria | 7211 |
| 74 | Ga0070696_100016487 | 3300005546 | Bacteria | 4977 |
| 75 | Ga0070696_100150780 | 3300005546 | Bacteria | 1706 |
| 76 | Ga0070665_100160996 | 3300005548 | Unclassified | 2247 |
| 77 | Ga0070665_100667791 | 3300005548 | Bacteria | 1052 |
| 78 | Ga0070702_100028062 | 3300005615 | Bacteria | 3046 |
| 79 | Ga0068860_100005184 | 3300005843 | Bacteria | 13250 |
| 80 | Ga0068860_100448482 | 3300005843 | Unclassified | 1283 |
| 81 | Ga0068862_100003505 | 3300005844 | Bacteria | 13475 |
| 82 | Ga0068862_100333481 | 3300005844 | Bacteria | 1403 |
| 83 | Ga0081455_10001507 | 3300005937 | Bacteria | 28752 |
| 84 | Ga0081455_10007190 | 3300005937 | Bacteria | 11762 |
| 85 | Ga0081455_10024323 | 3300005937 | Bacteria | 5610 |
| 86 | Ga0081540_1000152 | 3300005983 | Bacteria | 70858 |
| 87 | Ga0081539_10065068 | 3300005985 | Bacteria | 1981 |
| 88 | Ga0070717_10000658 | 3300006028 | Bacteria | 22180 |
| 89 | Ga0070717_10035314 | 3300006028 | Bacteria | 4046 |
| 90 | Ga0070717_10045380 | 3300006028 | Bacteria | 3593 |
| 91 | Ga0070717_10441130 | 3300006028 | Unclassified | 1172 |
| 92 | Ga0070715_10061428 | 3300006163 | Bacteria | 1650 |
| 93 | Ga0070716_100040252 | 3300006173 | Unclassified | 2599 |
| 94 | Ga0070716_100145871 | 3300006173 | Bacteria | 1516 |
| 95 | Ga0070712_100004993 | 3300006175 | Bacteria | 8210 |
| 96 | Ga0070712_100058649 | 3300006175 | Bacteria | 2708 |
| 97 | Ga0070712_100365938 | 3300006175 | Bacteria | 1184 |
| 98 | Ga0070712_100783153 | 3300006175 | Unclassified | 817 |
| 99 | Ga0075428_100477857 | 3300006844 | Bacteria | 1334 |
| 100 | Ga0075428_100518425 | 3300006844 | Bacteria | 1275 |
| 101 | Ga0075433_10435729 | 3300006852 | Unclassified | 1156 |
| 102 | Ga0075434_100106636 | 3300006871 | Bacteria | 2812 |
| 103 | Ga0075434_100645668 | 3300006871 | Unclassified | 1077 |
| 104 | Ga0068865_100125961 | 3300006881 | Unclassified | 1912 |
| 105 | Ga0075435_100041003 | 3300007076 | Bacteria | 3699 |
| 106 | Ga0099795_10150233 | 3300007788 | Bacteria | 953 |
| 107 | Ga0105245_10040765 | 3300009098 | Unclassified | 4138 |
| 108 | Ga0105245_10113951 | 3300009098 | Bacteria | 2518 |
| 109 | Ga0114129_10018659 | 3300009147 | Bacteria | 9876 |
| 110 | Ga0105243_10695627 | 3300009148 | Unclassified | 990 |
| 111 | Ga0105242_10023913 | 3300009176 | Bacteria | 4821 |
| 112 | Ga0105248_10313800 | 3300009177 | Bacteria | 1766 |
| 113 | Ga0105249_10012996 | 3300009553 | Bacteria | 7347 |
| 114 | Ga0105249_10495464 | 3300009553 | Unclassified | 1266 |
| 115 | Ga0099796_10094795 | 3300010159 | Bacteria | 1114 |
| 116 | Ga0105239_10024855 | 3300010375 | Bacteria | 6597 |
| 117 | Ga0105246_10114073 | 3300011119 | Bacteria | 1990 |
| 118 | Ga0105246_10322082 | 3300011119 | Bacteria | 1256 |
| 119 | Ga0157369_11203929 | 3300013105 | Unclassified | 773 |
| 120 | Ga0157374_10005391 | 3300013296 | Bacteria | 10747 |
| 121 | Ga0157374_10205850 | 3300013296 | Bacteria | 1928 |
| 122 | Ga0157378_10027624 | 3300013297 | Bacteria | 5006 |
| 123 | Ga0157378_10103048 | 3300013297 | Bacteria | 2607 |
| 124 | Ga0157378_10155658 | 3300013297 | Unclassified | 2133 |
| 125 | Ga0157378_10605950 | 3300013297 | Unclassified | 1107 |
| 126 | Ga0163162_10004489 | 3300013306 | Bacteria | 13447 |
| 127 | Ga0163162_10032650 | 3300013306 | Bacteria | 5171 |
| 128 | Ga0163162_10111574 | 3300013306 | Bacteria | 2832 |
| 129 | Ga0157372_10124908 | 3300013307 | Bacteria | 2958 |
| 130 | Ga0157372_10324829 | 3300013307 | Unclassified | 1792 |
| 131 | Ga0157372_11449890 | 3300013307 | Unclassified | 791 |
| 132 | Ga0157375_10033550 | 3300013308 | Bacteria | 4878 |
| 133 | Ga0157375_11168115 | 3300013308 | Unclassified | 902 |
| 134 | Ga0163163_10761670 | 3300014325 | Bacteria | 1031 |
| 135 | Ga0157379_10035196 | 3300014968 | Bacteria | 4465 |
| 136 | Ga0157376_10067053 | 3300014969 | Unclassified | 3035 |
| 137 | Ga0157376_10176324 | 3300014969 | Bacteria | 1950 |
| 138 | Ga0163161_10002469 | 3300017792 | Bacteria | 13192 |
| 139 | Ga0163161_10106221 | 3300017792 | Bacteria | 2095 |
| 140 | Ga0207666_1005580 | 3300025271 | Unclassified | 1611 |
| 141 | Ga0207673_1001473 | 3300025290 | Unclassified | 2574 |
