F378215

General Info

Members Datasets Scaffolds Average Seq Length
272 152 272 223

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100006829|Ga0070697_1000068298
Length 225
Sequence MHNLFFTALVFVGATSVASAQQPLSPADVKSLLARIRDKRAAAPYMQANFQEERAVHLMNKPIVSSGKVWFRAPDKFRREVRGSSPSVTVSDGEQLWIYYPNFKSAEHYSLGKRSPVNAGIAAVTAALNLENVEATYHITASRIDSPQAGYELELLPRTPSLKRMFQKFNLRMNDELFVTRTEMLQPNGDGIITTYSNYSNAPIPESTFMFTPPPGTEVTTPLGR

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.99
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000017 3300000545 Bacteria 35464
2 JGI25404J52841_10003628 3300003659 Unclassified 3065
3 Ga0065704_10005395 3300005289 Bacteria 5808
4 Ga0065715_10182724 3300005293 Bacteria 1465
5 Ga0065707_10010208 3300005295 Bacteria 3509
6 Ga0070676_10006154 3300005328 Bacteria 6409
7 Ga0068869_100109566 3300005334 Bacteria 2099
8 Ga0070666_10020404 3300005335 Bacteria 4283
9 Ga0068868_100006255 3300005338 Bacteria 8421
10 Ga0068868_100126510 3300005338 Unclassified 2088
11 Ga0068868_100575669 3300005338 Unclassified 995
12 Ga0070660_100017141 3300005339 Bacteria 5274
13 Ga0070689_100007138 3300005340 Bacteria 7788
14 Ga0070689_100035850 3300005340 Bacteria 3791
15 Ga0070687_100000887 3300005343 Bacteria 10074
16 Ga0070668_100002154 3300005347 Bacteria 14422
17 Ga0070668_100005686 3300005347 Bacteria 9243
18 Ga0070669_100004516 3300005353 Bacteria 10040
19 Ga0070669_100023146 3300005353 Bacteria 4447
20 Ga0070675_100001260 3300005354 Bacteria 18513
21 Ga0070675_100025909 3300005354 Bacteria 4703
22 Ga0070675_100119586 3300005354 Unclassified 2237
23 Ga0070675_100300368 3300005354 Unclassified 1414
24 Ga0070671_100573976 3300005355 Unclassified 974
25 Ga0070671_100602409 3300005355 Unclassified 949
26 Ga0070659_100017913 3300005366 Bacteria 5336
27 Ga0070659_100028453 3300005366 Bacteria 4316
28 Ga0070667_100003659 3300005367 Bacteria 13085
29 Ga0070667_100080482 3300005367 Bacteria 2786
30 Ga0070709_10018983 3300005434 Bacteria 3968
31 Ga0070709_10189868 3300005434 Bacteria 1448
32 Ga0070714_100075823 3300005435 Bacteria 2918
33 Ga0070714_100261103 3300005435 Bacteria 1604
34 Ga0070713_100521001 3300005436 Unclassified 1123
35 Ga0070710_10202451 3300005437 Bacteria 1254
36 Ga0070710_10232057 3300005437 Unclassified 1179
37 Ga0070710_10707324 3300005437 Unclassified 712
38 Ga0070711_100039014 3300005439 Bacteria 3196
39 Ga0070711_100474274 3300005439 Unclassified 1027
40 Ga0070711_100807947 3300005439 Unclassified 796
41 Ga0070705_100058990 3300005440 Bacteria 2270
42 Ga0070705_100159070 3300005440 Unclassified 1508
43 Ga0070708_100037791 3300005445 Bacteria 4215
44 Ga0070708_100054126 3300005445 Bacteria 3563
45 Ga0070708_100145493 3300005445 Unclassified 2201
46 Ga0070708_100258779 3300005445 Bacteria 1636
47 Ga0070708_100464446 3300005445 Bacteria 1194
48 Ga0070708_100481128 3300005445 Bacteria 1171
49 Ga0070678_100180008 3300005456 Bacteria 1729
50 Ga0070678_100366028 3300005456 Bacteria 1244
51 Ga0070662_100000581 3300005457 Bacteria 22251
52 Ga0070662_100037379 3300005457 Bacteria 3442
53 Ga0070662_100049658 3300005457 Bacteria 3026
54 Ga0070662_100878551 3300005457 Unclassified 764
55 Ga0068867_100287827 3300005459 Unclassified 1350
56 Ga0070706_100000339 3300005467 Bacteria 56563
57 Ga0070706_100013043 3300005467 Bacteria 7691
58 Ga0070706_100654367 3300005467 Unclassified 975
59 Ga0070707_100007723 3300005468 Bacteria 9991
60 Ga0070707_100045815 3300005468 Bacteria 4185
61 Ga0070707_100048148 3300005468 Unclassified 4083
62 Ga0070707_100119938 3300005468 Bacteria 2553
63 Ga0070707_100201550 3300005468 Bacteria 1940
64 Ga0070698_100024495 3300005471 Bacteria 6297
65 Ga0070699_100027265 3300005518 Bacteria 4929
66 Ga0070699_100206318 3300005518 Bacteria 1749
67 Ga0070697_100006829 3300005536 Bacteria 8858
68 Ga0070697_100013899 3300005536 Bacteria 6318
69 Ga0070697_100117411 3300005536 Viruses 2222
70 Ga0070697_100150043 3300005536 Bacteria 1964
71 Ga0070672_100016236 3300005543 Bacteria 5326
