F378188

General Info

Members Datasets Scaffolds Average Seq Length
272 110 544 347

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100004092|Ga0070705_1000040926
Length 351
Sequence MPAEWEPHAATWIGWPHNVTDWPGKFPPIPWVYGEIVRKLAPGEVVRILVNSAIQQTQASRILTKVGVDLARVDFLRFPTNRGWTRDFGPIFVRGDKGLTIARFHFNAWAKYKDWKKDAAIPERAAKHFKLPLIPGKIVLEGGSIDVNGRGTLITTEECLLDPKVQTRNPGLSRGEIETVFRDALGITNTLWLGKGIAGDDTHGHVDDLCRFVKPGTVVLCREDDPKDVNYRPLAENRERLQGMHLERGTSIEVIDLPMPAPLYFDGVRLPASYANFYVSNAAVLVPTFNDPKDRIALGILAELFGDRPVVGIHAVDLVWGLGTIHCLTQQEPVLTPDPLSVPERGNGLRP

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
44 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 0
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100004092 3300005440 Bacteria 7121
2 Ga0070690_100014589 3300005330 Bacteria 4664
3 Ga0070689_100035027 3300005340 Bacteria 3833
4 Ga0070675_100016104 3300005354 Bacteria 5926
5 Ga0070673_100002638 3300005364 Bacteria 10968
6 Ga0070703_10000222 3300005406 Bacteria 27468
7 Ga0070703_10006064 3300005406 Bacteria 3384
8 Ga0070703_10009925 3300005406 Bacteria 2686
9 Ga0070709_10004785 3300005434 Bacteria 7314
10 Ga0070711_100000126 3300005439 Bacteria 40475
11 Ga0070705_100008218 3300005440 Bacteria 5163
12 Ga0070705_100191453 3300005440 Bacteria 1394
13 Ga0070694_100000603 3300005444 Bacteria 19790
14 Ga0070694_100004419 3300005444 Bacteria 8456
15 Ga0070708_100017129 3300005445 Bacteria 6035
16 Ga0070708_100027174 3300005445 Bacteria 4907
17 Ga0070708_100052640 3300005445 Bacteria 3610
18 Ga0070708_100098017 3300005445 Bacteria 2680
19 Ga0070708_100138710 3300005445 Bacteria 2254
20 Ga0070706_100003793 3300005467 Bacteria 14759
21 Ga0070706_100006160 3300005467 Bacteria 11345
22 Ga0070706_100007477 3300005467 Bacteria 10243
23 Ga0070706_100020394 3300005467 Bacteria 6108
24 Ga0070706_100021197 3300005467 Bacteria 5985
25 Ga0070706_100106056 3300005467 Bacteria 2614
26 Ga0070706_100165826 3300005467 Bacteria 2063
27 Ga0070706_100234482 3300005467 Unclassified 1713
28 Ga0070707_100004253 3300005468 Bacteria 13406
29 Ga0070707_100005957 3300005468 Bacteria 11374
30 Ga0070707_100012572 3300005468 Bacteria 7907
31 Ga0070707_100091246 3300005468 Bacteria 2949
32 Ga0070707_100094910 3300005468 Bacteria 2888
33 Ga0070707_100160773 3300005468 Bacteria 2189
34 Ga0070707_100177742 3300005468 Bacteria 2075
35 Ga0070698_100000697 3300005471 Bacteria 35907
36 Ga0070698_100000816 3300005471 Bacteria 34012
37 Ga0070698_100001971 3300005471 Bacteria 22819
38 Ga0070698_100021653 3300005471 Bacteria 6730
39 Ga0070698_100074004 3300005471 Bacteria 3412
40 Ga0070698_100253556 3300005471 Bacteria 1692
41 Ga0070699_100002621 3300005518 Bacteria 16062
42 Ga0070699_100004318 3300005518 Bacteria 12568
43 Ga0070699_100091277 3300005518 Bacteria 2663