| 142 | Ga0207697_10000025 | 3300025315 | Bacteria | 52572 |
| 143 | Ga0207697_10000160 | 3300025315 | Bacteria | 33765 |
| 144 | Ga0207692_10247834 | 3300025898 | Bacteria | 1066 |
| 145 | Ga0207688_10001029 | 3300025901 | Bacteria | 14267 |
| 146 | Ga0207680_10197016 | 3300025903 | Unclassified | 1370 |
| 147 | Ga0207685_10052755 | 3300025905 | Unclassified | 1576 |
| 148 | Ga0207699_10025578 | 3300025906 | Bacteria | 3242 |
| 149 | Ga0207645_10001376 | 3300025907 | Bacteria | 19947 |
| 150 | Ga0207645_10003969 | 3300025907 | Bacteria | 11043 |
| 151 | Ga0207645_10043378 | 3300025907 | Bacteria | 2878 |
| 152 | Ga0207684_10000276 | 3300025910 | Bacteria | 75551 |
| 153 | Ga0207684_10003154 | 3300025910 | Bacteria | 16212 |
| 154 | Ga0207684_10004944 | 3300025910 | Bacteria | 12438 |
| 155 | Ga0207684_10053578 | 3300025910 | Unclassified | 3424 |
| 156 | Ga0207684_10185805 | 3300025910 | Bacteria | 1792 |
| 157 | Ga0207684_10533971 | 3300025910 | Bacteria | 1004 |
| 158 | Ga0207707_10073689 | 3300025912 | Bacteria | 2977 |
| 159 | Ga0207693_10001965 | 3300025915 | Bacteria | 18024 |
| 160 | Ga0207693_10016370 | 3300025915 | Bacteria | 5926 |
| 161 | Ga0207693_10045550 | 3300025915 | Bacteria | 3447 |
| 162 | Ga0207693_10336701 | 3300025915 | Bacteria | 1181 |
| 163 | Ga0207663_10032531 | 3300025916 | Bacteria | 3097 |
| 164 | Ga0207663_10336457 | 3300025916 | Bacteria | 1139 |
| 165 | Ga0207663_10501097 | 3300025916 | Unclassified | 943 |
| 166 | Ga0207662_10000736 | 3300025918 | Bacteria | 15013 |
| 167 | Ga0207657_10059111 | 3300025919 | Bacteria | 3296 |
| 168 | Ga0207646_10054326 | 3300025922 | Bacteria | 3583 |
| 169 | Ga0207646_10082005 | 3300025922 | Bacteria | 2884 |
| 170 | Ga0207646_10102008 | 3300025922 | Bacteria | 2572 |
| 171 | Ga0207646_10103010 | 3300025922 | Bacteria | 2559 |
| 172 | Ga0207646_10171499 | 3300025922 | Bacteria | 1959 |
| 173 | Ga0207646_10174792 | 3300025922 | Unclassified | 1940 |
| 174 | Ga0207646_10365220 | 3300025922 | Unclassified | 1304 |
| 175 | Ga0207646_10683102 | 3300025922 | Bacteria | 919 |
| 176 | Ga0207646_10729266 | 3300025922 | Unclassified | 885 |
| 177 | Ga0207681_10003035 | 3300025923 | Bacteria | 10555 |
| 178 | Ga0207659_10022932 | 3300025926 | Bacteria | 4163 |
| 179 | Ga0207659_10140670 | 3300025926 | Bacteria | 1873 |
| 180 | Ga0207700_10188346 | 3300025928 | Bacteria | 1732 |
| 181 | Ga0207700_10894469 | 3300025928 | Unclassified | 794 |
| 182 | Ga0207664_10223646 | 3300025929 | Bacteria | 1634 |
| 183 | Ga0207644_10059804 | 3300025931 | Bacteria | 2756 |
| 184 | Ga0207644_10249456 | 3300025931 | Unclassified | 1416 |
| 185 | Ga0207690_10009811 | 3300025932 | Bacteria | 5690 |
| 186 | Ga0207706_10000443 | 3300025933 | Bacteria | 44273 |
| 187 | Ga0207706_10015402 | 3300025933 | Bacteria | 6908 |
| 188 | Ga0207706_10019313 | 3300025933 | Bacteria | 6130 |
| 189 | Ga0207706_10431101 | 3300025933 | Unclassified | 1142 |
| 190 | Ga0207686_10465125 | 3300025934 | Unclassified | 975 |
| 191 | Ga0207704_10107677 | 3300025938 | Unclassified | 1875 |
| 192 | Ga0207665_10006639 | 3300025939 | Bacteria | 7677 |
| 193 | Ga0207665_10023675 | 3300025939 | Bacteria | 4045 |
| 194 | Ga0207665_10051968 | 3300025939 | Bacteria | 2760 |
| 195 | Ga0207665_10125268 | 3300025939 | Bacteria | 1818 |
| 196 | Ga0207691_10000864 | 3300025940 | Bacteria | 30113 |
| 197 | Ga0207689_10124661 | 3300025942 | Bacteria | 2119 |
| 198 | Ga0207651_10086148 | 3300025960 | Bacteria | 2282 |
| 199 | Ga0207712_10025223 | 3300025961 | Bacteria | 3949 |
| 200 | Ga0207712_10725124 | 3300025961 | Unclassified | 869 |
| 201 | Ga0207668_10002178 | 3300025972 | Bacteria | 11423 |
| 202 | Ga0207668_10066841 | 3300025972 | Unclassified | 2550 |
| 203 | Ga0207668_10114723 | 3300025972 | Bacteria | 2028 |
| 204 | Ga0207668_10212350 | 3300025972 | Bacteria | 1549 |
| 205 | Ga0207640_10198402 | 3300025981 | Bacteria | 1519 |
| 206 | Ga0207677_10197625 | 3300026023 | Unclassified | 1596 |
| 207 | Ga0207702_11185324 | 3300026078 | Unclassified | 758 |
| 208 | Ga0207702_11202481 | 3300026078 | Bacteria | 752 |
| 209 | Ga0207641_10780664 | 3300026088 | Bacteria | 944 |