72 Ga0070672_100063463 3300005543 Bacteria 2917
73 Ga0070695_100005934 3300005545 Bacteria 7211
74 Ga0070696_100016487 3300005546 Bacteria 4977
75 Ga0070696_100150780 3300005546 Bacteria 1706
76 Ga0070665_100160996 3300005548 Unclassified 2247
77 Ga0070665_100667791 3300005548 Bacteria 1052
78 Ga0070702_100028062 3300005615 Bacteria 3046
79 Ga0068860_100005184 3300005843 Bacteria 13250
80 Ga0068860_100448482 3300005843 Unclassified 1283
81 Ga0068862_100003505 3300005844 Bacteria 13475
82 Ga0068862_100333481 3300005844 Bacteria 1403
83 Ga0081455_10001507 3300005937 Bacteria 28752
84 Ga0081455_10007190 3300005937 Bacteria 11762
85 Ga0081455_10024323 3300005937 Bacteria 5610
86 Ga0081540_1000152 3300005983 Bacteria 70858
87 Ga0081539_10065068 3300005985 Bacteria 1981
88 Ga0070717_10000658 3300006028 Bacteria 22180
89 Ga0070717_10035314 3300006028 Bacteria 4046
90 Ga0070717_10045380 3300006028 Bacteria 3593
91 Ga0070717_10441130 3300006028 Unclassified 1172
92 Ga0070715_10061428 3300006163 Bacteria 1650
93 Ga0070716_100040252 3300006173 Unclassified 2599
94 Ga0070716_100145871 3300006173 Bacteria 1516
95 Ga0070712_100004993 3300006175 Bacteria 8210
96 Ga0070712_100058649 3300006175 Bacteria 2708
97 Ga0070712_100365938 3300006175 Bacteria 1184
98 Ga0070712_100783153 3300006175 Unclassified 817
99 Ga0075428_100477857 3300006844 Bacteria 1334
100 Ga0075428_100518425 3300006844 Bacteria 1275
101 Ga0075433_10435729 3300006852 Unclassified 1156
102 Ga0075434_100106636 3300006871 Bacteria 2812
103 Ga0075434_100645668 3300006871 Unclassified 1077
104 Ga0068865_100125961 3300006881 Unclassified 1912
105 Ga0075435_100041003 3300007076 Bacteria 3699
106 Ga0099795_10150233 3300007788 Bacteria 953
107 Ga0105245_10040765 3300009098 Unclassified 4138
108 Ga0105245_10113951 3300009098 Bacteria 2518
109 Ga0114129_10018659 3300009147 Bacteria 9876
110 Ga0105243_10695627 3300009148 Unclassified 990
111 Ga0105242_10023913 3300009176 Bacteria 4821
112 Ga0105248_10313800 3300009177 Bacteria 1766
113 Ga0105249_10012996 3300009553 Bacteria 7347
114 Ga0105249_10495464 3300009553 Unclassified 1266
115 Ga0099796_10094795 3300010159 Bacteria 1114
116 Ga0105239_10024855 3300010375 Bacteria 6597
117 Ga0105246_10114073 3300011119 Bacteria 1990
118 Ga0105246_10322082 3300011119 Bacteria 1256
119 Ga0157369_11203929 3300013105 Unclassified 773
120 Ga0157374_10005391 3300013296 Bacteria 10747
121 Ga0157374_10205850 3300013296 Bacteria 1928
122 Ga0157378_10027624 3300013297 Bacteria 5006
123 Ga0157378_10103048 3300013297 Bacteria 2607
124 Ga0157378_10155658 3300013297 Unclassified 2133
125 Ga0157378_10605950 3300013297 Unclassified 1107
126 Ga0163162_10004489 3300013306 Bacteria 13447
127 Ga0163162_10032650 3300013306 Bacteria 5171
128 Ga0163162_10111574 3300013306 Bacteria 2832
129 Ga0157372_10124908 3300013307 Bacteria 2958
130 Ga0157372_10324829 3300013307 Unclassified 1792
131 Ga0157372_11449890 3300013307 Unclassified 791
132 Ga0157375_10033550 3300013308 Bacteria 4878
133 Ga0157375_11168115 3300013308 Unclassified 902
134 Ga0163163_10761670 3300014325 Bacteria 1031
135 Ga0157379_10035196 3300014968 Bacteria 4465
136 Ga0157376_10067053 3300014969 Unclassified 3035
137 Ga0157376_10176324 3300014969 Bacteria 1950
138 Ga0163161_10002469 3300017792 Bacteria 13192
139 Ga0163161_10106221 3300017792 Bacteria 2095
140 Ga0207666_1005580 3300025271 Unclassified 1611
141 Ga0207673_1001473 3300025290 Unclassified 2574
142 Ga0207697_10000025 3300025315 Bacteria 52572
143 Ga0207697_10000160 3300025315 Bacteria 33765
144 Ga0207692_10247834 3300025898 Bacteria 1066
145 Ga0207688_10001029 3300025901 Bacteria 14267
146 Ga0207680_10197016 3300025903 Unclassified 1370
147 Ga0207685_10052755 3300025905 Unclassified 1576
148 Ga0207699_10025578 3300025906 Bacteria 3242
149 Ga0207645_10001376 3300025907 Bacteria 19947
150 Ga0207645_10003969 3300025907 Bacteria 11043
151 Ga0207645_10043378 3300025907 Bacteria 2878