44 Ga0070699_100101995 3300005518 Bacteria 2516
45 Ga0070699_100123112 3300005518 Bacteria 2281
46 Ga0070699_100150648 3300005518 Bacteria 2057
47 Ga0070699_100170430 3300005518 Bacteria 1929
48 Ga0070697_100001179 3300005536 Bacteria 19791
49 Ga0070697_100009162 3300005536 Bacteria 7733
50 Ga0070697_100054105 3300005536 Bacteria 3262
51 Ga0070697_100219700 3300005536 Bacteria 1619
52 Ga0070697_100236380 3300005536 Bacteria 1560
53 Ga0070697_100293853 3300005536 Bacteria 1396
54 Ga0070672_100179241 3300005543 Bacteria 1765
55 Ga0070686_100102012 3300005544 Bacteria 1940
56 Ga0070695_100001687 3300005545 Bacteria 12457
57 Ga0070695_100002037 3300005545 Bacteria 11541
58 Ga0070695_100002775 3300005545 Bacteria 10161
59 Ga0070695_100003225 3300005545 Bacteria 9521
60 Ga0070695_100004989 3300005545 Bacteria 7825
61 Ga0070695_100325596 3300005545 Bacteria 1144
62 Ga0070696_100000334 3300005546 Bacteria 28521
63 Ga0070696_100000782 3300005546 Bacteria 20460
64 Ga0070696_100019387 3300005546 Bacteria 4606
65 Ga0070704_100000843 3300005549 Bacteria 15262
66 Ga0070704_100014783 3300005549 Bacteria 4883
67 Ga0070704_100036072 3300005549 Bacteria 3366
68 Ga0070704_100041204 3300005549 Bacteria 3185
69 Ga0070704_100153463 3300005549 Bacteria 1813
70 Ga0070664_100261169 3300005564 Bacteria 1558
71 Ga0068859_100003306 3300005617 Bacteria 16401
72 Ga0068859_100174642 3300005617 Bacteria 2230
73 Ga0068864_100044597 3300005618 Bacteria 3802
74 Ga0068858_100046183 3300005842 Bacteria 4038
75 Ga0081539_10063040 3300005985 Bacteria 2024
76 Ga0070716_100001598 3300006173 Bacteria 10206
77 Ga0075367_10002106 3300006178 Bacteria 8932
78 Ga0075366_10002086 3300006195 Bacteria 10149
79 Ga0075370_10089477 3300006353 Bacteria 1775
80 Ga0075428_100002917 3300006844 Bacteria 18620
81 Ga0075428_100005807 3300006844 Bacteria 13708
82 Ga0075428_100018830 3300006844 Bacteria 7634
83 Ga0075431_100027128 3300006847 Bacteria 5874
84 Ga0075433_10008641 3300006852 Bacteria 8127
85 Ga0075433_10016427 3300006852 Bacteria 6101
86 Ga0075433_10021143 3300006852 Bacteria 5454
87 Ga0075433_10071057 3300006852 Bacteria 3060
88 Ga0075433_10086767 3300006852 Bacteria 2763
89 Ga0075433_10300863 3300006852 Bacteria 1420
90 Ga0075434_100000228 3300006871 Bacteria 38589
91 Ga0075434_100001348 3300006871 Bacteria 20609
92 Ga0075434_100010910 3300006871 Bacteria 8542
93 Ga0075434_100018079 3300006871 Bacteria 6800
94 Ga0075434_100021936 3300006871 Bacteria 6215
95 Ga0075434_100062582 3300006871 Bacteria 3704
96 Ga0075434_100378316 3300006871 Bacteria 1437
97 Ga0075429_100002932 3300006880 Bacteria 14465
98 Ga0075429_100038276 3300006880 Bacteria 4175
99 Ga0075429_100301947 3300006880 Bacteria 1402
100 Ga0075436_100001790 3300006914 Bacteria 14722