| 210 | Ga0207683_10036694 | 3300026121 | Bacteria | 4269 |
| 211 | Ga0268266_10115513 | 3300028379 | Bacteria | 2383 |
| 212 | Ga0268266_10453013 | 3300028379 | Unclassified | 1220 |
| 213 | Ga0268265_10167826 | 3300028380 | Bacteria | 1872 |
| 214 | Ga0268264_10009371 | 3300028381 | Bacteria | 8103 |
| 215 | Ga0268264_10313295 | 3300028381 | Unclassified | 1481 |
| 216 | Ga0373926_0046618 | 3300035083 | Bacteria | 1556 |
| 217 | Ga0373944_0033763 | 3300035089 | Bacteria | 1552 |
| 218 | Ga0373945_0025789 | 3300035116 | Bacteria | 2045 |
| 219 | Ga0373946_0031008 | 3300035171 | Bacteria | 2138 |
| 220 | Ga0373935_0018633 | 3300035692 | Bacteria | 4227 |
| 221 | Ga0373935_0056420 | 3300035692 | Unclassified | 2504 |
| 222 | Ga0373935_0249725 | 3300035692 | Bacteria | 1241 |
| 223 | Ga0373927_0124378 | 3300035695 | Unclassified | 1684 |
| 224 | Ga0373927_0175985 | 3300035695 | Bacteria | 1403 |
| 225 | Ga0373933_0418026 | 3300035724 | Unclassified | 876 |
| 226 | Ga0373947_0138457 | 3300035725 | Bacteria | 1559 |
| 227 | Ga0373947_0479461 | 3300035725 | Unclassified | 844 |
| 228 | Ga0373937_0157799 | 3300036401 | Unclassified | 2127 |
| 229 | Ga0373925_0035220 | 3300037068 | Bacteria | 3693 |
| 230 | Ga0373925_0154684 | 3300037068 | Bacteria | 1803 |
| 231 | Ga0395900_0383289 | 3300037418 | Unclassified | 1373 |
| 232 | Ga0395898_0010142 | 3300037466 | Bacteria | 9861 |
| 233 | Ga0395898_0230674 | 3300037466 | Bacteria | 1766 |
| 234 | Ga0395901_0026924 | 3300038443 | Bacteria | 5904 |
| 235 | Ga0395901_0247923 | 3300038443 | Unclassified | 1856 |
| 236 | Ga0439455_0029689 | 3300042012 | Bacteria | 1353 |
| 237 | Ga0451576_0027516 | 3300045051 | Bacteria | 6105 |
| 238 | Ga0495592_0039482 | 3300046454 | Bacteria | 3545 |
| 239 | Ga0495641_0222574 | 3300046461 | Unclassified | 847 |
| 240 | Ga0495582_0378425 | 3300046473 | Unclassified | 816 |
| 241 | Ga0495662_0041669 | 3300046476 | Bacteria | 2217 |
| 242 | Ga0495630_0081404 | 3300046517 | Unclassified | 2443 |
| 243 | Ga0495658_0170490 | 3300046683 | Bacteria | 1347 |
| 244 | Ga0495604_0137925 | 3300047317 | Bacteria | 1746 |
| 245 | Ga0495674_0443422 | 3300047319 | Bacteria | 1044 |
| 246 | Ga0495684_0034514 | 3300047471 | Bacteria | 3881 |
| 247 | Ga0495684_0122098 | 3300047471 | Bacteria | 1961 |
| 248 | Ga0496100_0081937 | 3300048903 | Unclassified | 2181 |
| 249 | Ga0496101_0002744 | 3300048904 | Bacteria | 10812 |
| 250 | Ga0496101_0135575 | 3300048904 | Unclassified | 1873 |
| 251 | Ga0496102_0066764 | 3300048905 | Bacteria | 3297 |
| 252 | Ga0496102_0377330 | 3300048905 | Unclassified | 1334 |
| 253 | Ga0496104_0216232 | 3300048907 | Bacteria | 1828 |
| 254 | Ga0496104_0304411 | 3300048907 | Unclassified | 1506 |
| 255 | Ga0496105_0203233 | 3300048908 | Bacteria | 1617 |
| 256 | Ga0496106_0005308 | 3300048909 | Bacteria | 9545 |
| 257 | Ga0496107_0040088 | 3300048910 | Bacteria | 3360 |
| 258 | Ga0496107_0267277 | 3300048910 | Unclassified | 1273 |
| 259 | Ga0496109_0935962 | 3300048912 | Bacteria | 804 |
| 260 | Ga0496110_0078467 | 3300048913 | Unclassified | 2940 |
| 261 | Ga0496112_0030748 | 3300048915 | Bacteria | 5201 |
| 262 | Ga0496112_0818147 | 3300048915 | Unclassified | 856 |
| 263 | Ga0496113_0106517 | 3300048916 | Bacteria | 2178 |
| 264 | Ga0496114_0153806 | 3300048917 | Unclassified | 1996 |
| 265 | Ga0496115_0005041 | 3300048918 | Bacteria | 9598 |
| 266 | Ga0496115_0006654 | 3300048918 | Bacteria | 8482 |
| 267 | nmdc:mga0n895_448222_c1 | 3300050512 | Bacteria | 1303 |
| 268 | nmdc:mga0n895_797244_c1 | 3300050512 | Unclassified | 935 |
| 269 | nmdc:mga0rr50_123598_c1 | 3300050513 | Unclassified | 2063 |
| 270 | nmdc:mga0a205_382884_c1 | 3300050515 | Bacteria | 1272 |
| 271 | nmdc:mga0a205_773635_c1 | 3300050515 | Bacteria | 808 |
| 272 | Ga0495619_0274694 | 3300053085 | Bacteria | 1168 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10018983 | Ga0070709_100189832 | 212 |
| 2 | 3300025922 | Ga0207646_10683102 | Ga0207646_106831021 | 213 |
| 3 | 3300035695 | Ga0373927_0124378 | Ga0373927_0124378_10_651 | 213 |
| 4 | 3300014969 | Ga0157376_10176324 | Ga0157376_101763242 | 214 |
| 5 | 3300005985 | Ga0081539_10065068 | Ga0081539_100650682 | 215 |
