F378167

General Info

Members Datasets Scaffolds Average Seq Length
272 186 544 274

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100210568|Ga0070667_1002105682
Length 317
Sequence MRANGLSATWLKRRRHSDWQASHLHDYFGRDSRETALPGTVTFQAAVVLMLWCAVRALTADAWATPLEPVEFESASQRLVSGRFIPGDRIQGYLAKPDGAGPFPAVVGLHGCAGMHDTTKQKLADELVARGYVLLLADSYATRRGMDHACTSSAFATFVRRRPDAYGALAFLAGQTFVDPQRVAVVGFSAGARVTLSVAEANSFEQFVPEGNLRFRAAAAFYPPCKQAVGRPNIPTLIFIGALDDWTPAADCSDKVASWGNDGPPVELVVYRGAHHGFYYRHLQPGMTLFDHWLEYNGEAADDASHRLHRFLDRHLN

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
106 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
107 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.03
Nodule 0
Rhizoplane 6.99
Rhizosphere 79.41
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100210568 3300005367 Bacteria 1727
2 JGI25406J46586_10000267 3300003203 Bacteria 23237
3 JGI25153J46596_10002946 3300003215 Bacteria 9633
4 rootH2_10178214 3300003320 Bacteria 3731
5 JGI25404J52841_10004784 3300003659 Bacteria 2770
6 Ga0070690_100314230 3300005330 Unclassified 1127
7 Ga0068869_100027415 3300005334 Bacteria 3972
8 Ga0070680_100009376 3300005336 Bacteria 7521
9 Ga0070680_100014792 3300005336 Bacteria 6102
10 Ga0070680_100056203 3300005336 Bacteria 3217
11 Ga0070691_10010368 3300005341 Unclassified 4251
12 Ga0070668_100219810 3300005347 Bacteria 1566
13 Ga0070668_100440468 3300005347 Bacteria 1118
14 Ga0070669_100128237 3300005353 Bacteria 1943
15 Ga0070714_100043955 3300005435 Bacteria 3781
16 Ga0070705_100001823 3300005440 Bacteria 11004
17 Ga0070700_100203626 3300005441 Bacteria 1392
18 Ga0070694_100010810 3300005444 Bacteria 5645
19 Ga0070708_100027246 3300005445 Unclassified 4902
20 Ga0070708_100317874 3300005445 Bacteria 1466
21 Ga0070663_100235965 3300005455 Unclassified 1442
22 Ga0070681_10000753 3300005458 Bacteria 26934
23 Ga0070681_10174827 3300005458 Bacteria 2069
24 Ga0070706_100226359 3300005467 Bacteria 1746
25 Ga0070706_100326117 3300005467 Bacteria 1432
26 Ga0070699_100011174 3300005518 Bacteria 7761
27 Ga0070679_100001999 3300005530 Bacteria 18310
28 Ga0070679_100024461 3300005530 Bacteria 5917
29 Ga0070679_100038116 3300005530 Unclassified 4778
30 Ga0070697_100009358 3300005536 Bacteria 7655
31 Ga0070697_100069340 3300005536 Bacteria 2888
32 Ga0068853_100232035 3300005539 Bacteria 1689
33 Ga0070695_100000898 3300005545 Bacteria 16062
34 Ga0070696_100002323 3300005546 Bacteria 12548
35 Ga0070693_100013729 3300005547 Bacteria 4134
36 Ga0070665_100016927 3300005548 Bacteria 7309
37 Ga0070704_100030720 3300005549 Unclassified 3602
38 Ga0068857_100037495 3300005577 Bacteria 4295
39 Ga0068856_100034770 3300005614 Bacteria 4937
40 Ga0070702_100042947 3300005615 Bacteria 2545
41 Ga0070702_100095866 3300005615 Bacteria 1809
42 Ga0068859_100012035 3300005617 Bacteria 8689
43 Ga0068859_100254807 3300005617 Bacteria 1845
44 Ga0068861_100207227 3300005719 Bacteria 1649
45 Ga0068863_100154243 3300005841 Bacteria 2199
46 Ga0068863_100301561 3300005841 Unclassified 1554
47 Ga0068858_100067158 3300005842 Bacteria 3321
48 Ga0068860_100008178 3300005843 Bacteria 10413