101 Ga0075436_100009090 3300006914 Bacteria 6800
102 Ga0075436_100051046 3300006914 Bacteria 2854
103 Ga0075436_100129185 3300006914 Bacteria 1771
104 Ga0097620_100003306 3300006931 Bacteria 16401
105 Ga0097620_100174662 3300006931 Bacteria 2230
106 Ga0075435_100001986 3300007076 Bacteria 13361
107 Ga0075435_100009902 3300007076 Bacteria 6940
108 Ga0075435_100022615 3300007076 Bacteria 4850
109 Ga0075435_100055438 3300007076 Bacteria 3201
110 Ga0111539_10009042 3300009094 Bacteria 12607
111 Ga0111539_10199116 3300009094 Bacteria 2336
112 Ga0114129_10000848 3300009147 Bacteria 39581
113 Ga0114129_10030396 3300009147 Bacteria 7642
114 Ga0114129_10068017 3300009147 Bacteria 4968
115 Ga0114129_10104115 3300009147 Bacteria 3922
116 Ga0114129_10107140 3300009147 Bacteria 3860
117 Ga0114129_10169688 3300009147 Bacteria 2975
118 Ga0114129_10202798 3300009147 Bacteria 2685
119 Ga0114129_10615071 3300009147 Unclassified 1406
120 Ga0114129_10703403 3300009147 Bacteria 1298
121 Ga0105248_10265472 3300009177 Bacteria 1932
122 Ga0105249_10448515 3300009553 Bacteria 1328
123 Ga0157380_10183373 3300014326 Bacteria 1841
124 Ga0228598_1001027 3300024227 Bacteria 6134
125 Ga0207653_10000039 3300025885 Bacteria 98540
126 Ga0207653_10004548 3300025885 Bacteria 4349
127 Ga0207653_10007457 3300025885 Bacteria 3410
128 Ga0207653_10014391 3300025885 Bacteria 2482
129 Ga0207684_10004584 3300025910 Bacteria 12985
130 Ga0207684_10019382 3300025910 Bacteria 5821
131 Ga0207684_10060127 3300025910 Bacteria 3227
132 Ga0207663_10000046 3300025916 Bacteria 67693
133 Ga0207646_10001664 3300025922 Bacteria 27155
134 Ga0207646_10004000 3300025922 Bacteria 16319
135 Ga0207646_10036188 3300025922 Bacteria 4457
136 Ga0207646_10054588 3300025922 Bacteria 3573
137 Ga0207646_10092659 3300025922 Bacteria 2705
138 Ga0207646_10143317 3300025922 Bacteria 2152
139 Ga0207646_10206487 3300025922 Bacteria 1774
140 Ga0207687_10195572 3300025927 Bacteria 1577
141 Ga0207670_10150945 3300025936 Bacteria 1724
142 Ga0207665_10008291 3300025939 Bacteria 6860
143 Ga0207689_10099655 3300025942 Bacteria 2387
144 Ga0207689_10133497 3300025942 Bacteria 2043
145 Ga0207679_10215758 3300025945 Bacteria 1612
146 Ga0207651_10001928 3300025960 Bacteria 9738
147 Ga0207712_10299976 3300025961 Bacteria 1318
148 Ga0207658_10195263 3300025986 Bacteria 1686
149 Ga0207703_10039247 3300026035 Bacteria 3783
150 Ga0207703_10437454 3300026035 Bacteria 1220
151 Ga0207708_10008645 3300026075 Bacteria 7536
152 Ga0207676_10088381 3300026095 Bacteria 2537
153 Ga0207674_10159545 3300026116 Bacteria 2210
154 Ga0207675_100011434 3300026118 Bacteria 8304
155 Ga0207428_10000325 3300027907 Bacteria 61954
156 Ga0265337_1006833 3300028556 Unclassified 4338
157 Ga0265323_10006247 3300028653 Bacteria 5014