| 6 | 3300005445 | Ga0070708_100037791 | Ga0070708_1000377912 | 216 |
| 7 | 3300003659 | JGI25404J52841_10003628 | JGI25404J52841_100036283 | 217 |
| 8 | 3300005293 | Ga0065715_10182724 | Ga0065715_101827242 | 217 |
| 9 | 3300005295 | Ga0065707_10010208 | Ga0065707_100102081 | 217 |
| 10 | 3300005340 | Ga0070689_100035850 | Ga0070689_1000358505 | 217 |
| 11 | 3300005354 | Ga0070675_100119586 | Ga0070675_1001195864 | 217 |
| 12 | 3300005366 | Ga0070659_100028453 | Ga0070659_1000284535 | 217 |
| 13 | 3300005435 | Ga0070714_100075823 | Ga0070714_1000758235 | 217 |
| 14 | 3300005437 | Ga0070710_10707324 | Ga0070710_107073241 | 217 |
| 15 | 3300005439 | Ga0070711_100807947 | Ga0070711_1008079471 | 217 |
| 16 | 3300005440 | Ga0070705_100159070 | Ga0070705_1001590702 | 217 |
| 17 | 3300005445 | Ga0070708_100054126 | Ga0070708_1000541262 | 217 |
| 18 | 3300005445 | Ga0070708_100145493 | Ga0070708_1001454931 | 217 |
| 19 | 3300005445 | Ga0070708_100258779 | Ga0070708_1002587793 | 217 |
| 20 | 3300005457 | Ga0070662_100878551 | Ga0070662_1008785511 | 217 |
| 21 | 3300005467 | Ga0070706_100654367 | Ga0070706_1006543672 | 217 |
| 22 | 3300005468 | Ga0070707_100119938 | Ga0070707_1001199383 | 217 |
| 23 | 3300005468 | Ga0070707_100201550 | Ga0070707_1002015502 | 217 |
| 24 | 3300005471 | Ga0070698_100024495 | Ga0070698_1000244954 | 217 |
| 25 | 3300005548 | Ga0070665_100667791 | Ga0070665_1006677912 | 217 |
| 26 | 3300005937 | Ga0081455_10001507 | Ga0081455_1000150714 | 217 |
| 27 | 3300005937 | Ga0081455_10007190 | Ga0081455_1000719011 | 217 |
| 28 | 3300005937 | Ga0081455_10024323 | Ga0081455_100243232 | 217 |
| 29 | 3300005983 | Ga0081540_1000152 | Ga0081540_100015238 | 217 |
| 30 | 3300006028 | Ga0070717_10035314 | Ga0070717_100353141 | 217 |
| 31 | 3300006028 | Ga0070717_10045380 | Ga0070717_100453803 | 217 |
| 32 | 3300006163 | Ga0070715_10061428 | Ga0070715_100614283 | 217 |
| 33 | 3300006173 | Ga0070716_100145871 | Ga0070716_1001458713 | 217 |
| 34 | 3300006175 | Ga0070712_100365938 | Ga0070712_1003659381 | 217 |
| 35 | 3300006844 | Ga0075428_100477857 | Ga0075428_1004778572 | 217 |
| 36 | 3300006844 | Ga0075428_100518425 | Ga0075428_1005184252 | 217 |
| 37 | 3300009147 | Ga0114129_10018659 | Ga0114129_1001865911 | 217 |
| 38 | 3300009148 | Ga0105243_10695627 | Ga0105243_106956272 | 217 |
| 39 | 3300009177 | Ga0105248_10313800 | Ga0105248_103138002 | 217 |
| 40 | 3300009553 | Ga0105249_10495464 | Ga0105249_104954642 | 217 |
| 41 | 3300010159 | Ga0099796_10094795 | Ga0099796_100947952 | 217 |
| 42 | 3300011119 | Ga0105246_10114073 | Ga0105246_101140731 | 217 |
| 43 | 3300013306 | Ga0163162_10111574 | Ga0163162_101115742 | 217 |
| 44 | 3300013308 | Ga0157375_10033550 | Ga0157375_100335505 | 217 |
| 45 | 3300013308 | Ga0157375_11168115 | Ga0157375_111681151 | 217 |
| 46 | 3300025905 | Ga0207685_10052755 | Ga0207685_100527551 | 217 |
| 47 | 3300025910 | Ga0207684_10533971 | Ga0207684_105339711 | 217 |
| 48 | 3300025912 | Ga0207707_10073689 | Ga0207707_100736892 | 217 |
| 49 | 3300025915 | Ga0207693_10045550 | Ga0207693_100455503 | 217 |
| 50 | 3300025915 | Ga0207693_10336701 | Ga0207693_103367012 | 217 |
| 51 | 3300025916 | Ga0207663_10336457 | Ga0207663_103364571 | 217 |
| 52 | 3300025922 | Ga0207646_10102008 | Ga0207646_101020085 | 217 |
| 53 | 3300025922 | Ga0207646_10171499 | Ga0207646_101714991 | 217 |
| 54 | 3300025922 | Ga0207646_10729266 | Ga0207646_107292662 | 217 |
| 55 | 3300025926 | Ga0207659_10140670 | Ga0207659_101406703 | 217 |
| 56 | 3300025928 | Ga0207700_10188346 | Ga0207700_101883462 | 217 |
| 57 | 3300025931 | Ga0207644_10249456 | Ga0207644_102494562 | 217 |
| 58 | 3300025933 | Ga0207706_10431101 | Ga0207706_104311012 | 217 |
| 59 | 3300025939 | Ga0207665_10051968 | Ga0207665_100519683 | 217 |
| 60 | 3300025939 | Ga0207665_10125268 | Ga0207665_101252682 | 217 |
| 61 | 3300025972 | Ga0207668_10212350 | Ga0207668_102123502 | 217 |
| 62 | 3300026078 | Ga0207702_11202481 | Ga0207702_112024811 | 217 |
| 63 | 3300026088 | Ga0207641_10780664 | Ga0207641_107806641 | 217 |
| 64 | 3300028379 | Ga0268266_10115513 | Ga0268266_101155136 | 217 |