152 Ga0207684_10000276 3300025910 Bacteria 75551
153 Ga0207684_10003154 3300025910 Bacteria 16212
154 Ga0207684_10004944 3300025910 Bacteria 12438
155 Ga0207684_10053578 3300025910 Unclassified 3424
156 Ga0207684_10185805 3300025910 Bacteria 1792
157 Ga0207684_10533971 3300025910 Bacteria 1004
158 Ga0207707_10073689 3300025912 Bacteria 2977
159 Ga0207693_10001965 3300025915 Bacteria 18024
160 Ga0207693_10016370 3300025915 Bacteria 5926
161 Ga0207693_10045550 3300025915 Bacteria 3447
162 Ga0207693_10336701 3300025915 Bacteria 1181
163 Ga0207663_10032531 3300025916 Bacteria 3097
164 Ga0207663_10336457 3300025916 Bacteria 1139
165 Ga0207663_10501097 3300025916 Unclassified 943
166 Ga0207662_10000736 3300025918 Bacteria 15013
167 Ga0207657_10059111 3300025919 Bacteria 3296
168 Ga0207646_10054326 3300025922 Bacteria 3583
169 Ga0207646_10082005 3300025922 Bacteria 2884
170 Ga0207646_10102008 3300025922 Bacteria 2572
171 Ga0207646_10103010 3300025922 Bacteria 2559
172 Ga0207646_10171499 3300025922 Bacteria 1959
173 Ga0207646_10174792 3300025922 Unclassified 1940
174 Ga0207646_10365220 3300025922 Unclassified 1304
175 Ga0207646_10683102 3300025922 Bacteria 919
176 Ga0207646_10729266 3300025922 Unclassified 885
177 Ga0207681_10003035 3300025923 Bacteria 10555
178 Ga0207659_10022932 3300025926 Bacteria 4163
179 Ga0207659_10140670 3300025926 Bacteria 1873
180 Ga0207700_10188346 3300025928 Bacteria 1732
181 Ga0207700_10894469 3300025928 Unclassified 794
182 Ga0207664_10223646 3300025929 Bacteria 1634
183 Ga0207644_10059804 3300025931 Bacteria 2756
184 Ga0207644_10249456 3300025931 Unclassified 1416
185 Ga0207690_10009811 3300025932 Bacteria 5690
186 Ga0207706_10000443 3300025933 Bacteria 44273
187 Ga0207706_10015402 3300025933 Bacteria 6908
188 Ga0207706_10019313 3300025933 Bacteria 6130
189 Ga0207706_10431101 3300025933 Unclassified 1142
190 Ga0207686_10465125 3300025934 Unclassified 975
191 Ga0207704_10107677 3300025938 Unclassified 1875
192 Ga0207665_10006639 3300025939 Bacteria 7677
193 Ga0207665_10023675 3300025939 Bacteria 4045
194 Ga0207665_10051968 3300025939 Bacteria 2760
195 Ga0207665_10125268 3300025939 Bacteria 1818
196 Ga0207691_10000864 3300025940 Bacteria 30113
197 Ga0207689_10124661 3300025942 Bacteria 2119
198 Ga0207651_10086148 3300025960 Bacteria 2282
199 Ga0207712_10025223 3300025961 Bacteria 3949
200 Ga0207712_10725124 3300025961 Unclassified 869
201 Ga0207668_10002178 3300025972 Bacteria 11423
202 Ga0207668_10066841 3300025972 Unclassified 2550
203 Ga0207668_10114723 3300025972 Bacteria 2028
204 Ga0207668_10212350 3300025972 Bacteria 1549
205 Ga0207640_10198402 3300025981 Bacteria 1519
206 Ga0207677_10197625 3300026023 Unclassified 1596
207 Ga0207702_11185324 3300026078 Unclassified 758
208 Ga0207702_11202481 3300026078 Bacteria 752
209 Ga0207641_10780664 3300026088 Bacteria 944
210 Ga0207683_10036694 3300026121 Bacteria 4269
211 Ga0268266_10115513 3300028379 Bacteria 2383
212 Ga0268266_10453013 3300028379 Unclassified 1220
213 Ga0268265_10167826 3300028380 Bacteria 1872
214 Ga0268264_10009371 3300028381 Bacteria 8103
215 Ga0268264_10313295 3300028381 Unclassified 1481
216 Ga0373926_0046618 3300035083 Bacteria 1556
217 Ga0373944_0033763 3300035089 Bacteria 1552
218 Ga0373945_0025789 3300035116 Bacteria 2045
219 Ga0373946_0031008 3300035171 Bacteria 2138
220 Ga0373935_0018633 3300035692 Bacteria 4227
221 Ga0373935_0056420 3300035692 Unclassified 2504
222 Ga0373935_0249725 3300035692 Bacteria 1241
223 Ga0373927_0124378 3300035695 Unclassified 1684
224 Ga0373927_0175985 3300035695 Bacteria 1403
225 Ga0373933_0418026 3300035724 Unclassified 876
226 Ga0373947_0138457 3300035725 Bacteria 1559
227 Ga0373947_0479461 3300035725 Unclassified 844
228 Ga0373937_0157799 3300036401 Unclassified 2127
229 Ga0373925_0035220 3300037068 Bacteria 3693
230 Ga0373925_0154684 3300037068 Bacteria 1803
231 Ga0395900_0383289 3300037418 Unclassified 1373
232 Ga0395898_0010142 3300037466 Bacteria 9861