158 Ga0265323_10010598 3300028653 Bacteria 3734
159 Ga0265323_10013327 3300028653 Unclassified 3280
160 Ga0265323_10014735 3300028653 Bacteria 3085
161 Ga0265323_10032898 3300028653 Unclassified 1922
162 Ga0265338_10017710 3300028800 Bacteria 7661
163 Ga0265338_10033167 3300028800 Bacteria 5017
164 Ga0265338_10141427 3300028800 Bacteria 1884
165 Ga0265338_10209358 3300028800 Bacteria 1465
166 Ga0265760_10008528 3300031090 Bacteria 2930
167 Ga0265330_10000230 3300031235 Bacteria 42794
168 Ga0265330_10002345 3300031235 Bacteria 10382
169 Ga0265330_10003074 3300031235 Bacteria 8838
170 Ga0265330_10061641 3300031235 Bacteria 1631
171 Ga0265332_10014560 3300031238 Bacteria 3479
172 Ga0265328_10058772 3300031239 Bacteria 1412
173 Ga0265320_10008358 3300031240 Bacteria 6337
174 Ga0265329_10000574 3300031242 Bacteria 19021
175 Ga0265329_10001463 3300031242 Bacteria 11358
176 Ga0265329_10008197 3300031242 Unclassified 3979
177 Ga0265340_10000916 3300031247 Bacteria 16739
178 Ga0265339_10076667 3300031249 Bacteria 1772
179 Ga0265339_10090485 3300031249 Unclassified 1605
180 Ga0265331_10008293 3300031250 Bacteria 5920
181 Ga0265331_10029406 3300031250 Bacteria 2743
182 Ga0265316_10000074 3300031344 Bacteria 102906
183 Ga0265316_10000287 3300031344 Bacteria 56760
184 Ga0265316_10000325 3300031344 Bacteria 53021
185 Ga0265316_10004017 3300031344 Bacteria 14734
186 Ga0265316_10005670 3300031344 Bacteria 12082
187 Ga0265316_10010012 3300031344 Bacteria 8672
188 Ga0265316_10023571 3300031344 Bacteria 5169
189 Ga0265316_10051625 3300031344 Bacteria 3229
190 Ga0265316_10221032 3300031344 Unclassified 1398
191 Ga0265314_10000017 3300031711 Bacteria 340498
192 Ga0265314_10011172 3300031711 Bacteria 7440
193 Ga0265342_10000375 3300031712 Bacteria 49288
194 Ga0265342_10001695 3300031712 Bacteria 20207
195 Ga0265342_10003754 3300031712 Bacteria 12263
196 Ga0265342_10004462 3300031712 Bacteria 11003
197 Ga0265342_10006261 3300031712 Bacteria 8883
198 Ga0316576_10027196 3300031727 Bacteria 4020
199 Ga0316578_10057799 3300031728 Bacteria 2279
200 Ga0316577_10000716 3300031733 Bacteria 14103
201 Ga0373955_0035586 3300035172 Bacteria 2638
202 Ga0316582_0001759 3300036647 Bacteria 9755
203 Ga0316584_0000175 3300036712 Bacteria 30687
204 Ga0242420_005382 3300038996 Bacteria 1982
205 Ga0451577_0000476 3300042876 Bacteria 68574
206 Ga0451577_0026922 3300042876 Bacteria 5206
207 Ga0451577_0028758 3300042876 Bacteria 5026
208 Ga0451577_0041603 3300042876 Bacteria 4124
209 Ga0451577_0169209 3300042876 Bacteria 1969
210 Ga0451577_0240669 3300042876 Bacteria 1637
211 Ga0453683_0128252 3300044673 Bacteria 1598
212 Ga0453684_0000194 3300044712 Bacteria 265783
213 Ga0453684_0000197 3300044712 Bacteria 264445
214 Ga0453684_0000513 3300044712 Bacteria 149882