| 65 | 3300035116 | Ga0373945_0025789 | Ga0373945_0025789_232_885 | 217 |
| 66 | 3300035692 | Ga0373935_0018633 | Ga0373935_0018633_2201_2854 | 217 |
| 67 | 3300035692 | Ga0373935_0056420 | Ga0373935_0056420_203_856 | 217 |
| 68 | 3300035724 | Ga0373933_0418026 | Ga0373933_0418026_159_812 | 217 |
| 69 | 3300035725 | Ga0373947_0479461 | Ga0373947_0479461_117_770 | 217 |
| 70 | 3300036401 | Ga0373937_0157799 | Ga0373937_0157799_451_1104 | 217 |
| 71 | 3300037466 | Ga0395898_0230674 | Ga0395898_0230674_552_1205 | 217 |
| 72 | 3300038443 | Ga0395901_0247923 | Ga0395901_0247923_1071_1724 | 217 |
| 73 | 3300042012 | Ga0439455_0029689 | Ga0439455_0029689_20_673 | 217 |
| 74 | 3300046454 | Ga0495592_0039482 | Ga0495592_0039482_2837_3490 | 217 |
| 75 | 3300046461 | Ga0495641_0222574 | Ga0495641_0222574_81_734 | 217 |
| 76 | 3300046473 | Ga0495582_0378425 | Ga0495582_0378425_151_804 | 217 |
| 77 | 3300046476 | Ga0495662_0041669 | Ga0495662_0041669_79_732 | 217 |
| 78 | 3300046517 | Ga0495630_0081404 | Ga0495630_0081404_1670_2323 | 217 |
| 79 | 3300046683 | Ga0495658_0170490 | Ga0495658_0170490_396_1049 | 217 |
| 80 | 3300047317 | Ga0495604_0137925 | Ga0495604_0137925_25_678 | 217 |
| 81 | 3300047319 | Ga0495674_0443422 | Ga0495674_0443422_211_864 | 217 |
| 82 | 3300047471 | Ga0495684_0034514 | Ga0495684_0034514_2066_2719 | 217 |
| 83 | 3300047471 | Ga0495684_0122098 | Ga0495684_0122098_1088_1741 | 217 |
| 84 | 3300048903 | Ga0496100_0081937 | Ga0496100_0081937_703_1356 | 217 |
| 85 | 3300048904 | Ga0496101_0135575 | Ga0496101_0135575_692_1345 | 217 |
| 86 | 3300048905 | Ga0496102_0377330 | Ga0496102_0377330_37_690 | 217 |
| 87 | 3300048907 | Ga0496104_0304411 | Ga0496104_0304411_521_1174 | 217 |
| 88 | 3300048910 | Ga0496107_0267277 | Ga0496107_0267277_313_966 | 217 |
| 89 | 3300048915 | Ga0496112_0818147 | Ga0496112_0818147_29_682 | 217 |
| 90 | 3300048917 | Ga0496114_0153806 | Ga0496114_0153806_677_1330 | 217 |
| 91 | 3300048918 | Ga0496115_0006654 | Ga0496115_0006654_1081_1734 | 217 |
| 92 | 3300050512 | nmdc:mga0n895_448222_c1 | nmdc:mga0n895_448222_c1_238_891 | 217 |
| 93 | 3300050515 | nmdc:mga0a205_773635_c1 | nmdc:mga0a205_773635_c1_32_685 | 217 |
| 94 | 3300053085 | Ga0495619_0274694 | Ga0495619_0274694_327_980 | 217 |
| 95 | 3300007076 | Ga0075435_100041003 | Ga0075435_1000410032 | 219 |
| 96 | 3300050513 | nmdc:mga0rr50_123598_c1 | nmdc:mga0rr50_123598_c1_727_1386 | 219 |
| 97 | 3300005435 | Ga0070714_100261103 | Ga0070714_1002611032 | 220 |
| 98 | 3300013296 | Ga0157374_10205850 | Ga0157374_102058502 | 220 |
| 99 | 3300013297 | Ga0157378_10605950 | Ga0157378_106059502 | 220 |
| 100 | 3300025929 | Ga0207664_10223646 | Ga0207664_102236462 | 220 |
| 101 | 3300005289 | Ga0065704_10005395 | Ga0065704_100053952 | 221 |
| 102 | 3300005335 | Ga0070666_10020404 | Ga0070666_100204042 | 221 |
| 103 | 3300005338 | Ga0068868_100126510 | Ga0068868_1001265102 | 221 |
| 104 | 3300005347 | Ga0070668_100002154 | Ga0070668_1000021545 | 221 |
| 105 | 3300005353 | Ga0070669_100023146 | Ga0070669_1000231464 | 221 |
| 106 | 3300005354 | Ga0070675_100025909 | Ga0070675_1000259091 | 221 |
| 107 | 3300005354 | Ga0070675_100300368 | Ga0070675_1003003682 | 221 |
| 108 | 3300005355 | Ga0070671_100573976 | Ga0070671_1005739762 | 221 |
| 109 | 3300005355 | Ga0070671_100602409 | Ga0070671_1006024091 | 221 |
| 110 | 3300005367 | Ga0070667_100080482 | Ga0070667_1000804822 | 221 |
| 111 | 3300005434 | Ga0070709_10189868 | Ga0070709_101898682 | 221 |
| 112 | 3300005436 | Ga0070713_100521001 | Ga0070713_1005210012 | 221 |
| 113 | 3300005437 | Ga0070710_10202451 | Ga0070710_102024512 | 221 |
| 114 | 3300005437 | Ga0070710_10232057 | Ga0070710_102320572 | 221 |
| 115 | 3300005439 | Ga0070711_100039014 | Ga0070711_1000390142 | 221 |
| 116 | 3300005439 | Ga0070711_100474274 | Ga0070711_1004742742 | 221 |
| 117 | 3300005440 | Ga0070705_100058990 | Ga0070705_1000589902 | 221 |
| 118 | 3300005445 | Ga0070708_100464446 | Ga0070708_1004644461 | 221 |
| 119 | 3300005445 | Ga0070708_100481128 | Ga0070708_1004811281 | 221 |
| 120 | 3300005456 | Ga0070678_100180008 | Ga0070678_1001800081 | 221 |
| 121 | 3300005456 | Ga0070678_100366028 | Ga0070678_1003660282 | 221 |