49 Ga0068860_100392484 3300005843 Bacteria 1371
50 Ga0068862_100022674 3300005844 Bacteria 5253
51 Ga0068862_100075570 3300005844 Bacteria 2914
52 Ga0081455_10000267 3300005937 Bacteria 68735
53 Ga0081455_10022878 3300005937 Bacteria 5828
54 Ga0081455_10032623 3300005937 Bacteria 4691
55 Ga0081455_10189387 3300005937 Bacteria 1551
56 Ga0081540_1000112 3300005983 Bacteria 86810
57 Ga0081540_1001530 3300005983 Bacteria 19855
58 Ga0081540_1006289 3300005983 Bacteria 8691
59 Ga0081540_1012734 3300005983 Bacteria 5513
60 Ga0081540_1026999 3300005983 Bacteria 3264
61 Ga0081540_1044256 3300005983 Bacteria 2275
62 Ga0081540_1046961 3300005983 Bacteria 2176
63 Ga0081540_1047011 3300005983 Bacteria 2174
64 Ga0081539_10000265 3300005985 Bacteria 120457
65 Ga0075365_10064080 3300006038 Bacteria 2461
66 Ga0075365_10065992 3300006038 Bacteria 2427
67 Ga0075363_100080589 3300006048 Bacteria 1780
68 Ga0075364_10012910 3300006051 Bacteria 5127
69 Ga0070715_10013044 3300006163 Bacteria 3042
70 Ga0070715_10040094 3300006163 Bacteria 1955
71 Ga0075367_10023961 3300006178 Bacteria 3439
72 Ga0075367_10051407 3300006178 Bacteria 2436
73 Ga0075367_10120571 3300006178 Bacteria 1616
74 Ga0075367_10196516 3300006178 Bacteria 1260
75 Ga0075369_10021648 3300006186 Bacteria 2644
76 Ga0075369_10076945 3300006186 Bacteria 1475
77 Ga0075366_10139958 3300006195 Bacteria 1463
78 Ga0097621_100325584 3300006237 Bacteria 1362
79 Ga0075370_10010748 3300006353 Bacteria 4797
80 Ga0075428_100084741 3300006844 Bacteria 3457
81 Ga0075430_100207379 3300006846 Bacteria 1626
82 Ga0075431_100001057 3300006847 Bacteria 24633
83 Ga0075433_10004540 3300006852 Bacteria 10827
84 Ga0075434_100063948 3300006871 Bacteria 3663
85 Ga0075434_100136663 3300006871 Bacteria 2470
86 Ga0075434_100262022 3300006871 Bacteria 1748
87 Ga0075434_100309600 3300006871 Bacteria 1600
88 Ga0075429_100049790 3300006880 Bacteria 3644
89 Ga0097620_100012036 3300006931 Bacteria 8689
90 Ga0097620_100254814 3300006931 Bacteria 1845
91 Ga0099795_10055294 3300007788 Bacteria 1457
92 Ga0105250_10074819 3300009092 Bacteria 1370
93 Ga0105240_10125559 3300009093 Bacteria 3084
94 Ga0111539_10001489 3300009094 Bacteria 31284
95 Ga0111539_10031874 3300009094 Bacteria 6403
96 Ga0111539_10197141 3300009094 Bacteria 2348
97 Ga0111539_10534684 3300009094 Bacteria 1366
98 Ga0105247_10077356 3300009101 Bacteria 2091
99 Ga0105247_10218841 3300009101 Unclassified 1288
100 Ga0114129_10000245 3300009147 Bacteria 61080
101 Ga0114129_10044353 3300009147 Bacteria 6256
102 Ga0114129_10694363 3300009147 Bacteria 1308
103 Ga0105241_10320880 3300009174 Unclassified 1336
104 Ga0105241_10350541 3300009174 Bacteria 1281
105 Ga0105248_10096873 3300009177 Bacteria 3323
106 Ga0105248_10583488 3300009177 Bacteria 1261
107 Ga0105238_10106315 3300009551 Bacteria 2788
108 Ga0105238_10245820 3300009551 Bacteria 1767
109 Ga0105238_10298628 3300009551 Bacteria 1594
110 Ga0105249_10026194 3300009553 Bacteria 5253
111 Ga0105249_10187963 3300009553 Bacteria 2014
112 Ga0105239_10024232 3300010375 Bacteria 6683
113 Ga0105246_10109220 3300011119 Bacteria 2029
114 Ga0157374_10087074 3300013296 Bacteria 2973
115 Ga0157378_10070958 3300013297 Bacteria 3127
116 Ga0163162_10695617 3300013306 Bacteria 1138
117 Ga0157375_10329889 3300013308 Bacteria 1691
118 Ga0157375_10596944 3300013308 Bacteria 1263
119 Ga0209758_1007439 3300025297 Bacteria 7451
120 Ga0207653_10001097 3300025885 Bacteria 8879
121 Ga0207685_10019191 3300025905 Bacteria 2249
122 Ga0207684_10048388 3300025910 Bacteria 3606
123 Ga0207654_10010857 3300025911 Bacteria 4636
124 Ga0207654_10108560 3300025911 Unclassified 1722
125 Ga0207707_10000315 3300025912 Bacteria 50982
126 Ga0207707_10009975 3300025912 Bacteria 8237
127 Ga0207695_10237152 3300025913 Bacteria 1726
128 Ga0207693_10468259 3300025915 Bacteria 984
129 Ga0207660_10009985 3300025917 Bacteria 6149
130 Ga0207652_10019073 3300025921 Bacteria 5634
131 Ga0207652_10019498 3300025921 Bacteria 5578
132 Ga0207652_10022192 3300025921 Bacteria 5247
133 Ga0207687_10180046 3300025927 Bacteria 1637
134 Ga0207664_10058716 3300025929 Bacteria 3061
135 Ga0207690_10306722 3300025932 Bacteria 1244
136 Ga0207711_10214591 3300025941 Bacteria 1758
137 Ga0207689_10003525 3300025942 Bacteria 14298
138 Ga0207689_10362656 3300025942 Bacteria 1205
139 Ga0207712_10002869 3300025961 Bacteria 11021
140 Ga0207712_10126609 3300025961 Bacteria 1940
141 Ga0207658_10490569 3300025986 Bacteria 1093
142 Ga0207703_10100572 3300026035 Bacteria 2450
143 Ga0207703_10357481 3300026035 Bacteria 1346
144 Ga0207703_10429707 3300026035 Bacteria 1230
145 Ga0207678_10003950 3300026067 Bacteria 13343
146 Ga0207678_10087043 3300026067 Bacteria 2670
147 Ga0207708_10048128 3300026075 Bacteria 3245
148 Ga0207708_10140483 3300026075 Bacteria 1894
149 Ga0207641_10184770 3300026088 Bacteria 1912
150 Ga0207674_10002113 3300026116 Bacteria 25122
151 Ga0207675_100312954 3300026118 Unclassified 1532
152 Ga0207675_100590905 3300026118 Bacteria 1112
153 Ga0207683_10020191 3300026121 Bacteria 5695
154 Ga0207698_10461689 3300026142 Bacteria 1228
155 Ga0209588_1008566 3300027671 Bacteria 3035
156 Ga0207428_10003207 3300027907 Bacteria 15988
157 Ga0268265_10000609 3300028380 Bacteria 35707
158 Ga0268265_10260850 3300028380 Bacteria 1540
159 Ga0268264_10002033 3300028381 Bacteria 18103
160 Ga0307508_10092700 3300031616 Bacteria 2610
161 Ga0307516_10011149 3300031730 Bacteria 9811
162 Ga0307406_10317419 3300031901 Bacteria 1204
163 Ga0373958_0058211 3300034819 Bacteria 831
164 Ga0373928_0029477 3300035084 Bacteria 1207
165 Ga0373949_0044339 3300035090 Bacteria 1103
166 Ga0373953_0004095 3300035117 Bacteria 4618
167 Ga0373954_0000611 3300035118 Bacteria 13614
168 Ga0373956_0001898 3300035119 Bacteria 8617
169 Ga0373957_0016189 3300035120 Bacteria 2578
170 Ga0373960_0086728 3300035121 Bacteria 995
171 Ga0373960_0089826 3300035121 Bacteria 980
172 Ga0373946_0167966 3300035171 Bacteria 1034
173 Ga0373955_0005153 3300035172 Bacteria 5845
174 Ga0373942_0037674 3300035207 Bacteria 1308
175 Ga0373961_0003669 3300035241 Bacteria 3762
176 Ga0373962_0009887 3300035242 Bacteria 2370
177 Ga0373962_0065837 3300035242 Bacteria 1073
178 Ga0373924_0149287 3300035410 Bacteria 1022
179 Ga0373931_0001367 3300035691 Bacteria 10427
180 Ga0373931_0006420 3300035691 Bacteria 5493
181 Ga0373927_0081302 3300035695 Bacteria 2100
182 Ga0373927_0122933 3300035695 Bacteria 1694
183 Ga0373927_0210683 3300035695 Bacteria 1276
184 Ga0373933_0004009 3300035724 Bacteria 8113
185 Ga0373937_0051786 3300036401 Bacteria 3762
186 Ga0373925_0126247 3300037068 Bacteria 1991
187 Ga0373925_0174189 3300037068 Bacteria 1700
188 Ga0439459_0026238 3300042438 Bacteria 1156
189 Ga0495592_0001347 3300046454 Bacteria 17006
190 Ga0495603_0047296 3300046455 Bacteria 2562
191 Ga0495590_0063069 3300046457 Bacteria 1297
192 Ga0495629_0000388 3300046459 Bacteria 36900
193 Ga0495651_0003758 3300046462 Bacteria 11612
194 Ga0495653_0017721 3300046463 Bacteria 5789
195 Ga0495664_0114989 3300046477 Bacteria 1626
196 Ga0495608_0011088 3300046511 Bacteria 6279
197 Ga0495628_0078946 3300046516 Bacteria 2559
198 Ga0495652_0002755 3300046529 Bacteria 17749
199 Ga0495640_0036898 3300046533 Bacteria 3450
200 Ga0495587_0005245 3300046536 Bacteria 8470
201 Ga0495597_0042264 3300046542 Bacteria 2033
202 Ga0495645_0013630 3300046543 Bacteria 5757
203 Ga0495667_0003989 3300046559 Bacteria 9910
204 Ga0495656_0064468 3300046615 Bacteria 1609
205 Ga0495668_0125499 3300046616 Bacteria 1405
206 Ga0495635_0000278 3300046663 Bacteria 32846
207 Ga0495657_0006316 3300046675 Bacteria 9287
208 Ga0495599_0001883 3300046678 Bacteria 12153
209 Ga0495623_0014126 3300046679 Bacteria 5172
210 Ga0495646_0106375 3300046680 Bacteria 1602
211 Ga0495613_0019077 3300046689 Bacteria 5112
212 Ga0495600_0010189 3300046809 Bacteria 5825
213 Ga0495604_0006228 3300047317 Bacteria 9468
214 Ga0495674_0055885 3300047319 Bacteria 3460
215 Ga0495680_0001213 3300047322 Bacteria 28254
216 Ga0495675_0010868 3300047444 Bacteria 5703
217 Ga0495684_0000161 3300047471 Bacteria 50269
218 Ga0495593_0000707 3300047673 Bacteria 19277
219 Ga0495602_0273162 3300048088 Bacteria 1248
220 Ga0496101_0085871 3300048904 Bacteria 2333
221 Ga0496101_0142557 3300048904 Bacteria 1827
222 Ga0496101_0332333 3300048904 Bacteria 1193
223 Ga0496102_0006055 3300048905 Bacteria 10308
224 Ga0496102_0127981 3300048905 Bacteria 2375
225 Ga0496102_0380306 3300048905 Bacteria 1329
226 Ga0496104_0201006 3300048907 Bacteria 1905
227 Ga0496106_0020493 3300048909 Bacteria 4907
228 Ga0496106_0194170 3300048909 Unclassified 1614
229 Ga0496107_0305935 3300048910 Bacteria 1183
230 Ga0496108_0380857 3300048911 Bacteria 1232
231 Ga0496109_0285925 3300048912 Unclassified 1554
232 Ga0496110_0220855 3300048913 Bacteria 1723
233 Ga0496110_0490933 3300048913 Bacteria 1118
234 Ga0496111_0014897 3300048914 Bacteria 5323
235 Ga0496112_0065505 3300048915 Bacteria 3585
236 Ga0496112_0189317 3300048915 Bacteria 2020
237 Ga0496113_0188506 3300048916 Bacteria 1637
238 Ga0496114_0040137 3300048917 Bacteria 3873
239 Ga0496118_0141877 3300048921 Bacteria 1521
240 Ga0496121_0039955 3300048924 Bacteria 4124
241 Ga0496125_0257143 3300048928 Bacteria 1097
242 Ga0496126_0028788 3300048929 Bacteria 5286
243 nmdc:mga03683_19601_c1 3300050489 Bacteria 2584
244 nmdc:mga03683_54496_c1 3300050489 Bacteria 1677
245 nmdc:mga00v17_109197_c1 3300050491 Bacteria 1753
246 nmdc:mga00v17_32972_c1 3300050491 Bacteria 3065
247 nmdc:mga00v17_59757_c1 3300050491 Bacteria 2340
248 nmdc:mga0yw44_20125_c1 3300050492 Bacteria 3697
249 nmdc:mga0yw44_2070_c1 3300050492 Bacteria 8375
250 nmdc:mga0yw44_38003_c1 3300050492 Bacteria 2846
251 nmdc:mga0yw44_94675_c1 3300050492 Bacteria 1893
252 nmdc:mga0k408_133361_c1 3300050493 Bacteria 1475
253 nmdc:mga06z11_1390_c1 3300050494 Bacteria 8980
254 nmdc:mga06z11_17238_c1 3300050494 Bacteria 3273
255 nmdc:mga06z11_57499_c1 3300050494 Bacteria 2015
256 nmdc:mga06z11_94535_c1 3300050494 Bacteria 1629
257 nmdc:mga05p37_267_c1 3300050507 Bacteria 54017
258 nmdc:mga09592_3180_c1 3300050508 Bacteria 13329
259 nmdc:mga0qj67_234682_c1 3300050509 Bacteria 1488
260 nmdc:mga0qj67_474956_c1 3300050509 Bacteria 1006
261 nmdc:mga06r32_816_c1 3300050510 Bacteria 27619
262 nmdc:mga0n895_104729_c1 3300050512 Bacteria 2841
263 nmdc:mga0n895_202554_c1 3300050512 Bacteria 2015
264 nmdc:mga0n895_3714_c1 3300050512 Bacteria 12346
265 nmdc:mga0n895_90351_c1 3300050512 Bacteria 3064
266 nmdc:mga0sz30_41871_c1 3300050516 Bacteria 1926
267 Ga0495601_0046809 3300053077 Bacteria 2723
268 Ga0495601_0156956 3300053077 Bacteria 1486
269 Ga0495601_0229505 3300053077 Bacteria 1212
270 Ga0495595_0002151 3300053084 Bacteria 7654
271 Ga0495619_0001354 3300053085 Bacteria 16078
272 Ga0500595_011840 3300053119 Bacteria 3395
273 Ga0070667_100210568
274 JGI25406J46586_10000267
275 JGI25153J46596_10002946
276 rootH2_10178214
277 JGI25404J52841_10004784
278 Ga0070690_100314230
279 Ga0068869_100027415
280 Ga0070680_100009376
281 Ga0070680_100014792
282 Ga0070680_100056203
283 Ga0070691_10010368
284 Ga0070668_100219810
285 Ga0070668_100440468
286 Ga0070669_100128237
287 Ga0070714_100043955
288 Ga0070705_100001823
289 Ga0070700_100203626
290 Ga0070694_100010810
291 Ga0070708_100027246
292 Ga0070708_100317874
293 Ga0070663_100235965
294 Ga0070681_10000753
295 Ga0070681_10174827
296 Ga0070706_100226359
297 Ga0070706_100326117
298 Ga0070699_100011174
299 Ga0070679_100001999
300 Ga0070679_100024461
301 Ga0070679_100038116
302 Ga0070697_100009358
303 Ga0070697_100069340
304 Ga0068853_100232035
305 Ga0070695_100000898
306 Ga0070696_100002323
307 Ga0070693_100013729
308 Ga0070665_100016927
309 Ga0070704_100030720
310 Ga0068857_100037495
311 Ga0068856_100034770
312 Ga0070702_100042947
313 Ga0070702_100095866
314 Ga0068859_100012035
315 Ga0068859_100254807
316 Ga0068861_100207227
317 Ga0068863_100154243
318 Ga0068863_100301561
319 Ga0068858_100067158
320 Ga0068860_100008178
321 Ga0068860_100392484
322 Ga0068862_100022674
323 Ga0068862_100075570
324 Ga0081455_10000267
325 Ga0081455_10022878
326 Ga0081455_10032623
327 Ga0081455_10189387
328 Ga0081540_1000112
329 Ga0081540_1001530
330 Ga0081540_1006289
331 Ga0081540_1012734
332 Ga0081540_1026999
333 Ga0081540_1044256
334 Ga0081540_1046961
335 Ga0081540_1047011
336 Ga0081539_10000265
337 Ga0075365_10064080
338 Ga0075365_10065992
339 Ga0075363_100080589
340 Ga0075364_10012910
341 Ga0070715_10013044
342 Ga0070715_10040094
343 Ga0075367_10023961
344 Ga0075367_10051407
345 Ga0075367_10120571
346 Ga0075367_10196516
347 Ga0075369_10021648
348 Ga0075369_10076945
349 Ga0075366_10139958
350 Ga0097621_100325584
351 Ga0075370_10010748
352 Ga0075428_100084741
353 Ga0075430_100207379
354 Ga0075431_100001057
355 Ga0075433_10004540
356 Ga0075434_100063948
357 Ga0075434_100136663
358 Ga0075434_100262022
359 Ga0075434_100309600
360 Ga0075429_100049790
361 Ga0097620_100012036
362 Ga0097620_100254814
363 Ga0099795_10055294
364 Ga0105250_10074819
365 Ga0105240_10125559
366 Ga0111539_10001489
367 Ga0111539_10031874
368 Ga0111539_10197141
369 Ga0111539_10534684
370 Ga0105247_10077356
371 Ga0105247_10218841
372 Ga0114129_10000245
373 Ga0114129_10044353
374 Ga0114129_10694363
375 Ga0105241_10320880
376 Ga0105241_10350541
377 Ga0105248_10096873
378 Ga0105248_10583488
379 Ga0105238_10106315
380 Ga0105238_10245820
381 Ga0105238_10298628
382 Ga0105249_10026194
383 Ga0105249_10187963
384 Ga0105239_10024232
385 Ga0105246_10109220
386 Ga0157374_10087074
387 Ga0157378_10070958
388 Ga0163162_10695617
389 Ga0157375_10329889
390 Ga0157375_10596944
391 Ga0209758_1007439
392 Ga0207653_10001097
393 Ga0207685_10019191
394 Ga0207684_10048388
395 Ga0207654_10010857
396 Ga0207654_10108560
397 Ga0207707_10000315
398 Ga0207707_10009975
399 Ga0207695_10237152
400 Ga0207693_10468259
401 Ga0207660_10009985
402 Ga0207652_10019073
403 Ga0207652_10019498
404 Ga0207652_10022192
405 Ga0207687_10180046
406 Ga0207664_10058716
407 Ga0207690_10306722
408 Ga0207711_10214591
409 Ga0207689_10003525
410 Ga0207689_10362656
411 Ga0207712_10002869
412 Ga0207712_10126609
413 Ga0207658_10490569
414 Ga0207703_10100572
415 Ga0207703_10357481
416 Ga0207703_10429707
417 Ga0207678_10003950
418 Ga0207678_10087043
419 Ga0207708_10048128
420 Ga0207708_10140483
421 Ga0207641_10184770
422 Ga0207674_10002113
423 Ga0207675_100312954
424 Ga0207675_100590905
425 Ga0207683_10020191
426 Ga0207698_10461689
427 Ga0209588_1008566
428 Ga0207428_10003207
429 Ga0268265_10000609
430 Ga0268265_10260850
431 Ga0268264_10002033
432 Ga0307508_10092700
433 Ga0307516_10011149
434 Ga0307406_10317419
435 Ga0373958_0058211
436 Ga0373928_0029477
437 Ga0373949_0044339
438 Ga0373953_0004095
439 Ga0373954_0000611
440 Ga0373956_0001898
441 Ga0373957_0016189
442 Ga0373960_0086728
443 Ga0373960_0089826
444 Ga0373946_0167966
445 Ga0373955_0005153
446 Ga0373942_0037674
447 Ga0373961_0003669
448 Ga0373962_0009887
449 Ga0373962_0065837
450 Ga0373924_0149287
451 Ga0373931_0001367
452 Ga0373931_0006420
453 Ga0373927_0081302
454 Ga0373927_0122933
455 Ga0373927_0210683
456 Ga0373933_0004009
457 Ga0373937_0051786
458 Ga0373925_0126247
459 Ga0373925_0174189
460 Ga0439459_0026238
461 Ga0495592_0001347
462 Ga0495603_0047296
463 Ga0495590_0063069
464 Ga0495629_0000388
465 Ga0495651_0003758
466 Ga0495653_0017721
467 Ga0495664_0114989
468 Ga0495608_0011088
469 Ga0495628_0078946
470 Ga0495652_0002755
471 Ga0495640_0036898
472 Ga0495587_0005245
473 Ga0495597_0042264
474 Ga0495645_0013630
475 Ga0495667_0003989
476 Ga0495656_0064468
477 Ga0495668_0125499
478 Ga0495635_0000278
479 Ga0495657_0006316
480 Ga0495599_0001883
481 Ga0495623_0014126
482 Ga0495646_0106375
483 Ga0495613_0019077
484 Ga0495600_0010189
485 Ga0495604_0006228
486 Ga0495674_0055885
487 Ga0495680_0001213
488 Ga0495675_0010868
489 Ga0495684_0000161
490 Ga0495593_0000707
491 Ga0495602_0273162
492 Ga0496101_0085871
493 Ga0496101_0142557
494 Ga0496101_0332333
495 Ga0496102_0006055
496 Ga0496102_0127981
497 Ga0496102_0380306
498 Ga0496104_0201006
499 Ga0496106_0020493
500 Ga0496106_0194170
501 Ga0496107_0305935
502 Ga0496108_0380857
503 Ga0496109_0285925
504 Ga0496110_0220855
505 Ga0496110_0490933
506 Ga0496111_0014897
507 Ga0496112_0065505
508 Ga0496112_0189317
509 Ga0496113_0188506
510 Ga0496114_0040137
511 Ga0496118_0141877
512 Ga0496121_0039955
513 Ga0496125_0257143
514 Ga0496126_0028788
515 nmdc:mga03683_19601_c1
516 nmdc:mga03683_54496_c1
517 nmdc:mga00v17_109197_c1
518 nmdc:mga00v17_32972_c1
519 nmdc:mga00v17_59757_c1
520 nmdc:mga0yw44_20125_c1
521 nmdc:mga0yw44_2070_c1
522 nmdc:mga0yw44_38003_c1
523 nmdc:mga0yw44_94675_c1
524 nmdc:mga0k408_133361_c1
525 nmdc:mga06z11_1390_c1
526 nmdc:mga06z11_17238_c1
527 nmdc:mga06z11_57499_c1
528 nmdc:mga06z11_94535_c1
529 nmdc:mga05p37_267_c1
530 nmdc:mga09592_3180_c1
531 nmdc:mga0qj67_234682_c1
532 nmdc:mga0qj67_474956_c1
533 nmdc:mga06r32_816_c1
534 nmdc:mga0n895_104729_c1
535 nmdc:mga0n895_202554_c1
536 nmdc:mga0n895_3714_c1
537 nmdc:mga0n895_90351_c1
538 nmdc:mga0sz30_41871_c1
539 Ga0495601_0046809
540 Ga0495601_0156956
541 Ga0495601_0229505
542 Ga0495595_0002151
543 Ga0495619_0001354
544 Ga0500595_011840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

90

316

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e3j-assembly1.cif.gz_A the crystal structure of epoxide hydrolase b (rv1938) from mycobacterium tuberculosis at 2.1 angstrom 0.7812 47 181
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.781 28 274
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.7798 25 274
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.7785 28 274
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.7703 26 274
ID Description Score Start End Superfamily
af_A0A0P0Y160_2_157_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7861 114 271 3.40.50.1820
2i3dA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7832 26 273 3.40.50.1820
af_B4FY74_55_262_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7789 48 272 3.40.50.1820
af_B4FY74_55_262_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7694 48 272 3.40.50.1820
af_O86353_1_230_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7688 32 274 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A508SYX7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9652 20 274 GO:0052689
AF-A0A526PT02-F1-model_v4 Dienelactone hydrolase family protein 0.9328 48 273 GO:0052689
AF-J6DWI6-F1-model_v4 Lipase 0.9291 68 274 GO:0052689
AF-A0A560LZG8-F1-model_v4 Dienelactone hydrolase family protein 0.9237 121 273 GO:0016787
AF-A0A442T0Z5-F1-model_v4 Dienelactone hydrolase family protein 0.9225 24 274 GO:0052689

Map