215 Ga0453684_0000968 3300044712 Bacteria 94634
216 Ga0453684_0015778 3300044712 Bacteria 11887
217 Ga0451576_0041407 3300045051 Bacteria 4871
218 Ga0451576_0086909 3300045051 Bacteria 3252
219 Ga0451576_0110095 3300045051 Bacteria 2866
220 Ga0495580_0122221 3300046472 Unclassified 1807
221 Ga0495630_0227609 3300046517 Bacteria 1424
222 Ga0495642_0049718 3300046528 Bacteria 1723
223 Ga0495657_0063337 3300046675 Bacteria 2440
224 Ga0495602_0019643 3300048088 Bacteria 6701
225 Ga0501041_0156269 3300049577 Bacteria 1425
226 Ga0501070_0200693 3300049586 Bacteria 1638
227 Ga0501075_0041214 3300049591 Bacteria 3460
228 Ga0501076_0030857 3300049592 Bacteria 4176
229 Ga0501076_0193152 3300049592 Bacteria 1662
230 Ga0501079_0066109 3300049741 Bacteria 2790
231 Ga0501079_0343563 3300049741 Bacteria 1169
232 Ga0501080_0111597 3300049742 Bacteria 2535
233 Ga0501080_0250028 3300049742 Bacteria 1617
234 nmdc:mga0k408_1266_c1 3300050493 Bacteria 13744
235 nmdc:mga06z11_2032_c1 3300050494 Bacteria 7672
236 nmdc:mga07m45_15213_c1 3300050496 Bacteria 4107
237 nmdc:mga05p37_15365_c1 3300050507 Bacteria 9197
238 nmdc:mga05p37_155733_c1 3300050507 Bacteria 2793
239 nmdc:mga05p37_16201_c1 3300050507 Bacteria 8975
240 nmdc:mga05p37_1918_c1 3300050507 Bacteria 24184
241 nmdc:mga05p37_202379_c1 3300050507 Bacteria 2404
242 nmdc:mga05p37_210963_c1 3300050507 Bacteria 2348
243 nmdc:mga05p37_327056_c1 3300050507 Bacteria 1812
244 nmdc:mga05p37_35920_c1 3300050507 Bacteria 6081
245 nmdc:mga09592_248455_c1 3300050508 Bacteria 1542
246 nmdc:mga09592_6062_c1 3300050508 Bacteria 9854
247 nmdc:mga06r32_31913_c1 3300050510 Bacteria 4951
248 nmdc:mga08y16_2497_c1 3300050511 Bacteria 18912
249 nmdc:mga08y16_251994_c1 3300050511 Unclassified 1824
250 nmdc:mga0n895_111435_c1 3300050512 Bacteria 2753
251 nmdc:mga0n895_11232_c1 3300050512 Bacteria 7977
252 nmdc:mga0n895_1246_c1 3300050512 Bacteria 18777
253 nmdc:mga0n895_127976_c1 3300050512 Bacteria 2564
254 nmdc:mga0n895_2341_c1 3300050512 Bacteria 14768
255 nmdc:mga0n895_376428_c1 3300050512 Bacteria 1437
256 nmdc:mga0rr50_13110_c1 3300050513 Bacteria 5384
257 nmdc:mga0rr50_190397_c1 3300050513 Bacteria 1681
258 nmdc:mga0rr50_5788_c1 3300050513 Bacteria 7424
259 nmdc:mga0rr50_8926_c1 3300050513 Bacteria 6264
260 nmdc:mga08x19_1160_c1 3300050514 Bacteria 16481
261 nmdc:mga08x19_213861_c1 3300050514 Bacteria 1324
262 nmdc:mga08x19_50361_c1 3300050514 Unclassified 2673
263 nmdc:mga0a205_11271_c1 3300050515 Bacteria 8229
264 nmdc:mga0a205_144415_c1 3300050515 Bacteria 2279
265 nmdc:mga0a205_167262_c1 3300050515 Bacteria 2094
266 nmdc:mga0a205_1734_c1 3300050515 Bacteria 18855
267 nmdc:mga0a205_1867_c1 3300050515 Bacteria 18246
268 nmdc:mga0a205_230384_c1 3300050515 Bacteria 1736
269 nmdc:mga0a205_303889_c1 3300050515 Bacteria 1468
270 nmdc:mga0a205_33841_c1 3300050515 Bacteria 4901
271 nmdc:mga0a205_92309_c1 3300050515 Bacteria 2925
272 Ga0501082_0075367 3300060353 Bacteria 2907
273 Ga0070705_100004092
274 Ga0070690_100014589
275 Ga0070689_100035027
276 Ga0070675_100016104
277 Ga0070673_100002638
278 Ga0070703_10000222
279 Ga0070703_10006064
280 Ga0070703_10009925
281 Ga0070709_10004785
282 Ga0070711_100000126
283 Ga0070705_100008218
284 Ga0070705_100191453
285 Ga0070694_100000603
286 Ga0070694_100004419
287 Ga0070708_100017129
288 Ga0070708_100027174
289 Ga0070708_100052640
290 Ga0070708_100098017
291 Ga0070708_100138710
292 Ga0070706_100003793
293 Ga0070706_100006160
294 Ga0070706_100007477
295 Ga0070706_100020394
296 Ga0070706_100021197
297 Ga0070706_100106056
298 Ga0070706_100165826
299 Ga0070706_100234482
300 Ga0070707_100004253
301 Ga0070707_100005957
302 Ga0070707_100012572
303 Ga0070707_100091246
304 Ga0070707_100094910
305 Ga0070707_100160773
306 Ga0070707_100177742
307 Ga0070698_100000697
308 Ga0070698_100000816
309 Ga0070698_100001971
310 Ga0070698_100021653
311 Ga0070698_100074004
312 Ga0070698_100253556
313 Ga0070699_100002621
314 Ga0070699_100004318
315 Ga0070699_100091277
316 Ga0070699_100101995
317 Ga0070699_100123112
318 Ga0070699_100150648
319 Ga0070699_100170430
320 Ga0070697_100001179
321 Ga0070697_100009162
322 Ga0070697_100054105
323 Ga0070697_100219700
324 Ga0070697_100236380
325 Ga0070697_100293853
326 Ga0070672_100179241
327 Ga0070686_100102012
328 Ga0070695_100001687
329 Ga0070695_100002037
330 Ga0070695_100002775
331 Ga0070695_100003225
332 Ga0070695_100004989
333 Ga0070695_100325596
334 Ga0070696_100000334
335 Ga0070696_100000782
336 Ga0070696_100019387
337 Ga0070704_100000843
338 Ga0070704_100014783
339 Ga0070704_100036072
340 Ga0070704_100041204
341 Ga0070704_100153463
342 Ga0070664_100261169
343 Ga0068859_100003306
344 Ga0068859_100174642
345 Ga0068864_100044597
346 Ga0068858_100046183
347 Ga0081539_10063040
348 Ga0070716_100001598
349 Ga0075367_10002106
350 Ga0075366_10002086
351 Ga0075370_10089477
352 Ga0075428_100002917
353 Ga0075428_100005807
354 Ga0075428_100018830
355 Ga0075431_100027128
356 Ga0075433_10008641
357 Ga0075433_10016427
358 Ga0075433_10021143
359 Ga0075433_10071057
360 Ga0075433_10086767
361 Ga0075433_10300863
362 Ga0075434_100000228
363 Ga0075434_100001348
364 Ga0075434_100010910
365 Ga0075434_100018079
366 Ga0075434_100021936
367 Ga0075434_100062582
368 Ga0075434_100378316
369 Ga0075429_100002932
370 Ga0075429_100038276
371 Ga0075429_100301947
372 Ga0075436_100001790
373 Ga0075436_100009090
374 Ga0075436_100051046
375 Ga0075436_100129185
376 Ga0097620_100003306
377 Ga0097620_100174662
378 Ga0075435_100001986
379 Ga0075435_100009902
380 Ga0075435_100022615