| 122 | 3300005457 | Ga0070662_100037379 | Ga0070662_1000373792 | 221 |
| 123 | 3300005457 | Ga0070662_100049658 | Ga0070662_1000496582 | 221 |
| 124 | 3300005459 | Ga0068867_100287827 | Ga0068867_1002878271 | 221 |
| 125 | 3300005468 | Ga0070707_100007723 | Ga0070707_1000077235 | 221 |
| 126 | 3300005518 | Ga0070699_100027265 | Ga0070699_1000272656 | 221 |
| 127 | 3300005536 | Ga0070697_100006829 | Ga0070697_1000068298 | 221 |
| 128 | 3300005536 | Ga0070697_100013899 | Ga0070697_1000138995 | 221 |
| 129 | 3300005543 | Ga0070672_100063463 | Ga0070672_1000634632 | 221 |
| 130 | 3300005545 | Ga0070695_100005934 | Ga0070695_1000059343 | 221 |
| 131 | 3300005546 | Ga0070696_100016487 | Ga0070696_1000164872 | 221 |
| 132 | 3300005548 | Ga0070665_100160996 | Ga0070665_1001609962 | 221 |
| 133 | 3300005615 | Ga0070702_100028062 | Ga0070702_1000280622 | 221 |
| 134 | 3300005843 | Ga0068860_100448482 | Ga0068860_1004484822 | 221 |
| 135 | 3300005844 | Ga0068862_100333481 | Ga0068862_1003334812 | 221 |
| 136 | 3300006028 | Ga0070717_10441130 | Ga0070717_104411302 | 221 |
| 137 | 3300006173 | Ga0070716_100040252 | Ga0070716_1000402522 | 221 |
| 138 | 3300006175 | Ga0070712_100004993 | Ga0070712_1000049932 | 221 |
| 139 | 3300006175 | Ga0070712_100058649 | Ga0070712_1000586492 | 221 |
| 140 | 3300006175 | Ga0070712_100783153 | Ga0070712_1007831531 | 221 |
| 141 | 3300006852 | Ga0075433_10435729 | Ga0075433_104357292 | 221 |
| 142 | 3300006871 | Ga0075434_100106636 | Ga0075434_1001066362 | 221 |
| 143 | 3300006871 | Ga0075434_100645668 | Ga0075434_1006456682 | 221 |
| 144 | 3300006881 | Ga0068865_100125961 | Ga0068865_1001259612 | 221 |
| 145 | 3300007788 | Ga0099795_10150233 | Ga0099795_101502331 | 221 |
| 146 | 3300009098 | Ga0105245_10040765 | Ga0105245_100407652 | 221 |
| 147 | 3300009176 | Ga0105242_10023913 | Ga0105242_100239134 | 221 |
| 148 | 3300011119 | Ga0105246_10322082 | Ga0105246_103220822 | 221 |
| 149 | 3300013105 | Ga0157369_11203929 | Ga0157369_112039291 | 221 |
| 150 | 3300013297 | Ga0157378_10103048 | Ga0157378_101030482 | 221 |
| 151 | 3300013297 | Ga0157378_10155658 | Ga0157378_101556582 | 221 |
| 152 | 3300013306 | Ga0163162_10032650 | Ga0163162_100326504 | 221 |
| 153 | 3300013307 | Ga0157372_10124908 | Ga0157372_101249082 | 221 |
| 154 | 3300013307 | Ga0157372_11449890 | Ga0157372_114498901 | 221 |
| 155 | 3300014325 | Ga0163163_10761670 | Ga0163163_107616702 | 221 |
| 156 | 3300014969 | Ga0157376_10067053 | Ga0157376_100670532 | 221 |
| 157 | 3300017792 | Ga0163161_10002469 | Ga0163161_100024697 | 221 |
| 158 | 3300025290 | Ga0207673_1001473 | Ga0207673_10014732 | 221 |
| 159 | 3300025315 | Ga0207697_10000025 | Ga0207697_1000002513 | 221 |
| 160 | 3300025898 | Ga0207692_10247834 | Ga0207692_102478342 | 221 |
| 161 | 3300025901 | Ga0207688_10001029 | Ga0207688_1000102914 | 221 |
| 162 | 3300025903 | Ga0207680_10197016 | Ga0207680_101970162 | 221 |
| 163 | 3300025906 | Ga0207699_10025578 | Ga0207699_100255782 | 221 |
| 164 | 3300025907 | Ga0207645_10003969 | Ga0207645_100039694 | 221 |
| 165 | 3300025907 | Ga0207645_10043378 | Ga0207645_100433782 | 221 |
| 166 | 3300025910 | Ga0207684_10004944 | Ga0207684_100049448 | 221 |
| 167 | 3300025910 | Ga0207684_10053578 | Ga0207684_100535783 | 221 |
| 168 | 3300025910 | Ga0207684_10185805 | Ga0207684_101858052 | 221 |
| 169 | 3300025915 | Ga0207693_10001965 | Ga0207693_100019657 | 221 |
| 170 | 3300025915 | Ga0207693_10016370 | Ga0207693_100163701 | 221 |
| 171 | 3300025916 | Ga0207663_10032531 | Ga0207663_100325312 | 221 |
| 172 | 3300025916 | Ga0207663_10501097 | Ga0207663_105010972 | 221 |
| 173 | 3300025922 | Ga0207646_10103010 | Ga0207646_101030102 | 221 |
| 174 | 3300025922 | Ga0207646_10365220 | Ga0207646_103652202 | 221 |
| 175 | 3300025928 | Ga0207700_10894469 | Ga0207700_108944692 | 221 |
| 176 | 3300025931 | Ga0207644_10059804 | Ga0207644_100598042 | 221 |
| 177 | 3300025933 | Ga0207706_10015402 | Ga0207706_100154022 | 221 |
| 178 | 3300025933 | Ga0207706_10019313 | Ga0207706_100193131 | 221 |
| 179 | 3300025934 | Ga0207686_10465125 | Ga0207686_104651252 | 221 |
| 180 | 3300025938 | Ga0207704_10107677 | Ga0207704_101076772 | 221 |
