F377929
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 271 | 199 | 248 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300048919|Ga0496116_0000174|Ga0496116_0000174_119788_120756 |
| Length | 322 |
| Sequence | MATLSPLTPDVAQGRLKPAVGSSRSWPRAALARLAPLAWLGPALVLIGVVVVWPVVVMVQSSFQHIGGEGFVAGYNGTHNYQHLFREPDFVSVLVRTVLWVVAVVVVTMLLALGLAQLFHQRFPGRRVARWALIVPWAASVMMTALIFRWALDPNNGVINLFLHQIGVVKKLGSHQAYWLGEPSHALVWMMAVAVFVSLPFTTYAILSGLQGIPDDVYEAASIDGSTGLSSYLHITLPLLRPAIIVATLINVINVFNSFPIIWEMTRGGPGYQTSTSTIYMVDLKQGNVGESAAMSVINFGLVILIVVIYLSTTRWKEQVDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 3 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 4 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 5 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 6 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 7 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 8 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 9 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 10 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 11 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 12 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 13 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 14 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 15 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 16 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 17 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 18 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 19 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 20 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 94 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 95 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 98 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 104 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 105 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 110 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 114 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 116 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 117 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 118 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 119 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 120 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 121 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 171 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 172 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 173 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 174 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 175 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 176 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 177 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 178 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 192 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 194 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 195 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 196 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 197 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 198 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 199 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.51 |
| Metatranscriptomes | 0 |
| Isolates | 8.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 3.69 |
| Nodule | 1.85 |
| Rhizoplane | 6.27 |
| Rhizosphere | 71.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055542_1010041 | 3300003762 | Bacteria | 1752 |
| 2 | Ga0070658_10004626 | 3300005327 | Bacteria | 11186 |
| 3 | Ga0070658_10135771 | 3300005327 | Bacteria | 2052 |
| 4 | Ga0070658_10238006 | 3300005327 | Bacteria | 1542 |
| 5 | Ga0070683_100042945 | 3300005329 | Bacteria | 4164 |
| 6 | Ga0070660_100118401 | 3300005339 | Bacteria | 2112 |
| 7 | Ga0070660_100171652 | 3300005339 | Bacteria | 1752 |
| 8 | Ga0070692_10047695 | 3300005345 | Bacteria | 2217 |
| 9 | Ga0070659_100124931 | 3300005366 | Bacteria | 2087 |
| 10 | Ga0070667_100099302 | 3300005367 | Bacteria | 2513 |
| 11 | Ga0070714_100126486 | 3300005435 | Bacteria | 2279 |
| 12 | Ga0070663_100035400 | 3300005455 | Bacteria | 3465 |
| 13 | Ga0070681_10060752 | 3300005458 | Bacteria | 3755 |
| 14 | Ga0070685_10016459 | 3300005466 | Bacteria | 3940 |
| 15 | Ga0068853_100039962 | 3300005539 | Bacteria | 4001 |
| 16 | Ga0068853_100442198 | 3300005539 | Bacteria | 1222 |
| 17 | Ga0070672_100408823 | 3300005543 | Bacteria | 1164 |
| 18 | Ga0068855_100005744 | 3300005563 | Bacteria | 15151 |
| 19 | Ga0068855_100066043 | 3300005563 | Bacteria | 4217 |
| 20 | Ga0068855_100115930 | 3300005563 | Bacteria | 3070 |
| 21 | Ga0070664_100291609 | 3300005564 | Bacteria | 1473 |
| 22 | Ga0068857_100006574 | 3300005577 | Bacteria | 9979 |
| 23 | Ga0068857_100074199 | 3300005577 | Bacteria | 3032 |
| 24 | Ga0068856_100217343 | 3300005614 | Bacteria | 1926 |