381 Ga0075435_100055438
382 Ga0111539_10009042
383 Ga0111539_10199116
384 Ga0114129_10000848
385 Ga0114129_10030396
386 Ga0114129_10068017
387 Ga0114129_10104115
388 Ga0114129_10107140
389 Ga0114129_10169688
390 Ga0114129_10202798
391 Ga0114129_10615071
392 Ga0114129_10703403
393 Ga0105248_10265472
394 Ga0105249_10448515
395 Ga0157380_10183373
396 Ga0228598_1001027
397 Ga0207653_10000039
398 Ga0207653_10004548
399 Ga0207653_10007457
400 Ga0207653_10014391
401 Ga0207684_10004584
402 Ga0207684_10019382
403 Ga0207684_10060127
404 Ga0207663_10000046
405 Ga0207646_10001664
406 Ga0207646_10004000
407 Ga0207646_10036188
408 Ga0207646_10054588
409 Ga0207646_10092659
410 Ga0207646_10143317
411 Ga0207646_10206487
412 Ga0207687_10195572
413 Ga0207670_10150945
414 Ga0207665_10008291
415 Ga0207689_10099655
416 Ga0207689_10133497
417 Ga0207679_10215758
418 Ga0207651_10001928
419 Ga0207712_10299976
420 Ga0207658_10195263
421 Ga0207703_10039247
422 Ga0207703_10437454
423 Ga0207708_10008645
424 Ga0207676_10088381
425 Ga0207674_10159545
426 Ga0207675_100011434
427 Ga0207428_10000325
428 Ga0265337_1006833
429 Ga0265323_10006247
430 Ga0265323_10010598
431 Ga0265323_10013327
432 Ga0265323_10014735
433 Ga0265323_10032898
434 Ga0265338_10017710
435 Ga0265338_10033167
436 Ga0265338_10141427
437 Ga0265338_10209358
438 Ga0265760_10008528
439 Ga0265330_10000230
440 Ga0265330_10002345
441 Ga0265330_10003074
442 Ga0265330_10061641
443 Ga0265332_10014560
444 Ga0265328_10058772
445 Ga0265320_10008358
446 Ga0265329_10000574
447 Ga0265329_10001463
448 Ga0265329_10008197
449 Ga0265340_10000916
450 Ga0265339_10076667
451 Ga0265339_10090485
452 Ga0265331_10008293
453 Ga0265331_10029406
454 Ga0265316_10000074
455 Ga0265316_10000287
456 Ga0265316_10000325
457 Ga0265316_10004017
458 Ga0265316_10005670
459 Ga0265316_10010012
460 Ga0265316_10023571
461 Ga0265316_10051625
462 Ga0265316_10221032
463 Ga0265314_10000017
464 Ga0265314_10011172
465 Ga0265342_10000375
466 Ga0265342_10001695
467 Ga0265342_10003754
468 Ga0265342_10004462
469 Ga0265342_10006261
470 Ga0316576_10027196
471 Ga0316578_10057799
472 Ga0316577_10000716
473 Ga0373955_0035586
474 Ga0316582_0001759
475 Ga0316584_0000175
476 Ga0242420_005382
477 Ga0451577_0000476
478 Ga0451577_0026922
479 Ga0451577_0028758
480 Ga0451577_0041603
481 Ga0451577_0169209
482 Ga0451577_0240669
483 Ga0453683_0128252
484 Ga0453684_0000194
485 Ga0453684_0000197
486 Ga0453684_0000513
487 Ga0453684_0000968
488 Ga0453684_0015778
489 Ga0451576_0041407
490 Ga0451576_0086909
491 Ga0451576_0110095
492 Ga0495580_0122221
493 Ga0495630_0227609
494 Ga0495642_0049718
495 Ga0495657_0063337
496 Ga0495602_0019643
497 Ga0501041_0156269
498 Ga0501070_0200693
499 Ga0501075_0041214
500 Ga0501076_0030857
501 Ga0501076_0193152
502 Ga0501079_0066109
503 Ga0501079_0343563
504 Ga0501080_0111597
505 Ga0501080_0250028
506 nmdc:mga0k408_1266_c1
507 nmdc:mga06z11_2032_c1
508 nmdc:mga07m45_15213_c1
509 nmdc:mga05p37_15365_c1
510 nmdc:mga05p37_155733_c1
511 nmdc:mga05p37_16201_c1
512 nmdc:mga05p37_1918_c1
513 nmdc:mga05p37_202379_c1
514 nmdc:mga05p37_210963_c1
515 nmdc:mga05p37_327056_c1
516 nmdc:mga05p37_35920_c1
517 nmdc:mga09592_248455_c1
518 nmdc:mga09592_6062_c1
519 nmdc:mga06r32_31913_c1
520 nmdc:mga08y16_2497_c1
521 nmdc:mga08y16_251994_c1
522 nmdc:mga0n895_111435_c1
523 nmdc:mga0n895_11232_c1
524 nmdc:mga0n895_1246_c1
525 nmdc:mga0n895_127976_c1
526 nmdc:mga0n895_2341_c1
527 nmdc:mga0n895_376428_c1
528 nmdc:mga0rr50_13110_c1
529 nmdc:mga0rr50_190397_c1
530 nmdc:mga0rr50_5788_c1
531 nmdc:mga0rr50_8926_c1
532 nmdc:mga08x19_1160_c1
533 nmdc:mga08x19_213861_c1
534 nmdc:mga08x19_50361_c1
535 nmdc:mga0a205_11271_c1
536 nmdc:mga0a205_144415_c1
537 nmdc:mga0a205_167262_c1
538 nmdc:mga0a205_1734_c1
539 nmdc:mga0a205_1867_c1
540 nmdc:mga0a205_230384_c1
541 nmdc:mga0a205_303889_c1
542 nmdc:mga0a205_33841_c1
543 nmdc:mga0a205_92309_c1
544 Ga0501082_0075367

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04371

PAD_porph

Porphyromonas-type peptidyl-arginine deiminase

1

333

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xkn-assembly1.cif.gz_A crystal structure of the putative peptidyl-arginine deiminase from chlorobium tepidum, nesg target ctr21 0.9383 15 356
6b10-assembly1.cif.gz_A c. jejuni agmatine deiminase 0.9155 15 356
6b2w-assembly2.cif.gz_B c. jejuni c315s agmatine deiminase with substrate bound 0.9132 15 353
6nic-assembly1.cif.gz_B crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide 0.9109 16 356
6b10-assembly2.cif.gz_B c. jejuni agmatine deiminase 0.909 15 353
ID Description Score Start End Superfamily
1xknA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9355 15 356 3.75.10.10
1xknA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9091 15 356 3.75.10.10
6b10B00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.909 15 353 3.75.10.10
3hvmA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9029 16 353 3.75.10.10
3hvmA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8951 16 353 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A7Y4TJQ6-F1-model_v4 Agmatine deiminase family protein 0.9908 201 355 GO:0004668
GO:0009446
GO:0047632
AF-A0A355UHW5-F1-model_v4 Agmatine deiminase 0.9902 225 356 GO:0004668
GO:0009446
GO:0047632
AF-A0A2V6DB55-F1-model_v4 Agmatine deiminase 0.989 199 356 GO:0004668
GO:0009446
GO:0047632
AF-A0A7J5E782-F1-model_v4 Agmatine deiminase family protein 0.9877 172 355 GO:0004668
GO:0009446
GO:0047632
AF-A0A3C0AGC0-F1-model_v4 Agmatine deiminase 0.9874 226 356 GO:0004668
GO:0009446
GO:0047632

Map