| 181 | 3300025939 | Ga0207665_10006639 | Ga0207665_100066391 | 221 |
| 182 | 3300025939 | Ga0207665_10023675 | Ga0207665_100236753 | 221 |
| 183 | 3300025940 | Ga0207691_10000864 | Ga0207691_1000086423 | 221 |
| 184 | 3300025960 | Ga0207651_10086148 | Ga0207651_100861482 | 221 |
| 185 | 3300025961 | Ga0207712_10725124 | Ga0207712_107251242 | 221 |
| 186 | 3300025972 | Ga0207668_10066841 | Ga0207668_100668412 | 221 |
| 187 | 3300025972 | Ga0207668_10114723 | Ga0207668_101147232 | 221 |
| 188 | 3300025981 | Ga0207640_10198402 | Ga0207640_101984022 | 221 |
| 189 | 3300026078 | Ga0207702_11185324 | Ga0207702_111853241 | 221 |
| 190 | 3300026121 | Ga0207683_10036694 | Ga0207683_100366944 | 221 |
| 191 | 3300028379 | Ga0268266_10453013 | Ga0268266_104530132 | 221 |
| 192 | 3300028381 | Ga0268264_10313295 | Ga0268264_103132952 | 221 |
| 193 | 3300035083 | Ga0373926_0046618 | Ga0373926_0046618_828_1493 | 221 |
| 194 | 3300035089 | Ga0373944_0033763 | Ga0373944_0033763_852_1517 | 221 |
| 195 | 3300035171 | Ga0373946_0031008 | Ga0373946_0031008_589_1254 | 221 |
| 196 | 3300035692 | Ga0373935_0249725 | Ga0373935_0249725_494_1159 | 221 |
| 197 | 3300035695 | Ga0373927_0175985 | Ga0373927_0175985_147_812 | 221 |
| 198 | 3300035725 | Ga0373947_0138457 | Ga0373947_0138457_426_1091 | 221 |
| 199 | 3300037068 | Ga0373925_0035220 | Ga0373925_0035220_2513_3178 | 221 |
| 200 | 3300037068 | Ga0373925_0154684 | Ga0373925_0154684_602_1267 | 221 |
| 201 | 3300037418 | Ga0395900_0383289 | Ga0395900_0383289_683_1351 | 221 |
| 202 | 3300037466 | Ga0395898_0010142 | Ga0395898_0010142_5661_6329 | 221 |
| 203 | 3300038443 | Ga0395901_0026924 | Ga0395901_0026924_5161_5829 | 221 |
| 204 | 3300048904 | Ga0496101_0002744 | Ga0496101_0002744_8007_8672 | 221 |
| 205 | 3300048905 | Ga0496102_0066764 | Ga0496102_0066764_2550_3215 | 221 |
| 206 | 3300048907 | Ga0496104_0216232 | Ga0496104_0216232_762_1427 | 221 |
| 207 | 3300048908 | Ga0496105_0203233 | Ga0496105_0203233_602_1267 | 221 |
| 208 | 3300048909 | Ga0496106_0005308 | Ga0496106_0005308_8447_9112 | 221 |
| 209 | 3300048910 | Ga0496107_0040088 | Ga0496107_0040088_1813_2478 | 221 |
| 210 | 3300048912 | Ga0496109_0935962 | Ga0496109_0935962_112_777 | 221 |
| 211 | 3300048913 | Ga0496110_0078467 | Ga0496110_0078467_2169_2834 | 221 |
| 212 | 3300048915 | Ga0496112_0030748 | Ga0496112_0030748_2330_2995 | 221 |
| 213 | 3300048916 | Ga0496113_0106517 | Ga0496113_0106517_971_1636 | 221 |
| 214 | 3300048918 | Ga0496115_0005041 | Ga0496115_0005041_5593_6258 | 221 |
| 215 | 3300050512 | nmdc:mga0n895_797244_c1 | nmdc:mga0n895_797244_c1_37_702 | 221 |
| 216 | 3300050515 | nmdc:mga0a205_382884_c1 | nmdc:mga0a205_382884_c1_184_852 | 221 |
| 217 | 3300005328 | Ga0070676_10006154 | Ga0070676_100061545 | 223 |
| 218 | 3300005334 | Ga0068869_100109566 | Ga0068869_1001095664 | 223 |
| 219 | 3300005338 | Ga0068868_100006255 | Ga0068868_1000062552 | 223 |
| 220 | 3300005339 | Ga0070660_100017141 | Ga0070660_1000171412 | 223 |
| 221 | 3300005340 | Ga0070689_100007138 | Ga0070689_1000071385 | 223 |
| 222 | 3300005343 | Ga0070687_100000887 | Ga0070687_1000008874 | 223 |
| 223 | 3300005347 | Ga0070668_100005686 | Ga0070668_1000056867 | 223 |
| 224 | 3300005353 | Ga0070669_100004516 | Ga0070669_1000045168 | 223 |
| 225 | 3300005354 | Ga0070675_100001260 | Ga0070675_1000012606 | 223 |
| 226 | 3300005366 | Ga0070659_100017913 | Ga0070659_1000179134 | 223 |
| 227 | 3300005367 | Ga0070667_100003659 | Ga0070667_1000036594 | 223 |
| 228 | 3300005457 | Ga0070662_100000581 | Ga0070662_10000058111 | 223 |
| 229 | 3300005543 | Ga0070672_100016236 | Ga0070672_1000162361 | 223 |
| 230 | 3300005843 | Ga0068860_100005184 | Ga0068860_1000051844 | 223 |
| 231 | 3300005844 | Ga0068862_100003505 | Ga0068862_1000035055 | 223 |
| 232 | 3300009098 | Ga0105245_10113951 | Ga0105245_101139512 | 223 |
| 233 | 3300009553 | Ga0105249_10012996 | Ga0105249_100129965 | 223 |
| 234 | 3300010375 | Ga0105239_10024855 | Ga0105239_100248551 | 223 |
| 235 | 3300013296 | Ga0157374_10005391 | Ga0157374_100053916 | 223 |
| 236 | 3300013297 | Ga0157378_10027624 | Ga0157378_100276242 | 223 |
| 237 | 3300013306 | Ga0163162_10004489 | Ga0163162_100044899 | 223 |