233 Ga0395898_0230674 3300037466 Bacteria 1766
234 Ga0395901_0026924 3300038443 Bacteria 5904
235 Ga0395901_0247923 3300038443 Unclassified 1856
236 Ga0439455_0029689 3300042012 Bacteria 1353
237 Ga0451576_0027516 3300045051 Bacteria 6105
238 Ga0495592_0039482 3300046454 Bacteria 3545
239 Ga0495641_0222574 3300046461 Unclassified 847
240 Ga0495582_0378425 3300046473 Unclassified 816
241 Ga0495662_0041669 3300046476 Bacteria 2217
242 Ga0495630_0081404 3300046517 Unclassified 2443
243 Ga0495658_0170490 3300046683 Bacteria 1347
244 Ga0495604_0137925 3300047317 Bacteria 1746
245 Ga0495674_0443422 3300047319 Bacteria 1044
246 Ga0495684_0034514 3300047471 Bacteria 3881
247 Ga0495684_0122098 3300047471 Bacteria 1961
248 Ga0496100_0081937 3300048903 Unclassified 2181
249 Ga0496101_0002744 3300048904 Bacteria 10812
250 Ga0496101_0135575 3300048904 Unclassified 1873
251 Ga0496102_0066764 3300048905 Bacteria 3297
252 Ga0496102_0377330 3300048905 Unclassified 1334
253 Ga0496104_0216232 3300048907 Bacteria 1828
254 Ga0496104_0304411 3300048907 Unclassified 1506
255 Ga0496105_0203233 3300048908 Bacteria 1617
256 Ga0496106_0005308 3300048909 Bacteria 9545
257 Ga0496107_0040088 3300048910 Bacteria 3360
258 Ga0496107_0267277 3300048910 Unclassified 1273
259 Ga0496109_0935962 3300048912 Bacteria 804
260 Ga0496110_0078467 3300048913 Unclassified 2940
261 Ga0496112_0030748 3300048915 Bacteria 5201
262 Ga0496112_0818147 3300048915 Unclassified 856
263 Ga0496113_0106517 3300048916 Bacteria 2178
264 Ga0496114_0153806 3300048917 Unclassified 1996
265 Ga0496115_0005041 3300048918 Bacteria 9598
266 Ga0496115_0006654 3300048918 Bacteria 8482
267 nmdc:mga0n895_448222_c1 3300050512 Bacteria 1303
268 nmdc:mga0n895_797244_c1 3300050512 Unclassified 935
269 nmdc:mga0rr50_123598_c1 3300050513 Unclassified 2063
270 nmdc:mga0a205_382884_c1 3300050515 Bacteria 1272
271 nmdc:mga0a205_773635_c1 3300050515 Bacteria 808
272 Ga0495619_0274694 3300053085 Bacteria 1168

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10018983 Ga0070709_100189832 212
2 3300025922 Ga0207646_10683102 Ga0207646_106831021 213
3 3300035695 Ga0373927_0124378 Ga0373927_0124378_10_651 213
4 3300014969 Ga0157376_10176324 Ga0157376_101763242 214
5 3300005985 Ga0081539_10065068 Ga0081539_100650682 215
6 3300005445 Ga0070708_100037791 Ga0070708_1000377912 216
7 3300003659 JGI25404J52841_10003628 JGI25404J52841_100036283 217
8 3300005293 Ga0065715_10182724 Ga0065715_101827242 217
9 3300005295 Ga0065707_10010208 Ga0065707_100102081 217
10 3300005340 Ga0070689_100035850 Ga0070689_1000358505 217
11 3300005354 Ga0070675_100119586 Ga0070675_1001195864 217
12 3300005366 Ga0070659_100028453 Ga0070659_1000284535 217
13 3300005435 Ga0070714_100075823 Ga0070714_1000758235 217
14 3300005437 Ga0070710_10707324 Ga0070710_107073241 217
15 3300005439 Ga0070711_100807947 Ga0070711_1008079471 217
16 3300005440 Ga0070705_100159070 Ga0070705_1001590702 217
17 3300005445 Ga0070708_100054126 Ga0070708_1000541262 217
18 3300005445 Ga0070708_100145493 Ga0070708_1001454931 217
19 3300005445 Ga0070708_100258779 Ga0070708_1002587793 217
20 3300005457 Ga0070662_100878551 Ga0070662_1008785511 217
21 3300005467 Ga0070706_100654367 Ga0070706_1006543672 217
22 3300005468 Ga0070707_100119938 Ga0070707_1001199383 217
23 3300005468 Ga0070707_100201550 Ga0070707_1002015502 217
24 3300005471 Ga0070698_100024495 Ga0070698_1000244954 217
25 3300005548 Ga0070665_100667791 Ga0070665_1006677912 217
26 3300005937 Ga0081455_10001507 Ga0081455_1000150714 217
27 3300005937 Ga0081455_10007190 Ga0081455_1000719011 217
28 3300005937 Ga0081455_10024323 Ga0081455_100243232 217
29 3300005983 Ga0081540_1000152 Ga0081540_100015238 217
30 3300006028 Ga0070717_10035314 Ga0070717_100353141 217
31 3300006028 Ga0070717_10045380 Ga0070717_100453803 217
32 3300006163 Ga0070715_10061428 Ga0070715_100614283 217
33 3300006173 Ga0070716_100145871 Ga0070716_1001458713 217
34 3300006175 Ga0070712_100365938 Ga0070712_1003659381 217
35 3300006844 Ga0075428_100477857 Ga0075428_1004778572 217
36 3300006844 Ga0075428_100518425 Ga0075428_1005184252 217
37 3300009147 Ga0114129_10018659 Ga0114129_1001865911 217
38 3300009148 Ga0105243_10695627 Ga0105243_106956272 217
39 3300009177 Ga0105248_10313800 Ga0105248_103138002 217
40 3300009553 Ga0105249_10495464 Ga0105249_104954642 217
41 3300010159 Ga0099796_10094795 Ga0099796_100947952 217
42 3300011119 Ga0105246_10114073 Ga0105246_101140731 217
43 3300013306 Ga0163162_10111574 Ga0163162_101115742 217
44 3300013308 Ga0157375_10033550 Ga0157375_100335505 217
45 3300013308 Ga0157375_11168115 Ga0157375_111681151 217
46 3300025905 Ga0207685_10052755 Ga0207685_100527551 217
47 3300025910 Ga0207684_10533971 Ga0207684_105339711 217
48 3300025912 Ga0207707_10073689 Ga0207707_100736892 217
49 3300025915 Ga0207693_10045550 Ga0207693_100455503 217
50 3300025915 Ga0207693_10336701 Ga0207693_103367012 217
51 3300025916 Ga0207663_10336457 Ga0207663_103364571 217
52 3300025922 Ga0207646_10102008 Ga0207646_101020085 217
53 3300025922 Ga0207646_10171499 Ga0207646_101714991 217
54 3300025922 Ga0207646_10729266 Ga0207646_107292662 217
55 3300025926 Ga0207659_10140670 Ga0207659_101406703 217
56 3300025928 Ga0207700_10188346 Ga0207700_101883462 217
57 3300025931 Ga0207644_10249456 Ga0207644_102494562 217
58 3300025933 Ga0207706_10431101 Ga0207706_104311012 217
59 3300025939 Ga0207665_10051968 Ga0207665_100519683 217
60 3300025939 Ga0207665_10125268 Ga0207665_101252682 217
61 3300025972 Ga0207668_10212350 Ga0207668_102123502 217
62 3300026078 Ga0207702_11202481 Ga0207702_112024811 217
63 3300026088 Ga0207641_10780664 Ga0207641_107806641 217
64 3300028379 Ga0268266_10115513 Ga0268266_101155136 217
65 3300035116 Ga0373945_0025789 Ga0373945_0025789_232_885 217
66 3300035692 Ga0373935_0018633 Ga0373935_0018633_2201_2854 217
67 3300035692 Ga0373935_0056420 Ga0373935_0056420_203_856 217
68 3300035724 Ga0373933_0418026 Ga0373933_0418026_159_812 217
69 3300035725 Ga0373947_0479461 Ga0373947_0479461_117_770 217
70 3300036401 Ga0373937_0157799 Ga0373937_0157799_451_1104 217
71 3300037466 Ga0395898_0230674 Ga0395898_0230674_552_1205 217
72 3300038443 Ga0395901_0247923 Ga0395901_0247923_1071_1724 217
73 3300042012 Ga0439455_0029689 Ga0439455_0029689_20_673 217
74 3300046454 Ga0495592_0039482 Ga0495592_0039482_2837_3490 217
75 3300046461 Ga0495641_0222574 Ga0495641_0222574_81_734 217
76 3300046473 Ga0495582_0378425 Ga0495582_0378425_151_804 217
77 3300046476 Ga0495662_0041669 Ga0495662_0041669_79_732 217
78 3300046517 Ga0495630_0081404 Ga0495630_0081404_1670_2323 217
79 3300046683 Ga0495658_0170490 Ga0495658_0170490_396_1049 217
80 3300047317 Ga0495604_0137925 Ga0495604_0137925_25_678 217
81 3300047319 Ga0495674_0443422 Ga0495674_0443422_211_864 217
82 3300047471 Ga0495684_0034514 Ga0495684_0034514_2066_2719 217
83 3300047471 Ga0495684_0122098 Ga0495684_0122098_1088_1741 217
84 3300048903 Ga0496100_0081937 Ga0496100_0081937_703_1356 217
85 3300048904 Ga0496101_0135575 Ga0496101_0135575_692_1345 217
86 3300048905 Ga0496102_0377330 Ga0496102_0377330_37_690 217
87 3300048907 Ga0496104_0304411 Ga0496104_0304411_521_1174 217
88 3300048910 Ga0496107_0267277 Ga0496107_0267277_313_966 217
89 3300048915 Ga0496112_0818147 Ga0496112_0818147_29_682 217
90 3300048917 Ga0496114_0153806 Ga0496114_0153806_677_1330 217
91 3300048918 Ga0496115_0006654 Ga0496115_0006654_1081_1734 217
92 3300050512 nmdc:mga0n895_448222_c1 nmdc:mga0n895_448222_c1_238_891 217
93 3300050515 nmdc:mga0a205_773635_c1 nmdc:mga0a205_773635_c1_32_685 217
94 3300053085 Ga0495619_0274694 Ga0495619_0274694_327_980 217
95 3300007076 Ga0075435_100041003 Ga0075435_1000410032 219
96 3300050513 nmdc:mga0rr50_123598_c1 nmdc:mga0rr50_123598_c1_727_1386 219
97 3300005435 Ga0070714_100261103 Ga0070714_1002611032 220
98 3300013296 Ga0157374_10205850 Ga0157374_102058502 220
99 3300013297 Ga0157378_10605950 Ga0157378_106059502 220
100 3300025929 Ga0207664_10223646 Ga0207664_102236462 220
101 3300005289 Ga0065704_10005395 Ga0065704_100053952 221
102 3300005335 Ga0070666_10020404 Ga0070666_100204042 221
103 3300005338 Ga0068868_100126510 Ga0068868_1001265102 221
104 3300005347 Ga0070668_100002154 Ga0070668_1000021545 221
105 3300005353 Ga0070669_100023146 Ga0070669_1000231464 221
106 3300005354 Ga0070675_100025909 Ga0070675_1000259091 221
107 3300005354 Ga0070675_100300368 Ga0070675_1003003682 221
108 3300005355 Ga0070671_100573976 Ga0070671_1005739762 221
109 3300005355 Ga0070671_100602409 Ga0070671_1006024091 221
110 3300005367 Ga0070667_100080482 Ga0070667_1000804822 221
111 3300005434 Ga0070709_10189868 Ga0070709_101898682 221
112 3300005436 Ga0070713_100521001 Ga0070713_1005210012 221
113 3300005437 Ga0070710_10202451 Ga0070710_102024512 221
114 3300005437 Ga0070710_10232057 Ga0070710_102320572 221
115 3300005439 Ga0070711_100039014 Ga0070711_1000390142 221
116 3300005439 Ga0070711_100474274 Ga0070711_1004742742 221
117 3300005440 Ga0070705_100058990 Ga0070705_1000589902 221
118 3300005445 Ga0070708_100464446 Ga0070708_1004644461 221
119 3300005445 Ga0070708_100481128 Ga0070708_1004811281 221
120 3300005456 Ga0070678_100180008 Ga0070678_1001800081 221
121 3300005456 Ga0070678_100366028 Ga0070678_1003660282 221
122 3300005457 Ga0070662_100037379 Ga0070662_1000373792 221
123 3300005457 Ga0070662_100049658 Ga0070662_1000496582 221
124 3300005459 Ga0068867_100287827 Ga0068867_1002878271 221
125 3300005468 Ga0070707_100007723 Ga0070707_1000077235 221
126 3300005518 Ga0070699_100027265 Ga0070699_1000272656 221
127 3300005536 Ga0070697_100006829 Ga0070697_1000068298 221
128 3300005536 Ga0070697_100013899 Ga0070697_1000138995 221
129 3300005543 Ga0070672_100063463 Ga0070672_1000634632 221
130 3300005545 Ga0070695_100005934 Ga0070695_1000059343 221
131 3300005546 Ga0070696_100016487 Ga0070696_1000164872 221
132 3300005548 Ga0070665_100160996 Ga0070665_1001609962 221
133 3300005615 Ga0070702_100028062 Ga0070702_1000280622 221
134 3300005843 Ga0068860_100448482 Ga0068860_1004484822 221
135 3300005844 Ga0068862_100333481 Ga0068862_1003334812 221
136 3300006028 Ga0070717_10441130 Ga0070717_104411302 221
137 3300006173 Ga0070716_100040252 Ga0070716_1000402522 221
138 3300006175 Ga0070712_100004993 Ga0070712_1000049932 221
139 3300006175 Ga0070712_100058649 Ga0070712_1000586492 221
140 3300006175 Ga0070712_100783153 Ga0070712_1007831531 221
141 3300006852 Ga0075433_10435729 Ga0075433_104357292 221
142 3300006871 Ga0075434_100106636 Ga0075434_1001066362 221
143 3300006871 Ga0075434_100645668 Ga0075434_1006456682 221
144 3300006881 Ga0068865_100125961 Ga0068865_1001259612 221
145 3300007788 Ga0099795_10150233 Ga0099795_101502331 221
146 3300009098 Ga0105245_10040765 Ga0105245_100407652 221
147 3300009176 Ga0105242_10023913 Ga0105242_100239134 221
148 3300011119 Ga0105246_10322082 Ga0105246_103220822 221
149 3300013105 Ga0157369_11203929 Ga0157369_112039291 221
150 3300013297 Ga0157378_10103048 Ga0157378_101030482 221
151 3300013297 Ga0157378_10155658 Ga0157378_101556582 221
152 3300013306 Ga0163162_10032650 Ga0163162_100326504 221
153 3300013307 Ga0157372_10124908 Ga0157372_101249082 221
154 3300013307 Ga0157372_11449890 Ga0157372_114498901 221
155 3300014325 Ga0163163_10761670 Ga0163163_107616702 221
156 3300014969 Ga0157376_10067053 Ga0157376_100670532 221
157 3300017792 Ga0163161_10002469 Ga0163161_100024697 221
158 3300025290 Ga0207673_1001473 Ga0207673_10014732 221
159 3300025315 Ga0207697_10000025 Ga0207697_1000002513 221
160 3300025898 Ga0207692_10247834 Ga0207692_102478342 221
161 3300025901 Ga0207688_10001029 Ga0207688_1000102914 221
162 3300025903 Ga0207680_10197016 Ga0207680_101970162 221
163 3300025906 Ga0207699_10025578 Ga0207699_100255782 221
164 3300025907 Ga0207645_10003969 Ga0207645_100039694 221
165 3300025907 Ga0207645_10043378 Ga0207645_100433782 221
166 3300025910 Ga0207684_10004944 Ga0207684_100049448 221
167 3300025910 Ga0207684_10053578 Ga0207684_100535783 221
168 3300025910 Ga0207684_10185805 Ga0207684_101858052 221
169 3300025915 Ga0207693_10001965 Ga0207693_100019657 221
170 3300025915 Ga0207693_10016370 Ga0207693_100163701 221
171 3300025916 Ga0207663_10032531 Ga0207663_100325312 221
172 3300025916 Ga0207663_10501097 Ga0207663_105010972 221
173 3300025922 Ga0207646_10103010 Ga0207646_101030102 221
174 3300025922 Ga0207646_10365220 Ga0207646_103652202 221
175 3300025928 Ga0207700_10894469 Ga0207700_108944692 221
176 3300025931 Ga0207644_10059804 Ga0207644_100598042 221
177 3300025933 Ga0207706_10015402 Ga0207706_100154022 221
178 3300025933 Ga0207706_10019313 Ga0207706_100193131 221
179 3300025934 Ga0207686_10465125 Ga0207686_104651252 221
180 3300025938 Ga0207704_10107677 Ga0207704_101076772 221
181 3300025939 Ga0207665_10006639 Ga0207665_100066391 221
182 3300025939 Ga0207665_10023675 Ga0207665_100236753 221
183 3300025940 Ga0207691_10000864 Ga0207691_1000086423 221
184 3300025960 Ga0207651_10086148 Ga0207651_100861482 221
185 3300025961 Ga0207712_10725124 Ga0207712_107251242 221
186 3300025972 Ga0207668_10066841 Ga0207668_100668412 221
187 3300025972 Ga0207668_10114723 Ga0207668_101147232 221
188 3300025981 Ga0207640_10198402 Ga0207640_101984022 221
189 3300026078 Ga0207702_11185324 Ga0207702_111853241 221
190 3300026121 Ga0207683_10036694 Ga0207683_100366944 221
191 3300028379 Ga0268266_10453013 Ga0268266_104530132 221
192 3300028381 Ga0268264_10313295 Ga0268264_103132952 221
193 3300035083 Ga0373926_0046618 Ga0373926_0046618_828_1493 221
194 3300035089 Ga0373944_0033763 Ga0373944_0033763_852_1517 221
195 3300035171 Ga0373946_0031008 Ga0373946_0031008_589_1254 221
196 3300035692 Ga0373935_0249725 Ga0373935_0249725_494_1159 221
197 3300035695 Ga0373927_0175985 Ga0373927_0175985_147_812 221
198 3300035725 Ga0373947_0138457 Ga0373947_0138457_426_1091 221
199 3300037068 Ga0373925_0035220 Ga0373925_0035220_2513_3178 221
200 3300037068 Ga0373925_0154684 Ga0373925_0154684_602_1267 221
201 3300037418 Ga0395900_0383289 Ga0395900_0383289_683_1351 221
202 3300037466 Ga0395898_0010142 Ga0395898_0010142_5661_6329 221
203 3300038443 Ga0395901_0026924 Ga0395901_0026924_5161_5829 221
204 3300048904 Ga0496101_0002744 Ga0496101_0002744_8007_8672 221
205 3300048905 Ga0496102_0066764 Ga0496102_0066764_2550_3215 221
206 3300048907 Ga0496104_0216232 Ga0496104_0216232_762_1427 221
207 3300048908 Ga0496105_0203233 Ga0496105_0203233_602_1267 221
208 3300048909 Ga0496106_0005308 Ga0496106_0005308_8447_9112 221
209 3300048910 Ga0496107_0040088 Ga0496107_0040088_1813_2478 221
210 3300048912 Ga0496109_0935962 Ga0496109_0935962_112_777 221
211 3300048913 Ga0496110_0078467 Ga0496110_0078467_2169_2834 221
212 3300048915 Ga0496112_0030748 Ga0496112_0030748_2330_2995 221
213 3300048916 Ga0496113_0106517 Ga0496113_0106517_971_1636 221
214 3300048918 Ga0496115_0005041 Ga0496115_0005041_5593_6258 221
215 3300050512 nmdc:mga0n895_797244_c1 nmdc:mga0n895_797244_c1_37_702 221
216 3300050515 nmdc:mga0a205_382884_c1 nmdc:mga0a205_382884_c1_184_852 221
217 3300005328 Ga0070676_10006154 Ga0070676_100061545 223
218 3300005334 Ga0068869_100109566 Ga0068869_1001095664 223
219 3300005338 Ga0068868_100006255 Ga0068868_1000062552 223
220 3300005339 Ga0070660_100017141 Ga0070660_1000171412 223
221 3300005340 Ga0070689_100007138 Ga0070689_1000071385 223
222 3300005343 Ga0070687_100000887 Ga0070687_1000008874 223
223 3300005347 Ga0070668_100005686 Ga0070668_1000056867 223
224 3300005353 Ga0070669_100004516 Ga0070669_1000045168 223
225 3300005354 Ga0070675_100001260 Ga0070675_1000012606 223
226 3300005366 Ga0070659_100017913 Ga0070659_1000179134 223
227 3300005367 Ga0070667_100003659 Ga0070667_1000036594 223
228 3300005457 Ga0070662_100000581 Ga0070662_10000058111 223
229 3300005543 Ga0070672_100016236 Ga0070672_1000162361 223
230 3300005843 Ga0068860_100005184 Ga0068860_1000051844 223
231 3300005844 Ga0068862_100003505 Ga0068862_1000035055 223
232 3300009098 Ga0105245_10113951 Ga0105245_101139512 223
233 3300009553 Ga0105249_10012996 Ga0105249_100129965 223
234 3300010375 Ga0105239_10024855 Ga0105239_100248551 223
235 3300013296 Ga0157374_10005391 Ga0157374_100053916 223
236 3300013297 Ga0157378_10027624 Ga0157378_100276242 223
237 3300013306 Ga0163162_10004489 Ga0163162_100044899 223
238 3300013307 Ga0157372_10324829 Ga0157372_103248292 223
239 3300014968 Ga0157379_10035196 Ga0157379_100351965 223
240 3300017792 Ga0163161_10106221 Ga0163161_101062212 223
241 3300025271 Ga0207666_1005580 Ga0207666_10055801 223
242 3300025315 Ga0207697_10000160 Ga0207697_1000016013 223
243 3300025907 Ga0207645_10001376 Ga0207645_1000137613 223
244 3300025918 Ga0207662_10000736 Ga0207662_1000073613 223
245 3300025919 Ga0207657_10059111 Ga0207657_100591112 223
246 3300025923 Ga0207681_10003035 Ga0207681_100030355 223
247 3300025926 Ga0207659_10022932 Ga0207659_100229323 223
248 3300025932 Ga0207690_10009811 Ga0207690_100098113 223
249 3300025933 Ga0207706_10000443 Ga0207706_1000044312 223
250 3300025942 Ga0207689_10124661 Ga0207689_101246613 223
251 3300025961 Ga0207712_10025223 Ga0207712_100252233 223
252 3300025972 Ga0207668_10002178 Ga0207668_100021785 223
253 3300026023 Ga0207677_10197625 Ga0207677_101976251 223
254 3300028380 Ga0268265_10167826 Ga0268265_101678262 223
255 3300028381 Ga0268264_10009371 Ga0268264_100093715 223
256 3300045051 Ga0451576_0027516 Ga0451576_0027516_2258_2965 223
257 3300005338 Ga0068868_100575669 Ga0068868_1005756691 225
258 3300006028 Ga0070717_10000658 Ga0070717_1000065811 227
259 3300025922 Ga0207646_10054326 Ga0207646_100543262 227
260 3300005467 Ga0070706_100013043 Ga0070706_1000130436 236
261 3300005468 Ga0070707_100048148 Ga0070707_1000481488 236
262 3300005518 Ga0070699_100206318 Ga0070699_1002063182 236
263 3300005536 Ga0070697_100150043 Ga0070697_1001500432 236
264 3300025910 Ga0207684_10003154 Ga0207684_100031545 236
265 3300025922 Ga0207646_10174792 Ga0207646_101747923 236
266 3300005467 Ga0070706_100000339 Ga0070706_10000033919 238
267 3300025910 Ga0207684_10000276 Ga0207684_1000027641 238
268 3300005546 Ga0070696_100150780 Ga0070696_1001507802 239
269 3300005536 Ga0070697_100117411 Ga0070697_1001174111 240
270 3300005468 Ga0070707_100045815 Ga0070707_1000458152 241
271 3300025922 Ga0207646_10082005 Ga0207646_100820054 248
272 3300000545 CNXas_1000017 CNXas_10000173 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03548

LolA

Outer membrane lipoprotein carrier protein LolA

42

212

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8v1k-assembly2.cif.gz_B crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella tularensis 0.8611 57 245
8orn-assembly2.cif.gz_C crystal structure of xanthomonas campestris pv. campestris lola-lolb complex 0.8445 61 245
4ki3-assembly3.cif.gz_I 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.8411 60 245
2w7q-assembly1.cif.gz_A structure of pseudomonas aeruginosa lola 0.84 57 245
4ki3-assembly1.cif.gz_D 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.839 60 245
ID Description Score Start End Superfamily
af_P39310_121_209_3.10.450.350 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8932 192 219 3.10.450.350
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.837 60 245 2.50.20.10
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8237 60 245 2.50.20.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8159 60 245 2.50.20.10
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8034 60 245 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A2V5NYB0-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9686 46 249
AF-A0A4Q3BUS5-F1-model_v4 deleted 0.9117 46 249
AF-A0A1F0UCE0-F1-model_v4 Cell envelope biogenesis protein LolA 0.9085 47 235
AF-D3IJ49-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9084 47 235
AF-A0A2V6FGV7-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9035 72 249

Feature Viewer

pLDDT pTM Quality
82.17 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map