| 25 | Ga0068859_100005984 | 3300005617 | Bacteria | 12354 |
| 26 | Ga0068859_100084609 | 3300005617 | Bacteria | 3217 |
| 27 | Ga0068851_10000015 | 3300005834 | Bacteria | 145191 |
| 28 | Ga0068863_100010491 | 3300005841 | Bacteria | 9004 |
| 29 | Ga0068858_100000023 | 3300005842 | Bacteria | 167824 |
| 30 | Ga0075364_10078040 | 3300006051 | Bacteria | 2187 |
| 31 | Ga0070712_100116904 | 3300006175 | Bacteria | 2000 |
| 32 | Ga0097620_100005984 | 3300006931 | Bacteria | 12354 |
| 33 | Ga0097620_100084608 | 3300006931 | Bacteria | 3217 |
| 34 | Ga0105244_10017930 | 3300009036 | Bacteria | 3986 |
| 35 | Ga0105244_10031039 | 3300009036 | Bacteria | 2838 |
| 36 | Ga0105240_10860605 | 3300009093 | Bacteria | 978 |
| 37 | Ga0105245_10207480 | 3300009098 | Bacteria | 1884 |
| 38 | Ga0105245_10234964 | 3300009098 | Bacteria | 1775 |
| 39 | Ga0105243_10014346 | 3300009148 | Bacteria | 5997 |
| 40 | Ga0105241_10052488 | 3300009174 | Bacteria | 3113 |
| 41 | Ga0105248_10001200 | 3300009177 | Bacteria | 28950 |
| 42 | Ga0105248_10001838 | 3300009177 | Bacteria | 23503 |
| 43 | Ga0105237_10004762 | 3300009545 | Bacteria | 15602 |
| 44 | Ga0105237_10316573 | 3300009545 | Bacteria | 1564 |
| 45 | Ga0105238_10000648 | 3300009551 | Bacteria | 36594 |
| 46 | Ga0105239_10451593 | 3300010375 | Bacteria | 1458 |
| 47 | Ga0157370_10196982 | 3300013104 | Bacteria | 1869 |
| 48 | Ga0157370_10430102 | 3300013104 | Bacteria | 1214 |
| 49 | Ga0157369_10246507 | 3300013105 | Bacteria | 1865 |
| 50 | Ga0163162_10054191 | 3300013306 | Bacteria | 4034 |
| 51 | Ga0163162_10310326 | 3300013306 | Bacteria | 1710 |
| 52 | Ga0157372_10477349 | 3300013307 | Bacteria | 1454 |
| 53 | Ga0157375_10518358 | 3300013308 | Bacteria | 1355 |
| 54 | Ga0163163_10106431 | 3300014325 | Bacteria | 2831 |
| 55 | Ga0157380_10339387 | 3300014326 | Bacteria | 1401 |
| 56 | Ga0157379_10045393 | 3300014968 | Bacteria | 3921 |
| 57 | Ga0209148_1000836 | 3300025254 | Bacteria | 21976 |
| 58 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 59 | Ga0207655_1002019 | 3300025728 | Bacteria | 17179 |
| 60 | Ga0207655_1058078 | 3300025728 | Bacteria | 1515 |
| 61 | Ga0207647_10016136 | 3300025904 | Bacteria | 5103 |
| 62 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 63 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 64 | Ga0207707_10001735 | 3300025912 | Bacteria | 20037 |
| 65 | Ga0207695_10010909 | 3300025913 | Bacteria | 11053 |
| 66 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 67 | Ga0207671_10101624 | 3300025914 | Bacteria | 2178 |
| 68 | Ga0207693_10123118 | 3300025915 | Bacteria | 2037 |
| 69 | Ga0207660_10022477 | 3300025917 | Bacteria | 4249 |
| 70 | Ga0207657_10018615 | 3300025919 | Bacteria | 6620 |
| 71 | Ga0207657_10120233 | 3300025919 | Bacteria | 2161 |
| 72 | Ga0207649_10231902 | 3300025920 | Bacteria | 1320 |
| 73 | Ga0207694_10000052 | 3300025924 | Bacteria | 157700 |
| 74 | Ga0207687_10247106 | 3300025927 | Bacteria | 1416 |
| 75 | Ga0207664_10172741 | 3300025929 | Bacteria | 1851 |
| 76 | Ga0207644_10184765 | 3300025931 | Bacteria | 1636 |
| 77 | Ga0207690_10008705 | 3300025932 | Bacteria | 6021 |
| 78 | Ga0207709_10007509 | 3300025935 | Bacteria | 6067 |
| 79 | Ga0207691_10311578 | 3300025940 | Bacteria | 1351 |
| 80 | Ga0207711_10000139 | 3300025941 | Bacteria | 77476 |
| 81 | Ga0207711_10009069 | 3300025941 | Bacteria | 8311 |
| 82 | Ga0207679_10024107 | 3300025945 | Bacteria | 4168 |
| 83 | Ga0207667_10004379 | 3300025949 | Bacteria | 17290 |
| 84 | Ga0207667_10086754 | 3300025949 | Bacteria | 3238 |
| 85 | Ga0207667_10316071 | 3300025949 | Bacteria | 1595 |
| 86 | Ga0207658_10104650 | 3300025986 | Bacteria | 2224 |
| 87 | Ga0207703_10000137 | 3300026035 | Bacteria | 89265 |
| 88 | Ga0207703_10094702 | 3300026035 | Bacteria | 2518 |
| 89 | Ga0207639_10029799 | 3300026041 | Bacteria | 3999 |
| 90 | Ga0207678_10000719 | 3300026067 | Bacteria | 30220 |
| 91 | Ga0207678_10011109 | 3300026067 | Bacteria | 7911 |
| 92 | Ga0207678_10018690 | 3300026067 | Bacteria | 6085 |
| 93 | Ga0207678_10055441 | 3300026067 | Bacteria | 3414 |
| 94 | Ga0207702_10080080 | 3300026078 | Bacteria | 2833 |
| 95 | Ga0207702_10371095 | 3300026078 | Bacteria | 1374 |
| 96 | Ga0207702_10462796 | 3300026078 | Bacteria | 1232 |
| 97 | Ga0207641_10041403 | 3300026088 | Bacteria | 3860 |
| 98 | Ga0207674_10006779 | 3300026116 | Bacteria | 13438 |
| 99 | Ga0207674_10122573 | 3300026116 | Bacteria | 2566 |
| 100 | Ga0207698_10012110 | 3300026142 | Bacteria | 5628 |
| 101 | Ga0207698_10016794 | 3300026142 | Bacteria | 4946 |
| 102 | Ga0265337_1000242 | 3300028556 | Bacteria | 29618 |
| 103 | Ga0265326_10002656 | 3300028558 | Bacteria | 5984 |
| 104 | Ga0265319_1004717 | 3300028563 | Bacteria | 6683 |
| 105 | Ga0265334_10002605 | 3300028573 | Bacteria | 8407 |
| 106 | Ga0265318_10012366 | 3300028577 | Bacteria | 3638 |
| 107 | Ga0265336_10006029 | 3300028666 | Bacteria | 4409 |
| 108 | Ga0265338_10001399 | 3300028800 | Bacteria | 39290 |
| 109 | Ga0265338_10002348 | 3300028800 | Bacteria | 28565 |
| 110 | Ga0265324_10003045 | 3300029957 | Bacteria | 8187 |
| 111 | Ga0265332_10001033 | 3300031238 | Bacteria | 16399 |
| 112 | Ga0265320_10001145 | 3300031240 | Bacteria | 19503 |
| 113 | Ga0265325_10126879 | 3300031241 | Bacteria | 1225 |
| 114 | Ga0307509_10001165 | 3300031507 | Bacteria | 44960 |
| 115 | Ga0265313_10015334 | 3300031595 | Bacteria | 4470 |
| 116 | Ga0307514_10002337 | 3300031649 | Bacteria | 19911 |
| 117 | Ga0265314_10047231 | 3300031711 | Bacteria | 3031 |
| 118 | Ga0307406_10023596 | 3300031901 | Bacteria | 3663 |
| 119 | Ga0307412_10270793 | 3300031911 | Bacteria | 1329 |
| 120 | Ga0373933_0137042 | 3300035724 | Bacteria | 1543 |
| 121 | Ga0373925_0002919 | 3300037068 | Bacteria | 13482 |
| 122 | Ga0395898_0285536 | 3300037466 | Bacteria | 1574 |
| 123 | Ga0439465_0059853 | 3300041413 | Bacteria | 1261 |
| 124 | Ga0451789_0405646 | 3300041443 | Bacteria | 1637 |
| 125 | Ga0451793_0960293 | 3300041452 | Bacteria | 1635 |
| 126 | Ga0451793_1423462 | 3300041452 | Bacteria | 2537 |
| 127 | Ga0466972_0059308 | 3300044658 | Bacteria | 1837 |
| 128 | Ga0466965_0000010 | 3300044683 | Bacteria | 112032 |
| 129 | Ga0466966_0004509 | 3300044684 | Bacteria | 9186 |
| 130 | Ga0466961_0003676 | 3300044693 | Bacteria | 9566 |
| 131 | Ga0466971_0003747 | 3300044719 | Bacteria | 6508 |
| 132 | Ga0466970_0006527 | 3300044765 | Bacteria | 5831 |
| 133 | Ga0466967_0650841 | 3300045976 | Bacteria | 1042 |
| 134 | Ga0495651_0021873 | 3300046462 | Bacteria | 4972 |
| 135 | Ga0495651_0203290 | 3300046462 | Bacteria | 1385 |
| 136 | Ga0495653_0008311 | 3300046463 | Bacteria | 8506 |
| 137 | Ga0495580_0014571 | 3300046472 | Bacteria | 5961 |
| 138 | Ga0495662_0003540 | 3300046476 | Bacteria | 7890 |
| 139 | Ga0495664_0044315 | 3300046477 | Bacteria | 2636 |
| 140 | Ga0495608_0064902 | 3300046511 | Bacteria | 2392 |
| 141 | Ga0495620_0005591 | 3300046515 | Bacteria | 7000 |
| 142 | Ga0495628_0010956 | 3300046516 | Bacteria | 7679 |
| 143 | Ga0495628_0060547 | 3300046516 | Bacteria | 2970 |
| 144 | Ga0495643_0020189 | 3300046522 | Bacteria | 3846 |
| 145 | Ga0495648_0041618 | 3300046524 | Bacteria | 2899 |
| 146 | Ga0495666_0025436 | 3300046526 | Bacteria | 2922 |
| 147 | Ga0495640_0020654 | 3300046533 | Bacteria | 4844 |
| 148 | Ga0495586_0004068 | 3300046535 | Bacteria | 7838 |
| 149 | Ga0495587_0012024 | 3300046536 | Bacteria | 5466 |
| 150 | Ga0495597_0061283 | 3300046542 | Bacteria | 1639 |
| 151 | Ga0495645_0033213 | 3300046543 | Bacteria | 3764 |
| 152 | Ga0495645_0067192 | 3300046543 | Bacteria | 2589 |
| 153 | Ga0495622_0016357 | 3300046557 | Bacteria | 3453 |
| 154 | Ga0495667_0009816 | 3300046559 | Bacteria | 6483 |
| 155 | Ga0495668_0021497 | 3300046616 | Bacteria | 3698 |
| 156 | Ga0495634_0064625 | 3300046642 | Bacteria | 2425 |
| 157 | Ga0495625_0027159 | 3300046660 | Bacteria | 4314 |
| 158 | Ga0495635_0092621 | 3300046663 | Bacteria | 2066 |
| 159 | Ga0495657_0100513 | 3300046675 | Bacteria | 1843 |
| 160 | Ga0495623_0201450 | 3300046679 | Bacteria | 1144 |
| 161 | Ga0495646_0013202 | 3300046680 | Bacteria | 5248 |
| 162 | Ga0495613_0002952 | 3300046689 | Bacteria | 12720 |
| 163 | Ga0495613_0007787 | 3300046689 | Bacteria | 7971 |
| 164 | Ga0495589_0006285 | 3300046794 | Bacteria | 6272 |
| 165 | Ga0495660_0045849 | 3300046810 | Bacteria | 2398 |
| 166 | Ga0495581_0046750 | 3300047315 | Bacteria | 2501 |
| 167 | Ga0495604_0005758 | 3300047317 | Bacteria | 9828 |
| 168 | Ga0495604_0041513 | 3300047317 | Bacteria | 3608 |
| 169 | Ga0495674_0010990 | 3300047319 | Bacteria | 8553 |
| 170 | Ga0495676_0007470 | 3300047321 | Bacteria | 10022 |
| 171 | Ga0495680_0027216 | 3300047322 | Bacteria | 4701 |
| 172 | Ga0495683_0065405 | 3300047323 | Bacteria | 1793 |
| 173 | Ga0495685_007805 | 3300047447 | Bacteria | 3539 |
| 174 | Ga0495684_0155108 | 3300047471 | Bacteria | 1710 |
| 175 | Ga0495684_0325137 | 3300047471 | Bacteria | 1098 |
| 176 | Ga0495602_0246834 | 3300048088 | Bacteria | 1332 |
| 177 | Ga0495626_0016714 | 3300048091 | Bacteria | 3721 |
| 178 | Ga0496100_0120952 | 3300048903 | Bacteria | 1831 |
| 179 | Ga0496101_0023867 | 3300048904 | Bacteria | 4228 |
| 180 | Ga0496102_0035923 | 3300048905 | Bacteria | 4463 |
| 181 | Ga0496104_0007696 | 3300048907 | Bacteria | 9537 |
| 182 | Ga0496104_0332226 | 3300048907 | Bacteria | 1433 |
| 183 | Ga0496105_0105967 | 3300048908 | Bacteria | 2320 |
| 184 | Ga0496107_0005670 | 3300048910 | Bacteria | 8543 |
| 185 | Ga0496110_0294821 | 3300048913 | Bacteria | 1477 |
| 186 | Ga0496112_0010387 | 3300048915 | Bacteria | 8442 |
| 187 | Ga0496114_0018085 | 3300048917 | Bacteria | 5695 |
| 188 | Ga0496114_0044361 | 3300048917 | Bacteria | 3688 |
| 189 | Ga0496115_0018536 | 3300048918 | Bacteria | 5346 |
| 190 | Ga0496115_0019837 | 3300048918 | Bacteria | 5180 |
| 191 | Ga0496115_0134742 | 3300048918 | Bacteria | 2036 |
| 192 | Ga0496116_0000174 | 3300048919 | Bacteria | 129255 |
| 193 | Ga0496116_0115561 | 3300048919 | Bacteria | 1565 |
| 194 | Ga0496117_0000069 | 3300048920 | Bacteria | 246025 |
| 195 | Ga0496117_0014779 | 3300048920 | Bacteria | 6700 |
| 196 | Ga0496117_0027801 | 3300048920 | Bacteria | 4395 |
| 197 | Ga0496117_0038438 | 3300048920 | Bacteria | 3548 |
| 198 | Ga0496118_0005564 | 3300048921 | Bacteria | 14270 |
| 199 | Ga0496118_0033118 | 3300048921 | Bacteria | 4246 |
| 200 | Ga0496118_0052113 | 3300048921 | Bacteria | 3125 |
| 201 | Ga0496118_0081948 | 3300048921 | Bacteria | 2263 |
| 202 | Ga0496119_0004878 | 3300048922 | Bacteria | 13135 |
| 203 | Ga0496119_0006264 | 3300048922 | Bacteria | 11102 |
| 204 | Ga0496119_0008975 | 3300048922 | Bacteria | 8680 |
| 205 | Ga0496119_0012414 | 3300048922 | Bacteria | 6921 |
| 206 | Ga0496119_0012964 | 3300048922 | Bacteria | 6701 |
| 207 | Ga0496119_0022720 | 3300048922 | Bacteria | 4479 |
| 208 | Ga0496120_0000326 | 3300048923 | Bacteria | 79061 |
| 209 | Ga0496120_0001833 | 3300048923 | Bacteria | 23715 |
| 210 | Ga0496120_0002495 | 3300048923 | Bacteria | 18485 |
| 211 | Ga0496120_0100001 | 3300048923 | Bacteria | 1534 |
| 212 | Ga0496121_0000380 | 3300048924 | Bacteria | 90959 |
| 213 | Ga0496122_0000208 | 3300048925 | Bacteria | 131175 |
| 214 | Ga0496122_0001562 | 3300048925 | Bacteria | 36221 |
| 215 | Ga0496122_0005303 | 3300048925 | Bacteria | 15427 |
| 216 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 217 | Ga0496123_0009079 | 3300048926 | Bacteria | 9004 |
| 218 | Ga0496123_0063407 | 3300048926 | Bacteria | 2361 |
| 219 | Ga0496124_0040921 | 3300048927 | Bacteria | 4003 |
| 220 | Ga0496125_0006174 | 3300048928 | Bacteria | 13056 |
| 221 | Ga0496125_0050710 | 3300048928 | Bacteria | 3432 |
| 222 | Ga0496126_0003925 | 3300048929 | Bacteria | 18219 |
| 223 | Ga0496126_0004908 | 3300048929 | Bacteria | 15620 |
| 224 | Ga0496126_0026278 | 3300048929 | Bacteria | 5584 |
| 225 | Ga0496126_0469849 | 3300048929 | Bacteria | 1009 |
| 226 | Ga0501033_0222129 | 3300049570 | Bacteria | 1344 |
| 227 | Ga0501034_0075567 | 3300049571 | Bacteria | 3376 |
| 228 | Ga0501034_0198194 | 3300049571 | Bacteria | 1967 |
| 229 | Ga0501034_0219239 | 3300049571 | Bacteria | 1855 |
| 230 | Ga0501036_0077421 | 3300049572 | Bacteria | 2814 |
| 231 | Ga0501036_0200167 | 3300049572 | Bacteria | 1680 |
| 232 | Ga0501038_0097031 | 3300049574 | Bacteria | 2459 |
| 233 | Ga0501043_0098757 | 3300049579 | Bacteria | 2295 |
| 234 | Ga0501047_0079571 | 3300049581 | Bacteria | 3151 |
| 235 | Ga0501035_0059493 | 3300049822 | Bacteria | 3402 |
| 236 | Ga0501035_0163506 | 3300049822 | Bacteria | 1926 |
| 237 | Ga0501044_0238607 | 3300049823 | Bacteria | 1762 |
| 238 | Ga0501044_0262689 | 3300049823 | Bacteria | 1664 |
| 239 | Ga0501044_0457803 | 3300049823 | Bacteria | 1181 |
| 240 | Ga0495601_0156504 | 3300053077 | Bacteria | 1488 |
| 241 | Ga0500635_0029814 | 3300053080 | Bacteria | 1754 |
| 242 | Ga0500564_054889 | 3300053138 | Bacteria | 1817 |
| 243 | Ga0500573_0000024 | 3300053140 | Bacteria | 151713 |
| 244 | Ga0500573_0000154 | 3300053140 | Bacteria | 27843 |
| 245 | Ga0500603_001723 | 3300053150 | Bacteria | 4923 |
| 246 | Ga0500616_0001756 | 3300053153 | Bacteria | 19850 |
| 247 | Ga0500616_0160287 | 3300053153 | Bacteria | 1032 |
| 248 | Ga0466962_0003071 | 3300061719 | Bacteria | 7955 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10001200 | Ga0105248_1000120024 | 260 |
| 2 | 3300025941 | Ga0207711_10000139 | Ga0207711_100001394 | 260 |
| 3 | 3300048920 | Ga0496117_0027801 | Ga0496117_0027801_2027_2914 | 262 |
| 4 | 3300048921 | Ga0496118_0005564 | Ga0496118_0005564_1550_2437 | 262 |
| 5 | 3300053153 | Ga0500616_0160287 | Ga0500616_0160287_56_943 | 273 |
| 6 | 3300009093 | Ga0105240_10860605 | Ga0105240_108606051 | 279 |
| 7 | 3300009098 | Ga0105245_10234964 | Ga0105245_102349642 | 279 |
| 8 | 3300009177 | Ga0105248_10001838 | Ga0105248_100018383 | 279 |
| 9 | 3300009545 | Ga0105237_10004762 | Ga0105237_100047622 | 279 |
| 10 | 3300009545 | Ga0105237_10316573 | Ga0105237_103165732 | 279 |
| 11 | 3300009551 | Ga0105238_10000648 | Ga0105238_100006489 | 279 |
| 12 | 3300013105 | Ga0157369_10246507 | Ga0157369_102465072 | 279 |
| 13 | 3300014968 | Ga0157379_10045393 | Ga0157379_100453933 | 279 |
| 14 | 3300025929 | Ga0207664_10172741 | Ga0207664_101727412 | 279 |
| 15 | 3300028556 | Ga0265337_1000242 | Ga0265337_100024226 | 279 |
| 16 | 3300028558 | Ga0265326_10002656 | Ga0265326_100026564 | 279 |
| 17 | 3300028563 | Ga0265319_1004717 | Ga0265319_10047174 | 279 |
| 18 | 3300028573 | Ga0265334_10002605 | Ga0265334_100026054 | 279 |
| 19 | 3300028577 | Ga0265318_10012366 | Ga0265318_100123661 | 279 |
| 20 | 3300028666 | Ga0265336_10006029 | Ga0265336_100060293 | 279 |
| 21 | 3300028800 | Ga0265338_10001399 | Ga0265338_100013994 | 279 |
| 22 | 3300029957 | Ga0265324_10003045 | Ga0265324_100030455 | 279 |
| 23 | 3300031238 | Ga0265332_10001033 | Ga0265332_100010334 | 279 |
| 24 | 3300031240 | Ga0265320_10001145 | Ga0265320_1000114516 | 279 |
| 25 | 3300031241 | Ga0265325_10126879 | Ga0265325_101268792 | 279 |
| 26 | 3300031595 | Ga0265313_10015334 | Ga0265313_100153344 | 279 |
| 27 | 3300031711 | Ga0265314_10047231 | Ga0265314_100472313 | 279 |
| 28 | 3300048929 | Ga0496126_0469849 | Ga0496126_0469849_63_902 | 279 |
| 29 | 3300035724 | Ga0373933_0137042 | Ga0373933_0137042_519_1484 | 280 |
| 30 | 3300041443 | Ga0451789_0405646 | Ga0451789_0405646_707_1603 | 280 |
| 31 | iso_pu_bacteria | 2687453737 | 2689962057 | 280 |
| 32 | iso_pu_bacteria | 2508501039 | 2508677832 | 283 |
| 33 | iso_pu_bacteria | 2675902999 | 2676204097 | 283 |
| 34 | iso_pu_bacteria | 2773857921 | 2774848673 | 283 |
| 35 | 3300006175 | Ga0070712_100116904 | Ga0070712_1001169042 | 284 |
| 36 | 3300025915 | Ga0207693_10123118 | Ga0207693_101231182 | 284 |
| 37 | 3300046543 | Ga0495645_0067192 | Ga0495645_0067192_1171_2058 | 285 |
| 38 | 3300049570 | Ga0501033_0222129 | Ga0501033_0222129_13_870 | 285 |
| 39 | 3300049823 | Ga0501044_0457803 | Ga0501044_0457803_261_1118 | 285 |
| 40 | 3300013308 | Ga0157375_10518358 | Ga0157375_105183582 | 287 |
| 41 | 3300041413 | Ga0439465_0059853 | Ga0439465_0059853_385_1248 | 287 |
| 42 | 3300025931 | Ga0207644_10184765 | Ga0207644_101847652 | 289 |
| 43 | 3300005435 | Ga0070714_100126486 | Ga0070714_1001264862 | 291 |
| 44 | 3300009036 | Ga0105244_10031039 | Ga0105244_100310392 | 291 |
| 45 | 3300025728 | Ga0207655_1058078 | Ga0207655_10580782 | 291 |
| 46 | 3300048922 | Ga0496119_0008975 | Ga0496119_0008975_7004_7981 | 291 |
| 47 | 3300048923 | Ga0496120_0002495 | Ga0496120_0002495_6844_7821 | 291 |
| 48 | 3300049823 | Ga0501044_0238607 | Ga0501044_0238607_28_936 | 291 |
| 49 | 3300005366 | Ga0070659_100124931 | Ga0070659_1001249312 | 292 |
| 50 | 3300005455 | Ga0070663_100035400 | Ga0070663_1000354002 | 292 |
| 51 | 3300013306 | Ga0163162_10054191 | Ga0163162_100541914 | 292 |
| 52 | 3300013306 | Ga0163162_10310326 | Ga0163162_103103261 | 292 |
| 53 | 3300013307 | Ga0157372_10477349 | Ga0157372_104773492 | 292 |
| 54 | 3300025945 | Ga0207679_10024107 | Ga0207679_100241073 | 292 |
| 55 | 3300026067 | Ga0207678_10018690 | Ga0207678_100186903 | 292 |
| 56 | 3300031507 | Ga0307509_10001165 | Ga0307509_100011656 | 292 |
| 57 | 3300044658 | Ga0466972_0059308 | Ga0466972_0059308_16_918 | 292 |
| 58 | 3300044684 | Ga0466966_0004509 | Ga0466966_0004509_5404_6381 | 292 |
| 59 | 3300044693 | Ga0466961_0003676 | Ga0466961_0003676_5517_6494 | 292 |
| 60 | 3300044719 | Ga0466971_0003747 | Ga0466971_0003747_2921_3898 | 292 |
| 61 | 3300048918 | Ga0496115_0018536 | Ga0496115_0018536_546_1475 | 292 |
| 62 | 3300048919 | Ga0496116_0115561 | Ga0496116_0115561_606_1538 | 292 |
| 63 | 3300048924 | Ga0496121_0000380 | Ga0496121_0000380_40204_41124 | 292 |
| 64 | 3300048925 | Ga0496122_0005303 | Ga0496122_0005303_8703_9629 | 292 |
| 65 | 3300048926 | Ga0496123_0063407 | Ga0496123_0063407_1367_2293 | 292 |
| 66 | 3300049571 | Ga0501034_0198194 | Ga0501034_0198194_74_973 | 292 |
| 67 | 3300053138 | Ga0500564_054889 | Ga0500564_054889_722_1621 | 292 |
| 68 | 3300053150 | Ga0500603_001723 | Ga0500603_001723_3338_4237 | 292 |
| 69 | 3300061719 | Ga0466962_0003071 | Ga0466962_0003071_3991_4968 | 292 |
| 70 | 3300005617 | Ga0068859_100005984 | Ga0068859_10000598410 | 294 |
| 71 | 3300005841 | Ga0068863_100010491 | Ga0068863_1000104912 | 294 |
| 72 | 3300006931 | Ga0097620_100005984 | Ga0097620_10000598410 | 294 |
| 73 | 3300026035 | Ga0207703_10094702 | Ga0207703_100947022 | 294 |
| 74 | 3300026088 | Ga0207641_10041403 | Ga0207641_100414033 | 294 |
| 75 | 3300048921 | Ga0496118_0081948 | Ga0496118_0081948_971_1951 | 294 |
| 76 | iso_pu_bacteria | 8002784119 | 8002791722 | 296 |
| 77 | 3300048919 | Ga0496116_0000174 | Ga0496116_0000174_119788_120756 | 297 |
| 78 | 3300048920 | Ga0496117_0014779 | Ga0496117_0014779_1411_2379 | 297 |
| 79 | 3300048921 | Ga0496118_0052113 | Ga0496118_0052113_595_1563 | 297 |
| 80 | 3300048922 | Ga0496119_0006264 | Ga0496119_0006264_8557_9525 | 297 |
| 81 | 3300048923 | Ga0496120_0100001 | Ga0496120_0100001_44_1012 | 297 |
| 82 | iso_pu_bacteria | 2767802112 | 2768643893 | 297 |
| 83 | 3300026067 | Ga0207678_10055441 | Ga0207678_100554413 | 298 |
| 84 | 3300047315 | Ga0495581_0046750 | Ga0495581_0046750_994_1971 | 298 |
| 85 | 3300047317 | Ga0495604_0041513 | Ga0495604_0041513_2595_3572 | 298 |
| 86 | 3300048929 | Ga0496126_0004908 | Ga0496126_0004908_3616_4593 | 298 |
| 87 | 3300041452 | Ga0451793_0960293 | Ga0451793_0960293_352_1350 | 299 |
| 88 | 3300044683 | Ga0466965_0000010 | Ga0466965_0000010_65755_66699 | 299 |
| 89 | 3300046462 | Ga0495651_0203290 | Ga0495651_0203290_37_1014 | 299 |
| 90 | 3300046511 | Ga0495608_0064902 | Ga0495608_0064902_100_1077 | 299 |
| 91 | 3300046516 | Ga0495628_0060547 | Ga0495628_0060547_687_1664 | 299 |
| 92 | 3300046679 | Ga0495623_0201450 | Ga0495623_0201450_71_1048 | 299 |
| 93 | 3300047322 | Ga0495680_0027216 | Ga0495680_0027216_3280_4257 | 299 |
| 94 | 3300031901 | Ga0307406_10023596 | Ga0307406_100235963 | 300 |
| 95 | iso_pu_bacteria | 2833709550 | 2833712382 | 300 |
| 96 | 3300005327 | Ga0070658_10004626 | Ga0070658_100046262 | 301 |
| 97 | 3300005339 | Ga0070660_100171652 | Ga0070660_1001716521 | 301 |
| 98 | 3300005539 | Ga0068853_100442198 | Ga0068853_1004421982 | 301 |
| 99 | 3300005563 | Ga0068855_100066043 | Ga0068855_1000660433 | 301 |
| 100 | 3300013104 | Ga0157370_10430102 | Ga0157370_104301021 | 301 |
| 101 | 3300025904 | Ga0207647_10016136 | Ga0207647_100161362 | 301 |
| 102 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000011211 | 301 |
| 103 | 3300025919 | Ga0207657_10120233 | Ga0207657_101202331 | 301 |
| 104 | 3300025932 | Ga0207690_10008705 | Ga0207690_100087055 | 301 |
| 105 | 3300026067 | Ga0207678_10011109 | Ga0207678_100111093 | 301 |
| 106 | 3300048903 | Ga0496100_0120952 | Ga0496100_0120952_185_1174 | 301 |
| 107 | 3300048904 | Ga0496101_0023867 | Ga0496101_0023867_2066_3055 | 301 |
| 108 | 3300048905 | Ga0496102_0035923 | Ga0496102_0035923_121_1110 | 301 |
| 109 | 3300048907 | Ga0496104_0007696 | Ga0496104_0007696_2198_3187 | 301 |
| 110 | 3300048907 | Ga0496104_0332226 | Ga0496104_0332226_330_1319 | 301 |
| 111 | 3300048908 | Ga0496105_0105967 | Ga0496105_0105967_405_1394 | 301 |
| 112 | 3300048910 | Ga0496107_0005670 | Ga0496107_0005670_1486_2475 | 301 |
| 113 | 3300048913 | Ga0496110_0294821 | Ga0496110_0294821_312_1301 | 301 |
| 114 | 3300048915 | Ga0496112_0010387 | Ga0496112_0010387_510_1499 | 301 |
| 115 | 3300048917 | Ga0496114_0018085 | Ga0496114_0018085_3938_4942 | 301 |
| 116 | 3300048917 | Ga0496114_0044361 | Ga0496114_0044361_639_1628 | 301 |
| 117 | 3300048918 | Ga0496115_0134742 | Ga0496115_0134742_823_1812 | 301 |
| 118 | iso_pu_bacteria | 2757320536 | 2758227432 | 301 |
| 119 | iso_pu_bacteria | 2904509784 | 2904513051 | 301 |
| 120 | iso_pu_bacteria | 2977228692 | 2977229285 | 301 |
| 121 | iso_pu_bacteria | 2977236895 | 2977238677 | 301 |
| 122 | iso_pu_bacteria | 2984542743 | 2984543539 | 301 |
| 123 | iso_pu_bacteria | 8016254467 | 8016256304 | 301 |
| 124 | 3300037068 | Ga0373925_0002919 | Ga0373925_0002919_3825_4820 | 302 |
| 125 | 3300045976 | Ga0466967_0650841 | Ga0466967_0650841_58_1023 | 302 |
| 126 | iso_pu_bacteria | 2974294766 | 2974295739 | 302 |
| 127 | iso_pu_bacteria | 2974324384 | 2974324463 | 302 |
| 128 | iso_pu_bacteria | 2643221632 | 2644181770 | 303 |
| 129 | 3300009036 | Ga0105244_10017930 | Ga0105244_100179303 | 304 |
| 130 | 3300009148 | Ga0105243_10014346 | Ga0105243_100143462 | 304 |
| 131 | 3300025728 | Ga0207655_1002019 | Ga0207655_10020192 | 304 |
| 132 | 3300025935 | Ga0207709_10007509 | Ga0207709_100075092 | 304 |
| 133 | 3300026067 | Ga0207678_10000719 | Ga0207678_100007196 | 304 |
| 134 | iso_pu_bacteria | 2904430863 | 2904431157 | 304 |
| 135 | iso_pu_bacteria | 2904501621 | 2904502257 | 304 |
| 136 | iso_pu_bacteria | 2908674828 | 2908677269 | 304 |
| 137 | iso_pu_bacteria | 2928500415 | 2928503179 | 304 |
| 138 | 3300014326 | Ga0157380_10339387 | Ga0157380_103393871 | 305 |
| 139 | 3300046462 | Ga0495651_0021873 | Ga0495651_0021873_1220_2224 | 305 |
| 140 | 3300046463 | Ga0495653_0008311 | Ga0495653_0008311_3225_4229 | 305 |
| 141 | 3300046472 | Ga0495580_0014571 | Ga0495580_0014571_1826_2830 | 305 |
| 142 | 3300046476 | Ga0495662_0003540 | Ga0495662_0003540_2265_3269 | 305 |
| 143 | 3300046477 | Ga0495664_0044315 | Ga0495664_0044315_1013_2017 | 305 |
| 144 | 3300046515 | Ga0495620_0005591 | Ga0495620_0005591_5470_6447 | 305 |
| 145 | 3300046516 | Ga0495628_0010956 | Ga0495628_0010956_6361_7365 | 305 |
| 146 | 3300046522 | Ga0495643_0020189 | Ga0495643_0020189_783_1760 | 305 |
| 147 | 3300046524 | Ga0495648_0041618 | Ga0495648_0041618_1067_2044 | 305 |
| 148 | 3300046526 | Ga0495666_0025436 | Ga0495666_0025436_748_1752 | 305 |
| 149 | 3300046533 | Ga0495640_0020654 | Ga0495640_0020654_1013_2017 | 305 |
| 150 | 3300046535 | Ga0495586_0004068 | Ga0495586_0004068_3658_4662 | 305 |
| 151 | 3300046536 | Ga0495587_0012024 | Ga0495587_0012024_583_1587 | 305 |
| 152 | 3300046542 | Ga0495597_0061283 | Ga0495597_0061283_492_1469 | 305 |
| 153 | 3300046543 | Ga0495645_0033213 | Ga0495645_0033213_975_1979 | 305 |
| 154 | 3300046557 | Ga0495622_0016357 | Ga0495622_0016357_2121_3098 | 305 |
| 155 | 3300046559 | Ga0495667_0009816 | Ga0495667_0009816_931_1935 | 305 |
| 156 | 3300046616 | Ga0495668_0021497 | Ga0495668_0021497_659_1636 | 305 |
| 157 | 3300046642 | Ga0495634_0064625 | Ga0495634_0064625_72_1076 | 305 |
| 158 | 3300046660 | Ga0495625_0027159 | Ga0495625_0027159_2679_3656 | 305 |
| 159 | 3300046663 | Ga0495635_0092621 | Ga0495635_0092621_443_1447 | 305 |
| 160 | 3300046675 | Ga0495657_0100513 | Ga0495657_0100513_385_1389 | 305 |
| 161 | 3300046680 | Ga0495646_0013202 | Ga0495646_0013202_856_1860 | 305 |
| 162 | 3300046689 | Ga0495613_0002952 | Ga0495613_0002952_5208_6212 | 305 |
| 163 | 3300046689 | Ga0495613_0007787 | Ga0495613_0007787_6341_7318 | 305 |
| 164 | 3300046794 | Ga0495589_0006285 | Ga0495589_0006285_4372_5349 | 305 |
| 165 | 3300046810 | Ga0495660_0045849 | Ga0495660_0045849_817_1794 | 305 |
| 166 | 3300047317 | Ga0495604_0005758 | Ga0495604_0005758_4550_5554 | 305 |
| 167 | 3300047319 | Ga0495674_0010990 | Ga0495674_0010990_1362_2366 | 305 |
| 168 | 3300047321 | Ga0495676_0007470 | Ga0495676_0007470_5038_6015 | 305 |
| 169 | 3300047323 | Ga0495683_0065405 | Ga0495683_0065405_51_1028 | 305 |
| 170 | 3300047447 | Ga0495685_007805 | Ga0495685_007805_684_1661 | 305 |
| 171 | 3300047471 | Ga0495684_0155108 | Ga0495684_0155108_274_1278 | 305 |
| 172 | 3300047471 | Ga0495684_0325137 | Ga0495684_0325137_23_1027 | 305 |
| 173 | 3300048088 | Ga0495602_0246834 | Ga0495602_0246834_168_1172 | 305 |
| 174 | 3300048091 | Ga0495626_0016714 | Ga0495626_0016714_1478_2455 | 305 |
| 175 | 3300048920 | Ga0496117_0000069 | Ga0496117_0000069_36935_37909 | 305 |
| 176 | 3300048922 | Ga0496119_0012414 | Ga0496119_0012414_1770_2744 | 305 |
| 177 | 3300048925 | Ga0496122_0001562 | Ga0496122_0001562_19163_20137 | 305 |
| 178 | 3300048926 | Ga0496123_0009079 | Ga0496123_0009079_5864_6838 | 305 |
| 179 | 3300048928 | Ga0496125_0006174 | Ga0496125_0006174_4530_5504 | 305 |
| 180 | 3300048929 | Ga0496126_0003925 | Ga0496126_0003925_1690_2664 | 305 |
| 181 | 3300049574 | Ga0501038_0097031 | Ga0501038_0097031_1011_1979 | 305 |
| 182 | 3300053077 | Ga0495601_0156504 | Ga0495601_0156504_354_1358 | 305 |
| 183 | 3300005339 | Ga0070660_100118401 | Ga0070660_1001184013 | 306 |
| 184 | 3300005367 | Ga0070667_100099302 | Ga0070667_1000993022 | 306 |
| 185 | 3300005466 | Ga0070685_10016459 | Ga0070685_100164593 | 306 |
| 186 | 3300005614 | Ga0068856_100217343 | Ga0068856_1002173432 | 306 |
| 187 | 3300005617 | Ga0068859_100084609 | Ga0068859_1000846092 | 306 |
| 188 | 3300005842 | Ga0068858_100000023 | Ga0068858_100000023149 | 306 |
| 189 | 3300006931 | Ga0097620_100084608 | Ga0097620_1000846083 | 306 |
| 190 | 3300025913 | Ga0207695_10010909 | Ga0207695_100109099 | 306 |
| 191 | 3300025919 | Ga0207657_10018615 | Ga0207657_100186155 | 306 |
| 192 | 3300025920 | Ga0207649_10231902 | Ga0207649_102319022 | 306 |
| 193 | 3300025927 | Ga0207687_10247106 | Ga0207687_102471062 | 306 |
| 194 | 3300025949 | Ga0207667_10086754 | Ga0207667_100867542 | 306 |
| 195 | 3300025986 | Ga0207658_10104650 | Ga0207658_101046502 | 306 |
| 196 | 3300026035 | Ga0207703_10000137 | Ga0207703_1000013760 | 306 |
| 197 | 3300026078 | Ga0207702_10371095 | Ga0207702_103710951 | 306 |
| 198 | 3300044765 | Ga0466970_0006527 | Ga0466970_0006527_3417_4388 | 306 |
| 199 | 3300049571 | Ga0501034_0219239 | Ga0501034_0219239_849_1841 | 306 |
| 200 | 3300049572 | Ga0501036_0077421 | Ga0501036_0077421_134_1126 | 306 |
| 201 | 3300049579 | Ga0501043_0098757 | Ga0501043_0098757_841_1833 | 306 |
| 202 | 3300049581 | Ga0501047_0079571 | Ga0501047_0079571_540_1532 | 306 |
| 203 | 3300049822 | Ga0501035_0059493 | Ga0501035_0059493_1761_2753 | 306 |
| 204 | 3300003762 | Ga0055542_1010041 | Ga0055542_10100412 | 307 |
| 205 | 3300005327 | Ga0070658_10135771 | Ga0070658_101357712 | 307 |
| 206 | 3300005327 | Ga0070658_10238006 | Ga0070658_102380061 | 307 |
| 207 | 3300005329 | Ga0070683_100042945 | Ga0070683_1000429453 | 307 |
| 208 | 3300005345 | Ga0070692_10047695 | Ga0070692_100476952 | 307 |
| 209 | 3300005458 | Ga0070681_10060752 | Ga0070681_100607523 | 307 |
| 210 | 3300005539 | Ga0068853_100039962 | Ga0068853_1000399623 | 307 |
| 211 | 3300005543 | Ga0070672_100408823 | Ga0070672_1004088231 | 307 |
| 212 | 3300005563 | Ga0068855_100005744 | Ga0068855_1000057442 | 307 |
| 213 | 3300005563 | Ga0068855_100115930 | Ga0068855_1001159302 | 307 |
| 214 | 3300005564 | Ga0070664_100291609 | Ga0070664_1002916092 | 307 |
| 215 | 3300005577 | Ga0068857_100006574 | Ga0068857_1000065742 | 307 |
| 216 | 3300005577 | Ga0068857_100074199 | Ga0068857_1000741993 | 307 |
| 217 | 3300005834 | Ga0068851_10000015 | Ga0068851_1000001547 | 307 |
| 218 | 3300006051 | Ga0075364_10078040 | Ga0075364_100780402 | 307 |
| 219 | 3300009098 | Ga0105245_10207480 | Ga0105245_102074802 | 307 |
| 220 | 3300009174 | Ga0105241_10052488 | Ga0105241_100524882 | 307 |
| 221 | 3300010375 | Ga0105239_10451593 | Ga0105239_104515932 | 307 |
| 222 | 3300013104 | Ga0157370_10196982 | Ga0157370_101969822 | 307 |
| 223 | 3300014325 | Ga0163163_10106431 | Ga0163163_101064312 | 307 |
| 224 | 3300025254 | Ga0209148_1000836 | Ga0209148_100083619 | 307 |