| 238 | 3300013307 | Ga0157372_10324829 | Ga0157372_103248292 | 223 |
| 239 | 3300014968 | Ga0157379_10035196 | Ga0157379_100351965 | 223 |
| 240 | 3300017792 | Ga0163161_10106221 | Ga0163161_101062212 | 223 |
| 241 | 3300025271 | Ga0207666_1005580 | Ga0207666_10055801 | 223 |
| 242 | 3300025315 | Ga0207697_10000160 | Ga0207697_1000016013 | 223 |
| 243 | 3300025907 | Ga0207645_10001376 | Ga0207645_1000137613 | 223 |
| 244 | 3300025918 | Ga0207662_10000736 | Ga0207662_1000073613 | 223 |
| 245 | 3300025919 | Ga0207657_10059111 | Ga0207657_100591112 | 223 |
| 246 | 3300025923 | Ga0207681_10003035 | Ga0207681_100030355 | 223 |
| 247 | 3300025926 | Ga0207659_10022932 | Ga0207659_100229323 | 223 |
| 248 | 3300025932 | Ga0207690_10009811 | Ga0207690_100098113 | 223 |
| 249 | 3300025933 | Ga0207706_10000443 | Ga0207706_1000044312 | 223 |
| 250 | 3300025942 | Ga0207689_10124661 | Ga0207689_101246613 | 223 |
| 251 | 3300025961 | Ga0207712_10025223 | Ga0207712_100252233 | 223 |
| 252 | 3300025972 | Ga0207668_10002178 | Ga0207668_100021785 | 223 |
| 253 | 3300026023 | Ga0207677_10197625 | Ga0207677_101976251 | 223 |
| 254 | 3300028380 | Ga0268265_10167826 | Ga0268265_101678262 | 223 |
| 255 | 3300028381 | Ga0268264_10009371 | Ga0268264_100093715 | 223 |
| 256 | 3300045051 | Ga0451576_0027516 | Ga0451576_0027516_2258_2965 | 223 |
| 257 | 3300005338 | Ga0068868_100575669 | Ga0068868_1005756691 | 225 |
| 258 | 3300006028 | Ga0070717_10000658 | Ga0070717_1000065811 | 227 |
| 259 | 3300025922 | Ga0207646_10054326 | Ga0207646_100543262 | 227 |
| 260 | 3300005467 | Ga0070706_100013043 | Ga0070706_1000130436 | 236 |
| 261 | 3300005468 | Ga0070707_100048148 | Ga0070707_1000481488 | 236 |
| 262 | 3300005518 | Ga0070699_100206318 | Ga0070699_1002063182 | 236 |
| 263 | 3300005536 | Ga0070697_100150043 | Ga0070697_1001500432 | 236 |
| 264 | 3300025910 | Ga0207684_10003154 | Ga0207684_100031545 | 236 |
| 265 | 3300025922 | Ga0207646_10174792 | Ga0207646_101747923 | 236 |
| 266 | 3300005467 | Ga0070706_100000339 | Ga0070706_10000033919 | 238 |
| 267 | 3300025910 | Ga0207684_10000276 | Ga0207684_1000027641 | 238 |
| 268 | 3300005546 | Ga0070696_100150780 | Ga0070696_1001507802 | 239 |
| 269 | 3300005536 | Ga0070697_100117411 | Ga0070697_1001174111 | 240 |
| 270 | 3300005468 | Ga0070707_100045815 | Ga0070707_1000458152 | 241 |
| 271 | 3300025922 | Ga0207646_10082005 | Ga0207646_100820054 | 248 |
| 272 | 3300000545 | CNXas_1000017 | CNXas_10000173 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8v1k-assembly2.cif.gz_B | crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella tularensis | 0.8611 | 57 | 245 |
| 8orn-assembly2.cif.gz_C | crystal structure of xanthomonas campestris pv. campestris lola-lolb complex | 0.8445 | 61 | 245 |
| 4ki3-assembly3.cif.gz_I | 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 | 0.8411 | 60 | 245 |
| 2w7q-assembly1.cif.gz_A | structure of pseudomonas aeruginosa lola | 0.84 | 57 | 245 |
| 4ki3-assembly1.cif.gz_D | 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 | 0.839 | 60 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39310_121_209_3.10.450.350 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8932 | 192 | 219 | 3.10.450.350 |
| 4ki3G00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.837 | 60 | 245 | 2.50.20.10 |
| 2w7qB00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.8237 | 60 | 245 | 2.50.20.10 |
| 4ki3G00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.8159 | 60 | 245 | 2.50.20.10 |
| 2w7qB00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.8034 | 60 | 245 | 2.50.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5NYB0-F1-model_v4 | Outer membrane lipoprotein carrier protein LolA | 0.9686 | 46 | 249 |
|
| AF-A0A4Q3BUS5-F1-model_v4 | deleted | 0.9117 | 46 | 249 |
|
| AF-A0A1F0UCE0-F1-model_v4 | Cell envelope biogenesis protein LolA | 0.9085 | 47 | 235 |
|
| AF-D3IJ49-F1-model_v4 | Outer membrane lipoprotein carrier protein LolA | 0.9084 | 47 | 235 |
|
| AF-A0A2V6FGV7-F1-model_v4 | Outer membrane lipoprotein carrier protein LolA | 0.9035 | 72 | 249 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar