F378166

General Info

Members Datasets Scaffolds Average Seq Length
272 159 544 224

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100630665|Ga0070659_1006306651
Length 261
Sequence MTLAPLLTAFVLAATPASFVQAHAQDGAFSEPGGVAGASLTSWAVLGLRAVGQPAPGSLAYLQSQEPSLETSNDVALAALAEEALGARPTALLQRLVVHPNGQIGESLNSTFWGVLALGRASPATTRFILAQQSKAGGFAWYLHGQPDSNDTAAALEALRVAHVTGAPVTRAVHFLRTFQNRDGGFELTHGRGSDAQSTAWAIQGFAAAKVRPPRSAFAYLARLKRPDGSYRYSARYVTTPVWVTSQVLAALAKKPFPLAP

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
64 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.13
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100630665 3300005366 Bacteria 923
2 Ga0070658_10243162 3300005327 Archaea 1525
3 Ga0070683_100151770 3300005329 Bacteria 2196
4 Ga0070680_100009570 3300005336 Bacteria 7446
5 Ga0070680_100520102 3300005336 Bacteria 1019
6 Ga0070660_100025126 3300005339 Bacteria 4426
7 Ga0070660_100128731 3300005339 Bacteria 2024
8 Ga0070660_100189298 3300005339 Bacteria 1666
9 Ga0070661_100241668 3300005344 Bacteria 1391
10 Ga0070671_100230488 3300005355 Bacteria 1572
11 Ga0070674_100194147 3300005356 Bacteria 1563
12 Ga0070659_100151676 3300005366 Bacteria 1891
13 Ga0070659_100384935 3300005366 Bacteria 1182
14 Ga0070714_100059162 3300005435 Bacteria 3284
15 Ga0070714_100203227 3300005435 Bacteria 1813
16 Ga0070714_100351419 3300005435 Bacteria 1385
17 Ga0070710_10347425 3300005437 Unclassified 981
18 Ga0070711_100060771 3300005439 Bacteria 2628
19 Ga0070708_100228898 3300005445 Bacteria 1744
20 Ga0070678_100725425 3300005456 Bacteria 897
21 Ga0070681_10005127 3300005458 Bacteria 12643
22 Ga0070681_10006682 3300005458 Bacteria 11223
23 Ga0070681_10070819 3300005458 Bacteria 3451
24 Ga0070681_10106874 3300005458 Bacteria 2740
25 Ga0070681_10178307 3300005458 Bacteria 2046
26 Ga0070681_10226867 3300005458 Bacteria 1782
27 Ga0070706_100036174 3300005467 Bacteria 4559
28 Ga0070707_100351343 3300005468 Bacteria 1432
29 Ga0070699_100178331 3300005518 Bacteria 1885
30 Ga0070679_100003250 3300005530 Bacteria 14854
31 Ga0070679_100012049 3300005530 Bacteria 8254
32 Ga0070679_100166805 3300005530 Bacteria 2175
33 Ga0070679_100168885 3300005530 Bacteria 2160
34 Ga0070679_100482668 3300005530 Bacteria 1184
35 Ga0070684_100014824 3300005535 Bacteria 6325
36 Ga0068853_100244493 3300005539 Bacteria 1645
37 Ga0070693_100448087 3300005547 Bacteria 905
38 Ga0068855_100056992 3300005563 Bacteria 4581
39 Ga0068855_100208824 3300005563 Bacteria 2195
40 Ga0068855_100501528 3300005563 Bacteria 1319
41 Ga0068855_100538231 3300005563 Bacteria 1266
42 Ga0068857_100043209 3300005577 Bacteria 3998
43 Ga0068852_100189133 3300005616 Bacteria 1941
44 Ga0081540_1016257 3300005983 Bacteria 4666
45 Ga0070717_10138202 3300006028 Unclassified 2100
46 Ga0075433_10124895 3300006852 Bacteria 2285
47 Ga0075435_100036843 3300007076 Bacteria 3890
48 Ga0105240_10115612 3300009093 Bacteria 3239
49 Ga0105240_10524108 3300009093 Bacteria 1315
50 Ga0105240_10892619 3300009093 Bacteria 957
51 Ga0105247_10390369 3300009101 Unclassified 989
52 Ga0105241_10263154 3300009174 Bacteria 1466
53 Ga0105242_10324929 3300009176 Bacteria 1412
54 Ga0105237_10119090 3300009545 Bacteria 2634
55 Ga0105238_10012377 3300009551 Bacteria 8603
56 Ga0105238_10198010 3300009551 Bacteria 1984
57 Ga0105239_10449622 3300010375 Bacteria 1461
58 Ga0157373_10043278 3300013100 Bacteria 3217
59 Ga0157370_10062066 3300013104 Bacteria 3545
60 Ga0157370_10073717 3300013104 Bacteria 3221
61 Ga0157370_10213695 3300013104 Bacteria 1787
62 Ga0157370_10444374 3300013104 Bacteria 1192
63 Ga0157369_10024935 3300013105 Bacteria 6645
64 Ga0157369_10041689 3300013105 Bacteria 5010
65 Ga0157369_10156501 3300013105 Bacteria 2407
66 Ga0157372_10039191 3300013307 Bacteria 5230
67 Ga0157372_10231392 3300013307 Bacteria 2143
68 Ga0157372_10256743 3300013307 Bacteria 2029
69 Ga0157375_10480650 3300013308 Unclassified 1407
70 Ga0182008_10054948 3300014497 Bacteria 1969
71 Ga0157376_10104027 3300014969 Bacteria 2487
72 Ga0206356_11529938 3300020070 Bacteria 2513
73 Ga0206353_10337700 3300020082 Bacteria 1701
74 Ga0206353_11370306 3300020082 Bacteria 2217
75 Ga0207705_10110933 3300025909 Unclassified 2027
76 Ga0207707_10093077 3300025912 Bacteria 2633
77 Ga0207707_10146472 3300025912 Archaea 2064
78 Ga0207695_10063172 3300025913 Bacteria 3818
79 Ga0207693_10140942 3300025915 Bacteria 1896
80 Ga0207693_10189492 3300025915 Unclassified 1619
81 Ga0207660_10226991 3300025917 Bacteria 1467
82 Ga0207657_10006283 3300025919 Bacteria 12348
83 Ga0207657_10008139 3300025919 Bacteria 10688
84 Ga0207652_10083372 3300025921 Bacteria 2799
85 Ga0207652_10099878 3300025921 Bacteria 2561
86 Ga0207664_10103648 3300025929 Bacteria 2354
87 Ga0207690_10178668 3300025932 Bacteria 1596
88 Ga0207686_10064700 3300025934 Bacteria 2329
89 Ga0207661_10397331 3300025944 Bacteria 1250
90 Ga0207667_10067725 3300025949 Bacteria 3719
91 Ga0207667_10346557 3300025949 Bacteria 1515
92 Ga0207667_10635065 3300025949 Unclassified 1074
93 Ga0207639_10071244 3300026041 Bacteria 2718
94 Ga0207639_10184894 3300026041 Bacteria 1776
95 Ga0207702_10079259 3300026078 Unclassified 2846
96 Ga0207674_10058344 3300026116 Bacteria 3911
97 Ga0207674_10142604 3300026116 Bacteria 2355
98 Ga0207683_10099732 3300026121 Bacteria 2592
99 Ga0207698_10160980 3300026142 Bacteria 1963
100 Ga0207698_10202567 3300026142 Bacteria 1778
101 Ga0265334_10008725 3300028573 Bacteria 4305
102 Ga0265323_10060181 3300028653 Unclassified 1323
103 Ga0265322_10005332 3300028654 Bacteria 3806
104 Ga0265338_10020687 3300028800 Bacteria 6905
105 Ga0265325_10032023 3300031241 Bacteria 2810
106 Ga0265329_10004165 3300031242 Bacteria 6098
107 Ga0265340_10051644 3300031247 Unclassified 1990
108 Ga0265339_10035685 3300031249 Bacteria 2788
109 Ga0265327_10005590 3300031251 Bacteria 10420
110 Ga0265316_10004495 3300031344 Bacteria 13858
111 Ga0265313_10008326 3300031595 Bacteria 6909
112 Ga0265314_10012061 3300031711 Bacteria 7082
113 Ga0265342_10014332 3300031712 Bacteria 5267
114 Ga0307412_10092762 3300031911 Unclassified 2117
115 Ga0373955_0256066 3300035172 Unclassified 1050
116 Ga0373933_0152165 3300035724 Unclassified 1466
117 Ga0395899_0050459 3300037312 Bacteria 3089
118 Ga0395899_0234481 3300037312 Bacteria 1266
119 Ga0395900_0010816 3300037418 Bacteria 9336
120 Ga0395898_0033607 3300037466 Bacteria 5116
121 Ga0395898_0054139 3300037466 Bacteria 3916
122 Ga0395905_0156368 3300037471 Bacteria 2144
123 Ga0395901_0002250 3300038443 Bacteria 19691
124 Ga0395901_0004380 3300038443 Bacteria 14244
125 Ga0395901_0641922 3300038443 Unclassified 1066
126 Ga0436365_0676868 3300039437 Bacteria 1078
127 Ga0466965_0218593 3300044683 Bacteria 1015
128 Ga0466966_0197185 3300044684 Bacteria 1219
129 Ga0466961_0020753 3300044693 Bacteria 4228
130 Ga0466961_0043460 3300044693 Bacteria 2878
131 Ga0466961_0229421 3300044693 Unclassified 1143
132 Ga0466963_0008716 3300044694 Bacteria 6089
133 Ga0466963_0012728 3300044694 Bacteria 5153
134 Ga0466963_0028719 3300044694 Bacteria 3574
135 Ga0466963_0030242 3300044694 Bacteria 3493
136 Ga0466963_0055197 3300044694 Bacteria 2641
137 Ga0466963_0349502 3300044694 Bacteria 1041
138 Ga0466964_0008530 3300044706 Bacteria 3853
139 Ga0466971_0009114 3300044719 Bacteria 4338
140 Ga0466971_0117019 3300044719 Bacteria 1232
141 Ga0466968_0001909 3300044735 Bacteria 7541
142 Ga0466970_0014251 3300044765 Bacteria 4079
143 Ga0466970_0033391 3300044765 Bacteria 2720
144 Ga0466957_0006792 3300044842 Bacteria 6466
145 Ga0466957_0048480 3300044842 Unclassified 2582
146 Ga0466957_0060105 3300044842 Bacteria 2330
147 Ga0466957_0293958 3300044842 Bacteria 1090
148 Ga0466959_0002815 3300045049 Bacteria 11204
149 Ga0466959_0066717 3300045049 Bacteria 2610
150 Ga0466959_0131292 3300045049 Bacteria 1775
151 Ga0466959_0203333 3300045049 Bacteria 1378
152 Ga0466958_0019631 3300045836 Bacteria 3934
153 Ga0466958_0025618 3300045836 Bacteria 3479
154 Ga0466958_0206206 3300045836 Bacteria 1252
155 Ga0466967_0000894 3300045976 Bacteria 15939
156 Ga0466967_0026596 3300045976 Bacteria 4795
157 Ga0466967_0027456 3300045976 Bacteria 4735
158 Ga0466967_0034342 3300045976 Bacteria 4303
159 Ga0466967_0037089 3300045976 Bacteria 4168
160 Ga0466967_0042372 3300045976 Bacteria 3933
161 Ga0466967_0046268 3300045976 Bacteria 3787
162 Ga0466967_0050912 3300045976 Bacteria 3627
163 Ga0466967_0061824 3300045976 Bacteria 3323
164 Ga0466967_0091393 3300045976 Bacteria 2766
165 Ga0466967_0143362 3300045976 Bacteria 2227
166 Ga0466967_0162916 3300045976 Bacteria 2094
167 Ga0466967_0202749 3300045976 Bacteria 1879
168 Ga0466967_0226867 3300045976 Bacteria 1777
169 Ga0466967_0613484 3300045976 Bacteria 1074
170 Ga0495592_0028548 3300046454 Bacteria 4226
171 Ga0495592_0040899 3300046454 Bacteria 3477
172 Ga0495629_0038078 3300046459 Bacteria 3389
173 Ga0495641_0117917 3300046461 Unclassified 1184
174 Ga0495651_0008166 3300046462 Bacteria 8028
175 Ga0495651_0027001 3300046462 Bacteria 4470
176 Ga0495651_0083725 3300046462 Bacteria 2404
177 Ga0495653_0020896 3300046463 Bacteria 5304
178 Ga0495653_0029504 3300046463 Bacteria 4378
179 Ga0495653_0030515 3300046463 Bacteria 4293
180 Ga0495639_0077473 3300046475 Archaea 1543
181 Ga0495664_0103270 3300046477 Bacteria 1718
182 Ga0495594_0109275 3300046499 Archaea 1559
183 Ga0495608_0006676 3300046511 Bacteria 8184
184 Ga0495628_0036981 3300046516 Bacteria 3915
185 Ga0495630_0138561 3300046517 Unclassified 1849
186 Ga0495666_0132852 3300046526 Bacteria 1163
187 Ga0495652_0103527 3300046529 Bacteria 2304
188 Ga0495652_0110301 3300046529 Bacteria 2213
189 Ga0495665_0102585 3300046531 Bacteria 1501
190 Ga0495640_0019305 3300046533 Bacteria 5035
191 Ga0495640_0091226 3300046533 Bacteria 2010
192 Ga0495640_0113953 3300046533 Unclassified 1763
193 Ga0495587_0208501 3300046536 Bacteria 1104
194 Ga0495645_0015766 3300046543 Bacteria 5380
195 Ga0495667_0025172 3300046559 Bacteria 4012
196 Ga0495667_0030683 3300046559 Bacteria 3611
197 Ga0495667_0058450 3300046559 Bacteria 2533
198 Ga0495634_0006819 3300046642 Bacteria 8642
199 Ga0495634_0020020 3300046642 Bacteria 4748
200 Ga0495635_0025049 3300046663 Bacteria 4157
201 Ga0495657_0030688 3300046675 Bacteria 3761
202 Ga0495657_0040384 3300046675 Bacteria 3201
203 Ga0495599_0042676 3300046678 Bacteria 2846
204 Ga0495599_0323434 3300046678 Bacteria 928
205 Ga0495623_0202488 3300046679 Unclassified 1140
206 Ga0495646_0182313 3300046680 Bacteria 1152
207 Ga0495613_0178930 3300046689 Bacteria 1502
208 Ga0495600_0114031 3300046809 Bacteria 1760
209 Ga0495600_0126409 3300046809 Bacteria 1663
210 Ga0495674_0021900 3300047319 Bacteria 5903
211 Ga0495674_0036762 3300047319 Bacteria 4405
212 Ga0495674_0039652 3300047319 Bacteria 4220
213 Ga0495680_0008692 3300047322 Bacteria 9209
214 Ga0495680_0019117 3300047322 Bacteria 5797
215 Ga0495675_0046941 3300047444 Unclassified 2749
216 Ga0495675_0140410 3300047444 Unclassified 1498
217 Ga0495602_0069185 3300048088 Unclassified 3027
218 Ga0495602_0361004 3300048088 Bacteria 1046
219 Ga0495614_0038642 3300048089 Unclassified 2048
220 Ga0496100_0022326 3300048903 Bacteria 3829
221 Ga0496100_0228472 3300048903 Bacteria 1368
222 Ga0496101_0005535 3300048904 Bacteria 8061
223 Ga0496101_0101566 3300048904 Bacteria 2153
224 Ga0496101_0151261 3300048904 Unclassified 1775
225 Ga0496102_0001373 3300048905 Bacteria 21702
226 Ga0496102_0049555 3300048905 Bacteria 3821
227 Ga0496102_0078903 3300048905 Bacteria 3031
228 Ga0496102_0662693 3300048905 Unclassified 967
229 Ga0496103_0113759 3300048906 Bacteria 1720
230 Ga0496104_0004609 3300048907 Bacteria 12011
231 Ga0496104_0037594 3300048907 Bacteria 4527
232 Ga0496104_0390753 3300048907 Bacteria 1303
233 Ga0496105_0000466 3300048908 Bacteria 26582
234 Ga0496105_0034126 3300048908 Bacteria 4183
235 Ga0496105_0107857 3300048908 Bacteria 2299
236 Ga0496106_0001707 3300048909 Bacteria 16398
237 Ga0496106_0035841 3300048909 Bacteria 3710
238 Ga0496107_0024756 3300048910 Bacteria 4247
239 Ga0496109_0000847 3300048912 Bacteria 25593
240 Ga0496109_0019999 3300048912 Bacteria 5911
241 Ga0496109_0472287 3300048912 Bacteria 1184
242 Ga0496109_0509205 3300048912 Bacteria 1136
243 Ga0496110_0068383 3300048913 Bacteria 3144
244 Ga0496110_0208885 3300048913 Bacteria 1775
245 Ga0496111_0261455 3300048914 Bacteria 1284
246 Ga0496112_0096040 3300048915 Bacteria 2934
247 Ga0496113_0078302 3300048916 Bacteria 2529
248 Ga0496113_0521562 3300048916 Bacteria 954
249 Ga0496114_0003258 3300048917 Bacteria 12460
250 Ga0496114_0084452 3300048917 Bacteria 2688
251 Ga0496115_0005347 3300048918 Bacteria 9341
252 Ga0496115_0010644 3300048918 Bacteria 6879
253 Ga0501043_0274427 3300049579 Bacteria 1294
254 Ga0501047_0020552 3300049581 Bacteria 6339
255 Ga0501067_0011520 3300049583 Bacteria 4899
256 Ga0501069_0024258 3300049585 Bacteria 3307
257 Ga0501069_0092048 3300049585 Bacteria 1715
258 Ga0501070_0051051 3300049586 Bacteria 3433
259 Ga0501073_0105887 3300049589 Bacteria 1952
260 Ga0501074_0135919 3300049590 Bacteria 1758
261 Ga0501080_0042940 3300049742 Bacteria 4209
262 Ga0501035_0449807 3300049822 Bacteria 1066
263 nmdc:mga05p37_268460_c1 3300050507 Bacteria 2039
264 nmdc:mga0n895_118929_c1 3300050512 Bacteria 2663
265 nmdc:mga0rr50_31977_c1 3300050513 Bacteria 3743
266 nmdc:mga0a205_52461_c1 3300050515 Bacteria 3935
267 Ga0495601_0015155 3300053077 Bacteria 4658
268 Ga0495612_0041621 3300053078 Bacteria 1874
269 Ga0495595_0064014 3300053084 Unclassified 1727
270 Ga0495595_0103973 3300053084 Bacteria 1372
271 Ga0495619_0004924 3300053085 Bacteria 8478
272 Ga0466962_0003055 3300061719 Bacteria 7975
273 Ga0070659_100630665
274 Ga0070658_10243162
275 Ga0070683_100151770
276 Ga0070680_100009570
277 Ga0070680_100520102
278 Ga0070660_100025126
279 Ga0070660_100128731
280 Ga0070660_100189298
281 Ga0070661_100241668
282 Ga0070671_100230488
283 Ga0070674_100194147
284 Ga0070659_100151676
285 Ga0070659_100384935
286 Ga0070714_100059162
287 Ga0070714_100203227
288 Ga0070714_100351419
289 Ga0070710_10347425
290 Ga0070711_100060771
291 Ga0070708_100228898
292 Ga0070678_100725425
293 Ga0070681_10005127
294 Ga0070681_10006682
295 Ga0070681_10070819
296 Ga0070681_10106874
297 Ga0070681_10178307
298 Ga0070681_10226867
299 Ga0070706_100036174
300 Ga0070707_100351343
301 Ga0070699_100178331
302 Ga0070679_100003250
303 Ga0070679_100012049
304 Ga0070679_100166805
305 Ga0070679_100168885
306 Ga0070679_100482668
307 Ga0070684_100014824
308 Ga0068853_100244493
309 Ga0070693_100448087
310 Ga0068855_100056992
311 Ga0068855_100208824
312 Ga0068855_100501528
313 Ga0068855_100538231
314 Ga0068857_100043209
315 Ga0068852_100189133
316 Ga0081540_1016257
317 Ga0070717_10138202
318 Ga0075433_10124895
319 Ga0075435_100036843
320 Ga0105240_10115612
321 Ga0105240_10524108
322 Ga0105240_10892619
323 Ga0105247_10390369
324 Ga0105241_10263154
325 Ga0105242_10324929
326 Ga0105237_10119090
327 Ga0105238_10012377
328 Ga0105238_10198010
329 Ga0105239_10449622
330 Ga0157373_10043278
331 Ga0157370_10062066
332 Ga0157370_10073717
333 Ga0157370_10213695
334 Ga0157370_10444374
335 Ga0157369_10024935
336 Ga0157369_10041689
337 Ga0157369_10156501
338 Ga0157372_10039191
339 Ga0157372_10231392
340 Ga0157372_10256743
341 Ga0157375_10480650
342 Ga0182008_10054948
343 Ga0157376_10104027
344 Ga0206356_11529938
345 Ga0206353_10337700
346 Ga0206353_11370306
347 Ga0207705_10110933
348 Ga0207707_10093077
349 Ga0207707_10146472
350 Ga0207695_10063172
351 Ga0207693_10140942
352 Ga0207693_10189492
353 Ga0207660_10226991
354 Ga0207657_10006283
355 Ga0207657_10008139
356 Ga0207652_10083372
357 Ga0207652_10099878
358 Ga0207664_10103648
359 Ga0207690_10178668
360 Ga0207686_10064700
361 Ga0207661_10397331
362 Ga0207667_10067725
363 Ga0207667_10346557
364 Ga0207667_10635065
365 Ga0207639_10071244
366 Ga0207639_10184894
367 Ga0207702_10079259
368 Ga0207674_10058344
369 Ga0207674_10142604
370 Ga0207683_10099732
371 Ga0207698_10160980
372 Ga0207698_10202567
373 Ga0265334_10008725
374 Ga0265323_10060181
375 Ga0265322_10005332
376 Ga0265338_10020687
377 Ga0265325_10032023
378 Ga0265329_10004165
379 Ga0265340_10051644
380 Ga0265339_10035685
381 Ga0265327_10005590
382 Ga0265316_10004495
383 Ga0265313_10008326
384 Ga0265314_10012061
385 Ga0265342_10014332
386 Ga0307412_10092762
387 Ga0373955_0256066
388 Ga0373933_0152165
389 Ga0395899_0050459
390 Ga0395899_0234481
391 Ga0395900_0010816
392 Ga0395898_0033607
393 Ga0395898_0054139
394 Ga0395905_0156368
395 Ga0395901_0002250
396 Ga0395901_0004380
397 Ga0395901_0641922
398 Ga0436365_0676868
399 Ga0466965_0218593
400 Ga0466966_0197185
401 Ga0466961_0020753
402 Ga0466961_0043460
403 Ga0466961_0229421
404 Ga0466963_0008716
405 Ga0466963_0012728
406 Ga0466963_0028719
407 Ga0466963_0030242
408 Ga0466963_0055197
409 Ga0466963_0349502
410 Ga0466964_0008530
411 Ga0466971_0009114
412 Ga0466971_0117019
413 Ga0466968_0001909
414 Ga0466970_0014251
415 Ga0466970_0033391
416 Ga0466957_0006792
417 Ga0466957_0048480
418 Ga0466957_0060105
419 Ga0466957_0293958
420 Ga0466959_0002815
421 Ga0466959_0066717
422 Ga0466959_0131292
423 Ga0466959_0203333
424 Ga0466958_0019631
425 Ga0466958_0025618
426 Ga0466958_0206206
427 Ga0466967_0000894
428 Ga0466967_0026596
429 Ga0466967_0027456
430 Ga0466967_0034342
431 Ga0466967_0037089
432 Ga0466967_0042372
433 Ga0466967_0046268
434 Ga0466967_0050912
435 Ga0466967_0061824
436 Ga0466967_0091393
437 Ga0466967_0143362
438 Ga0466967_0162916
439 Ga0466967_0202749
440 Ga0466967_0226867
441 Ga0466967_0613484
442 Ga0495592_0028548
443 Ga0495592_0040899
444 Ga0495629_0038078
445 Ga0495641_0117917
446 Ga0495651_0008166
447 Ga0495651_0027001
448 Ga0495651_0083725
449 Ga0495653_0020896
450 Ga0495653_0029504
451 Ga0495653_0030515
452 Ga0495639_0077473
453 Ga0495664_0103270
454 Ga0495594_0109275
455 Ga0495608_0006676
456 Ga0495628_0036981
457 Ga0495630_0138561
458 Ga0495666_0132852
459 Ga0495652_0103527
460 Ga0495652_0110301
461 Ga0495665_0102585
462 Ga0495640_0019305
463 Ga0495640_0091226
464 Ga0495640_0113953
465 Ga0495587_0208501
466 Ga0495645_0015766
467 Ga0495667_0025172
468 Ga0495667_0030683
469 Ga0495667_0058450
470 Ga0495634_0006819
471 Ga0495634_0020020
472 Ga0495635_0025049
473 Ga0495657_0030688
474 Ga0495657_0040384
475 Ga0495599_0042676
476 Ga0495599_0323434
477 Ga0495623_0202488
478 Ga0495646_0182313
479 Ga0495613_0178930
480 Ga0495600_0114031
481 Ga0495600_0126409
482 Ga0495674_0021900
483 Ga0495674_0036762
484 Ga0495674_0039652
485 Ga0495680_0008692
486 Ga0495680_0019117
487 Ga0495675_0046941
488 Ga0495675_0140410
489 Ga0495602_0069185
490 Ga0495602_0361004
491 Ga0495614_0038642
492 Ga0496100_0022326
493 Ga0496100_0228472
494 Ga0496101_0005535
495 Ga0496101_0101566
496 Ga0496101_0151261
497 Ga0496102_0001373
498 Ga0496102_0049555
499 Ga0496102_0078903
500 Ga0496102_0662693
501 Ga0496103_0113759
502 Ga0496104_0004609
503 Ga0496104_0037594
504 Ga0496104_0390753
505 Ga0496105_0000466
506 Ga0496105_0034126
507 Ga0496105_0107857
508 Ga0496106_0001707
509 Ga0496106_0035841
510 Ga0496107_0024756
511 Ga0496109_0000847
512 Ga0496109_0019999
513 Ga0496109_0472287
514 Ga0496109_0509205
515 Ga0496110_0068383
516 Ga0496110_0208885
517 Ga0496111_0261455
518 Ga0496112_0096040
519 Ga0496113_0078302
520 Ga0496113_0521562
521 Ga0496114_0003258
522 Ga0496114_0084452
523 Ga0496115_0005347
524 Ga0496115_0010644
525 Ga0501043_0274427
526 Ga0501047_0020552
527 Ga0501067_0011520
528 Ga0501069_0024258
529 Ga0501069_0092048
530 Ga0501070_0051051
531 Ga0501073_0105887
532 Ga0501074_0135919
533 Ga0501080_0042940
534 Ga0501035_0449807
535 nmdc:mga05p37_268460_c1
536 nmdc:mga0n895_118929_c1
537 nmdc:mga0rr50_31977_c1
538 nmdc:mga0a205_52461_c1
539 Ga0495601_0015155
540 Ga0495612_0041621
541 Ga0495595_0064014
542 Ga0495595_0103973
543 Ga0495619_0004924
544 Ga0466962_0003055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dsu-assembly1.cif.gz_B crystal structure of rabggtase(delta lrr; delta ig)in complex with farnesyl pyrophosphate 0.7632 17 160
3dss-assembly1.cif.gz_B crystal structure of rabggtase(delta lrr; delta ig) 0.7621 17 160
6j7x-assembly1.cif.gz_B complex of ggtaseiii, farnesyl-ykt6, and ggpp 0.7494 17 161
3hxf-assembly1.cif.gz_B engineered rabggtase in complex with a peptidomimetic inhibitor (compound 32) 0.721 17 161
6vpt-assembly1.cif.gz_A crystal structure and mechanistic molecular modeling studies of rv3377c: the mycobacterium tuberculosis diterpene cyclase 0.7179 17 178
ID Description Score Start End Superfamily
af_Q55D85_80_363_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9232 125 175 1.50.10.20
af_K7KEK9_8_267_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8546 125 172 1.50.10.20
af_A0A0R0J895_119_414_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8508 125 172 1.50.10.20
1gszB02 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8352 127 174 1.50.10.20
af_A0A1D6IZQ3_1_202_1.50.10.160 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7467 126 180 1.50.10.160
ID Description Score Start End GO Terms
AF-A0A453RGG6-F1-model_v4 Squalene cyclase N-terminal domain-containing protein 0.9232 126 172 GO:0005811
GO:0016104
GO:0016866
AF-A0A446XBB3-F1-model_v4 deleted 0.898 126 172
AF-A0A444X1S8-F1-model_v4 Squalene cyclase N-terminal domain-containing protein 0.8906 126 179 GO:0005811
GO:0016104
GO:0031559
AF-A0A4R5C6P0-F1-model_v4 Squalene cyclase C-terminal domain-containing protein 0.8786 125 185
AF-A0A7W1N2B7-F1-model_v4 Terpene cyclase/mutase family protein 0.848 15 214 GO:0003824

Map