| 225 | 3300025321 | Ga0207656_10000001 | Ga0207656_10000001837 | 307 |
| 226 | 3300025911 | Ga0207654_10000001 | Ga0207654_10000001128 | 307 |
| 227 | 3300025912 | Ga0207707_10001735 | Ga0207707_100017351 | 307 |
| 228 | 3300025914 | Ga0207671_10000001 | Ga0207671_10000001836 | 307 |
| 229 | 3300025914 | Ga0207671_10101624 | Ga0207671_101016242 | 307 |
| 230 | 3300025917 | Ga0207660_10022477 | Ga0207660_100224773 | 307 |
| 231 | 3300025924 | Ga0207694_10000052 | Ga0207694_10000052111 | 307 |
| 232 | 3300025940 | Ga0207691_10311578 | Ga0207691_103115781 | 307 |
| 233 | 3300025941 | Ga0207711_10009069 | Ga0207711_1000906910 | 307 |
| 234 | 3300025949 | Ga0207667_10004379 | Ga0207667_100043793 | 307 |
| 235 | 3300025949 | Ga0207667_10316071 | Ga0207667_103160711 | 307 |
| 236 | 3300026041 | Ga0207639_10029799 | Ga0207639_100297993 | 307 |
| 237 | 3300026078 | Ga0207702_10080080 | Ga0207702_100800803 | 307 |
| 238 | 3300026078 | Ga0207702_10462796 | Ga0207702_104627962 | 307 |
| 239 | 3300026116 | Ga0207674_10006779 | Ga0207674_1000677916 | 307 |
| 240 | 3300026116 | Ga0207674_10122573 | Ga0207674_101225732 | 307 |
| 241 | 3300026142 | Ga0207698_10012110 | Ga0207698_100121103 | 307 |
| 242 | 3300026142 | Ga0207698_10016794 | Ga0207698_100167942 | 307 |
| 243 | 3300028800 | Ga0265338_10002348 | Ga0265338_100023485 | 307 |
| 244 | 3300031649 | Ga0307514_10002337 | Ga0307514_100023379 | 307 |
| 245 | 3300031911 | Ga0307412_10270793 | Ga0307412_102707932 | 307 |
| 246 | 3300037466 | Ga0395898_0285536 | Ga0395898_0285536_175_1161 | 307 |
| 247 | 3300041452 | Ga0451793_1423462 | Ga0451793_1423462_74_1012 | 307 |
| 248 | 3300048918 | Ga0496115_0019837 | Ga0496115_0019837_562_1548 | 307 |
| 249 | 3300048920 | Ga0496117_0038438 | Ga0496117_0038438_1617_2618 | 307 |
| 250 | 3300048921 | Ga0496118_0033118 | Ga0496118_0033118_1011_2012 | 307 |
| 251 | 3300048922 | Ga0496119_0004878 | Ga0496119_0004878_10124_11125 | 307 |
| 252 | 3300048922 | Ga0496119_0012964 | Ga0496119_0012964_396_1397 | 307 |
| 253 | 3300048922 | Ga0496119_0022720 | Ga0496119_0022720_551_1537 | 307 |
| 254 | 3300048923 | Ga0496120_0000326 | Ga0496120_0000326_74827_75828 | 307 |
| 255 | 3300048923 | Ga0496120_0001833 | Ga0496120_0001833_1416_2417 | 307 |
| 256 | 3300048925 | Ga0496122_0000208 | Ga0496122_0000208_104123_105124 | 307 |
| 257 | 3300048926 | Ga0496123_0000003 | Ga0496123_0000003_101757_102758 | 307 |
| 258 | 3300048927 | Ga0496124_0040921 | Ga0496124_0040921_2919_3920 | 307 |
| 259 | 3300048928 | Ga0496125_0050710 | Ga0496125_0050710_2220_3221 | 307 |
| 260 | 3300048929 | Ga0496126_0026278 | Ga0496126_0026278_2619_3620 | 307 |
| 261 | 3300049571 | Ga0501034_0075567 | Ga0501034_0075567_2181_3155 | 307 |
| 262 | 3300049572 | Ga0501036_0200167 | Ga0501036_0200167_198_1169 | 307 |
| 263 | 3300049822 | Ga0501035_0163506 | Ga0501035_0163506_780_1754 | 307 |
| 264 | 3300049823 | Ga0501044_0262689 | Ga0501044_0262689_511_1485 | 307 |
| 265 | 3300053080 | Ga0500635_0029814 | Ga0500635_0029814_743_1729 | 307 |
| 266 | 3300053140 | Ga0500573_0000024 | Ga0500573_0000024_52889_53878 | 307 |
| 267 | 3300053140 | Ga0500573_0000154 | Ga0500573_0000154_10930_11949 | 307 |
| 268 | 3300053153 | Ga0500616_0001756 | Ga0500616_0001756_6647_7612 | 307 |
| 269 | iso_pu_bacteria | 2852643534 | 2852644230 | 307 |
| 270 | iso_pu_bacteria | 2946033335 | 2946036403 | 307 |
| 271 | iso_pu_bacteria | 8046352972 | 8046355235 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
108
322
0.85
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8713 | 17 | 300 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.8692 | 17 | 300 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.8644 | 17 | 299 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.8624 | 17 | 300 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8598 | 17 | 300 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8914 | 64 | 303 | 1.10.3720.10 |
| af_P9WG03_18_293_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8788 | 17 | 298 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8741 | 64 | 303 | 1.10.3720.10 |
| af_Q2G2B0_2_264_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8691 | 21 | 296 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8683 | 64 | 307 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9Z9B0-F1-model_v4 | ABC transporter permease subunit | 0.9134 | 18 | 304 |
GO:0005886
GO:0055085 |
| AF-A0A6L8I140-F1-model_v4 | Sugar ABC transporter permease | 0.9113 | 20 | 295 |
GO:0005886
GO:0055085 |
| AF-A0A0U2L168-F1-model_v4 | ABC transporter permease | 0.911 | 22 | 299 |
GO:0005886
GO:0055085 |
| AF-A0A3D9JSF9-F1-model_v4 | Carbohydrate ABC transporter membrane protein 1 (CUT1 family) | 0.9093 | 17 | 305 |
GO:0005886
GO:0055085 |
| AF-A0A3D4Y351-F1-model_v4 | Sugar ABC transporter permease | 0.9089 | 17 | 296 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar