F377929

General Info

Members Datasets Scaffolds Average Seq Length
271 199 248 312

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0000174|Ga0496116_0000174_119788_120756
Length 322
Sequence MATLSPLTPDVAQGRLKPAVGSSRSWPRAALARLAPLAWLGPALVLIGVVVVWPVVVMVQSSFQHIGGEGFVAGYNGTHNYQHLFREPDFVSVLVRTVLWVVAVVVVTMLLALGLAQLFHQRFPGRRVARWALIVPWAASVMMTALIFRWALDPNNGVINLFLHQIGVVKKLGSHQAYWLGEPSHALVWMMAVAVFVSLPFTTYAILSGLQGIPDDVYEAASIDGSTGLSSYLHITLPLLRPAIIVATLINVINVFNSFPIIWEMTRGGPGYQTSTSTIYMVDLKQGNVGESAAMSVINFGLVILIVVIYLSTTRWKEQVDR

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
3 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
4 2687453737 Frankia sp. BMG5.36 Isolate Nodule
5 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
6 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
7 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
8 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
9 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
10 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
11 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
12 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
13 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
14 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
15 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
16 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
17 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
18 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
19 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
20 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
94 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
193 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
194 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 8002784119 Frankia sp. AgB1.9 Isolate Nodule
198 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
199 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.51
Metatranscriptomes 0
Isolates 8.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 3.69
Nodule 1.85
Rhizoplane 6.27
Rhizosphere 71.96
Stem 0
Stem Tuber 0
Unclassified 15.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055542_1010041 3300003762 Bacteria 1752
2 Ga0070658_10004626 3300005327 Bacteria 11186
3 Ga0070658_10135771 3300005327 Bacteria 2052
4 Ga0070658_10238006 3300005327 Bacteria 1542
5 Ga0070683_100042945 3300005329 Bacteria 4164
6 Ga0070660_100118401 3300005339 Bacteria 2112
7 Ga0070660_100171652 3300005339 Bacteria 1752
8 Ga0070692_10047695 3300005345 Bacteria 2217
9 Ga0070659_100124931 3300005366 Bacteria 2087
10 Ga0070667_100099302 3300005367 Bacteria 2513
11 Ga0070714_100126486 3300005435 Bacteria 2279
12 Ga0070663_100035400 3300005455 Bacteria 3465
13 Ga0070681_10060752 3300005458 Bacteria 3755
14 Ga0070685_10016459 3300005466 Bacteria 3940
15 Ga0068853_100039962 3300005539 Bacteria 4001
16 Ga0068853_100442198 3300005539 Bacteria 1222
17 Ga0070672_100408823 3300005543 Bacteria 1164
18 Ga0068855_100005744 3300005563 Bacteria 15151
19 Ga0068855_100066043 3300005563 Bacteria 4217
20 Ga0068855_100115930 3300005563 Bacteria 3070
21 Ga0070664_100291609 3300005564 Bacteria 1473
22 Ga0068857_100006574 3300005577 Bacteria 9979
23 Ga0068857_100074199 3300005577 Bacteria 3032
24 Ga0068856_100217343 3300005614 Bacteria 1926
25 Ga0068859_100005984 3300005617 Bacteria 12354
26 Ga0068859_100084609 3300005617 Bacteria 3217
27 Ga0068851_10000015 3300005834 Bacteria 145191
28 Ga0068863_100010491 3300005841 Bacteria 9004
29 Ga0068858_100000023 3300005842 Bacteria 167824
30 Ga0075364_10078040 3300006051 Bacteria 2187
31 Ga0070712_100116904 3300006175 Bacteria 2000
32 Ga0097620_100005984 3300006931 Bacteria 12354
33 Ga0097620_100084608 3300006931 Bacteria 3217
34 Ga0105244_10017930 3300009036 Bacteria 3986
35 Ga0105244_10031039 3300009036 Bacteria 2838
36 Ga0105240_10860605 3300009093 Bacteria 978
37 Ga0105245_10207480 3300009098 Bacteria 1884
38 Ga0105245_10234964 3300009098 Bacteria 1775
39 Ga0105243_10014346 3300009148 Bacteria 5997
40 Ga0105241_10052488 3300009174 Bacteria 3113
41 Ga0105248_10001200 3300009177 Bacteria 28950
42 Ga0105248_10001838 3300009177 Bacteria 23503
43 Ga0105237_10004762 3300009545 Bacteria 15602
44 Ga0105237_10316573 3300009545 Bacteria 1564
45 Ga0105238_10000648 3300009551 Bacteria 36594
46 Ga0105239_10451593 3300010375 Bacteria 1458
47 Ga0157370_10196982 3300013104 Bacteria 1869
48 Ga0157370_10430102 3300013104 Bacteria 1214
49 Ga0157369_10246507 3300013105 Bacteria 1865
50 Ga0163162_10054191 3300013306 Bacteria 4034
51 Ga0163162_10310326 3300013306 Bacteria 1710
52 Ga0157372_10477349 3300013307 Bacteria 1454
53 Ga0157375_10518358 3300013308 Bacteria 1355
54 Ga0163163_10106431 3300014325 Bacteria 2831
55 Ga0157380_10339387 3300014326 Bacteria 1401
56 Ga0157379_10045393 3300014968 Bacteria 3921
57 Ga0209148_1000836 3300025254 Bacteria 21976
58 Ga0207656_10000001 3300025321 Bacteria 1323684
59 Ga0207655_1002019 3300025728 Bacteria 17179
60 Ga0207655_1058078 3300025728 Bacteria 1515
61 Ga0207647_10016136 3300025904 Bacteria 5103
62 Ga0207705_10000001 3300025909 Bacteria 2061880
63 Ga0207654_10000001 3300025911 Bacteria 1816198
64 Ga0207707_10001735 3300025912 Bacteria 20037
65 Ga0207695_10010909 3300025913 Bacteria 11053
66 Ga0207671_10000001 3300025914 Bacteria 1318881
67 Ga0207671_10101624 3300025914 Bacteria 2178
68 Ga0207693_10123118 3300025915 Bacteria 2037
69 Ga0207660_10022477 3300025917 Bacteria 4249
70 Ga0207657_10018615 3300025919 Bacteria 6620
71 Ga0207657_10120233 3300025919 Bacteria 2161
72 Ga0207649_10231902 3300025920 Bacteria 1320
73 Ga0207694_10000052 3300025924 Bacteria 157700
74 Ga0207687_10247106 3300025927 Bacteria 1416
75 Ga0207664_10172741 3300025929 Bacteria 1851
76 Ga0207644_10184765 3300025931 Bacteria 1636
77 Ga0207690_10008705 3300025932 Bacteria 6021
78 Ga0207709_10007509 3300025935 Bacteria 6067
79 Ga0207691_10311578 3300025940 Bacteria 1351
80 Ga0207711_10000139 3300025941 Bacteria 77476
81 Ga0207711_10009069 3300025941 Bacteria 8311
82 Ga0207679_10024107 3300025945 Bacteria 4168
83 Ga0207667_10004379 3300025949 Bacteria 17290
84 Ga0207667_10086754 3300025949 Bacteria 3238
85 Ga0207667_10316071 3300025949 Bacteria 1595
86 Ga0207658_10104650 3300025986 Bacteria 2224
87 Ga0207703_10000137 3300026035 Bacteria 89265
88 Ga0207703_10094702 3300026035 Bacteria 2518
89 Ga0207639_10029799 3300026041 Bacteria 3999
90 Ga0207678_10000719 3300026067 Bacteria 30220
91 Ga0207678_10011109 3300026067 Bacteria 7911
92 Ga0207678_10018690 3300026067 Bacteria 6085
93 Ga0207678_10055441 3300026067 Bacteria 3414
94 Ga0207702_10080080 3300026078 Bacteria 2833
95 Ga0207702_10371095 3300026078 Bacteria 1374
96 Ga0207702_10462796 3300026078 Bacteria 1232
97 Ga0207641_10041403 3300026088 Bacteria 3860
98 Ga0207674_10006779 3300026116 Bacteria 13438
99 Ga0207674_10122573 3300026116 Bacteria 2566
100 Ga0207698_10012110 3300026142 Bacteria 5628
101 Ga0207698_10016794 3300026142 Bacteria 4946
102 Ga0265337_1000242 3300028556 Bacteria 29618
103 Ga0265326_10002656 3300028558 Bacteria 5984
104 Ga0265319_1004717 3300028563 Bacteria 6683
105 Ga0265334_10002605 3300028573 Bacteria 8407
106 Ga0265318_10012366 3300028577 Bacteria 3638
107 Ga0265336_10006029 3300028666 Bacteria 4409
108 Ga0265338_10001399 3300028800 Bacteria 39290
109 Ga0265338_10002348 3300028800 Bacteria 28565
110 Ga0265324_10003045 3300029957 Bacteria 8187
111 Ga0265332_10001033 3300031238 Bacteria 16399
112 Ga0265320_10001145 3300031240 Bacteria 19503
113 Ga0265325_10126879 3300031241 Bacteria 1225
114 Ga0307509_10001165 3300031507 Bacteria 44960
115 Ga0265313_10015334 3300031595 Bacteria 4470
116 Ga0307514_10002337 3300031649 Bacteria 19911
117 Ga0265314_10047231 3300031711 Bacteria 3031
118 Ga0307406_10023596 3300031901 Bacteria 3663
119 Ga0307412_10270793 3300031911 Bacteria 1329
120 Ga0373933_0137042 3300035724 Bacteria 1543
121 Ga0373925_0002919 3300037068 Bacteria 13482
122 Ga0395898_0285536 3300037466 Bacteria 1574
123 Ga0439465_0059853 3300041413 Bacteria 1261
124 Ga0451789_0405646 3300041443 Bacteria 1637
125 Ga0451793_0960293 3300041452 Bacteria 1635
126 Ga0451793_1423462 3300041452 Bacteria 2537
127 Ga0466972_0059308 3300044658 Bacteria 1837
128 Ga0466965_0000010 3300044683 Bacteria 112032
129 Ga0466966_0004509 3300044684 Bacteria 9186
130 Ga0466961_0003676 3300044693 Bacteria 9566
131 Ga0466971_0003747 3300044719 Bacteria 6508
132 Ga0466970_0006527 3300044765 Bacteria 5831
133 Ga0466967_0650841 3300045976 Bacteria 1042
134 Ga0495651_0021873 3300046462 Bacteria 4972
135 Ga0495651_0203290 3300046462 Bacteria 1385
136 Ga0495653_0008311 3300046463 Bacteria 8506
137 Ga0495580_0014571 3300046472 Bacteria 5961
138 Ga0495662_0003540 3300046476 Bacteria 7890
139 Ga0495664_0044315 3300046477 Bacteria 2636
140 Ga0495608_0064902 3300046511 Bacteria 2392
141 Ga0495620_0005591 3300046515 Bacteria 7000
142 Ga0495628_0010956 3300046516 Bacteria 7679
143 Ga0495628_0060547 3300046516 Bacteria 2970
144 Ga0495643_0020189 3300046522 Bacteria 3846
145 Ga0495648_0041618 3300046524 Bacteria 2899
146 Ga0495666_0025436 3300046526 Bacteria 2922
147 Ga0495640_0020654 3300046533 Bacteria 4844
148 Ga0495586_0004068 3300046535 Bacteria 7838
149 Ga0495587_0012024 3300046536 Bacteria 5466
150 Ga0495597_0061283 3300046542 Bacteria 1639
151 Ga0495645_0033213 3300046543 Bacteria 3764
152 Ga0495645_0067192 3300046543 Bacteria 2589
153 Ga0495622_0016357 3300046557 Bacteria 3453
154 Ga0495667_0009816 3300046559 Bacteria 6483
155 Ga0495668_0021497 3300046616 Bacteria 3698
156 Ga0495634_0064625 3300046642 Bacteria 2425
157 Ga0495625_0027159 3300046660 Bacteria 4314
158 Ga0495635_0092621 3300046663 Bacteria 2066
159 Ga0495657_0100513 3300046675 Bacteria 1843
160 Ga0495623_0201450 3300046679 Bacteria 1144
161 Ga0495646_0013202 3300046680 Bacteria 5248
162 Ga0495613_0002952 3300046689 Bacteria 12720
163 Ga0495613_0007787 3300046689 Bacteria 7971
164 Ga0495589_0006285 3300046794 Bacteria 6272
165 Ga0495660_0045849 3300046810 Bacteria 2398
166 Ga0495581_0046750 3300047315 Bacteria 2501
167 Ga0495604_0005758 3300047317 Bacteria 9828
168 Ga0495604_0041513 3300047317 Bacteria 3608
169 Ga0495674_0010990 3300047319 Bacteria 8553
170 Ga0495676_0007470 3300047321 Bacteria 10022
171 Ga0495680_0027216 3300047322 Bacteria 4701
172 Ga0495683_0065405 3300047323 Bacteria 1793
173 Ga0495685_007805 3300047447 Bacteria 3539
174 Ga0495684_0155108 3300047471 Bacteria 1710
175 Ga0495684_0325137 3300047471 Bacteria 1098
176 Ga0495602_0246834 3300048088 Bacteria 1332
177 Ga0495626_0016714 3300048091 Bacteria 3721
178 Ga0496100_0120952 3300048903 Bacteria 1831
179 Ga0496101_0023867 3300048904 Bacteria 4228
180 Ga0496102_0035923 3300048905 Bacteria 4463
181 Ga0496104_0007696 3300048907 Bacteria 9537
182 Ga0496104_0332226 3300048907 Bacteria 1433
183 Ga0496105_0105967 3300048908 Bacteria 2320
184 Ga0496107_0005670 3300048910 Bacteria 8543
185 Ga0496110_0294821 3300048913 Bacteria 1477
186 Ga0496112_0010387 3300048915 Bacteria 8442
187 Ga0496114_0018085 3300048917 Bacteria 5695
188 Ga0496114_0044361 3300048917 Bacteria 3688
189 Ga0496115_0018536 3300048918 Bacteria 5346
190 Ga0496115_0019837 3300048918 Bacteria 5180
191 Ga0496115_0134742 3300048918 Bacteria 2036
192 Ga0496116_0000174 3300048919 Bacteria 129255
193 Ga0496116_0115561 3300048919 Bacteria 1565
194 Ga0496117_0000069 3300048920 Bacteria 246025
195 Ga0496117_0014779 3300048920 Bacteria 6700
196 Ga0496117_0027801 3300048920 Bacteria 4395
197 Ga0496117_0038438 3300048920 Bacteria 3548
198 Ga0496118_0005564 3300048921 Bacteria 14270
199 Ga0496118_0033118 3300048921 Bacteria 4246
200 Ga0496118_0052113 3300048921 Bacteria 3125
201 Ga0496118_0081948 3300048921 Bacteria 2263
202 Ga0496119_0004878 3300048922 Bacteria 13135
203 Ga0496119_0006264 3300048922 Bacteria 11102
204 Ga0496119_0008975 3300048922 Bacteria 8680
205 Ga0496119_0012414 3300048922 Bacteria 6921
206 Ga0496119_0012964 3300048922 Bacteria 6701
207 Ga0496119_0022720 3300048922 Bacteria 4479
208 Ga0496120_0000326 3300048923 Bacteria 79061
209 Ga0496120_0001833 3300048923 Bacteria 23715
210 Ga0496120_0002495 3300048923 Bacteria 18485
211 Ga0496120_0100001 3300048923 Bacteria 1534
212 Ga0496121_0000380 3300048924 Bacteria 90959
213 Ga0496122_0000208 3300048925 Bacteria 131175
214 Ga0496122_0001562 3300048925 Bacteria 36221
215 Ga0496122_0005303 3300048925 Bacteria 15427
216 Ga0496123_0000003 3300048926 Bacteria 866556
217 Ga0496123_0009079 3300048926 Bacteria 9004
218 Ga0496123_0063407 3300048926 Bacteria 2361
219 Ga0496124_0040921 3300048927 Bacteria 4003
220 Ga0496125_0006174 3300048928 Bacteria 13056
221 Ga0496125_0050710 3300048928 Bacteria 3432
222 Ga0496126_0003925 3300048929 Bacteria 18219
223 Ga0496126_0004908 3300048929 Bacteria 15620
224 Ga0496126_0026278 3300048929 Bacteria 5584
225 Ga0496126_0469849 3300048929 Bacteria 1009
226 Ga0501033_0222129 3300049570 Bacteria 1344
227 Ga0501034_0075567 3300049571 Bacteria 3376
228 Ga0501034_0198194 3300049571 Bacteria 1967
229 Ga0501034_0219239 3300049571 Bacteria 1855
230 Ga0501036_0077421 3300049572 Bacteria 2814
231 Ga0501036_0200167 3300049572 Bacteria 1680
232 Ga0501038_0097031 3300049574 Bacteria 2459
233 Ga0501043_0098757 3300049579 Bacteria 2295
234 Ga0501047_0079571 3300049581 Bacteria 3151
235 Ga0501035_0059493 3300049822 Bacteria 3402
236 Ga0501035_0163506 3300049822 Bacteria 1926
237 Ga0501044_0238607 3300049823 Bacteria 1762
238 Ga0501044_0262689 3300049823 Bacteria 1664
239 Ga0501044_0457803 3300049823 Bacteria 1181
240 Ga0495601_0156504 3300053077 Bacteria 1488
241 Ga0500635_0029814 3300053080 Bacteria 1754
242 Ga0500564_054889 3300053138 Bacteria 1817
243 Ga0500573_0000024 3300053140 Bacteria 151713
244 Ga0500573_0000154 3300053140 Bacteria 27843
245 Ga0500603_001723 3300053150 Bacteria 4923
246 Ga0500616_0001756 3300053153 Bacteria 19850
247 Ga0500616_0160287 3300053153 Bacteria 1032
248 Ga0466962_0003071 3300061719 Bacteria 7955

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10001200 Ga0105248_1000120024 260
2 3300025941 Ga0207711_10000139 Ga0207711_100001394 260
3 3300048920 Ga0496117_0027801 Ga0496117_0027801_2027_2914 262
4 3300048921 Ga0496118_0005564 Ga0496118_0005564_1550_2437 262
5 3300053153 Ga0500616_0160287 Ga0500616_0160287_56_943 273
6 3300009093 Ga0105240_10860605 Ga0105240_108606051 279
7 3300009098 Ga0105245_10234964 Ga0105245_102349642 279
8 3300009177 Ga0105248_10001838 Ga0105248_100018383 279
9 3300009545 Ga0105237_10004762 Ga0105237_100047622 279
10 3300009545 Ga0105237_10316573 Ga0105237_103165732 279
11 3300009551 Ga0105238_10000648 Ga0105238_100006489 279
12 3300013105 Ga0157369_10246507 Ga0157369_102465072 279
13 3300014968 Ga0157379_10045393 Ga0157379_100453933 279
14 3300025929 Ga0207664_10172741 Ga0207664_101727412 279
15 3300028556 Ga0265337_1000242 Ga0265337_100024226 279
16 3300028558 Ga0265326_10002656 Ga0265326_100026564 279
17 3300028563 Ga0265319_1004717 Ga0265319_10047174 279
18 3300028573 Ga0265334_10002605 Ga0265334_100026054 279
19 3300028577 Ga0265318_10012366 Ga0265318_100123661 279
20 3300028666 Ga0265336_10006029 Ga0265336_100060293 279
21 3300028800 Ga0265338_10001399 Ga0265338_100013994 279
22 3300029957 Ga0265324_10003045 Ga0265324_100030455 279
23 3300031238 Ga0265332_10001033 Ga0265332_100010334 279
24 3300031240 Ga0265320_10001145 Ga0265320_1000114516 279
25 3300031241 Ga0265325_10126879 Ga0265325_101268792 279
26 3300031595 Ga0265313_10015334 Ga0265313_100153344 279
27 3300031711 Ga0265314_10047231 Ga0265314_100472313 279
28 3300048929 Ga0496126_0469849 Ga0496126_0469849_63_902 279
29 3300035724 Ga0373933_0137042 Ga0373933_0137042_519_1484 280
30 3300041443 Ga0451789_0405646 Ga0451789_0405646_707_1603 280
31 iso_pu_bacteria 2687453737 2689962057 280
32 iso_pu_bacteria 2508501039 2508677832 283
33 iso_pu_bacteria 2675902999 2676204097 283
34 iso_pu_bacteria 2773857921 2774848673 283
35 3300006175 Ga0070712_100116904 Ga0070712_1001169042 284
36 3300025915 Ga0207693_10123118 Ga0207693_101231182 284
37 3300046543 Ga0495645_0067192 Ga0495645_0067192_1171_2058 285
38 3300049570 Ga0501033_0222129 Ga0501033_0222129_13_870 285
39 3300049823 Ga0501044_0457803 Ga0501044_0457803_261_1118 285
40 3300013308 Ga0157375_10518358 Ga0157375_105183582 287
41 3300041413 Ga0439465_0059853 Ga0439465_0059853_385_1248 287
42 3300025931 Ga0207644_10184765 Ga0207644_101847652 289
43 3300005435 Ga0070714_100126486 Ga0070714_1001264862 291
44 3300009036 Ga0105244_10031039 Ga0105244_100310392 291
45 3300025728 Ga0207655_1058078 Ga0207655_10580782 291
46 3300048922 Ga0496119_0008975 Ga0496119_0008975_7004_7981 291
47 3300048923 Ga0496120_0002495 Ga0496120_0002495_6844_7821 291
48 3300049823 Ga0501044_0238607 Ga0501044_0238607_28_936 291
49 3300005366 Ga0070659_100124931 Ga0070659_1001249312 292
50 3300005455 Ga0070663_100035400 Ga0070663_1000354002 292
51 3300013306 Ga0163162_10054191 Ga0163162_100541914 292
52 3300013306 Ga0163162_10310326 Ga0163162_103103261 292
53 3300013307 Ga0157372_10477349 Ga0157372_104773492 292
54 3300025945 Ga0207679_10024107 Ga0207679_100241073 292
55 3300026067 Ga0207678_10018690 Ga0207678_100186903 292
56 3300031507 Ga0307509_10001165 Ga0307509_100011656 292
57 3300044658 Ga0466972_0059308 Ga0466972_0059308_16_918 292
58 3300044684 Ga0466966_0004509 Ga0466966_0004509_5404_6381 292
59 3300044693 Ga0466961_0003676 Ga0466961_0003676_5517_6494 292
60 3300044719 Ga0466971_0003747 Ga0466971_0003747_2921_3898 292
61 3300048918 Ga0496115_0018536 Ga0496115_0018536_546_1475 292
62 3300048919 Ga0496116_0115561 Ga0496116_0115561_606_1538 292
63 3300048924 Ga0496121_0000380 Ga0496121_0000380_40204_41124 292
64 3300048925 Ga0496122_0005303 Ga0496122_0005303_8703_9629 292
65 3300048926 Ga0496123_0063407 Ga0496123_0063407_1367_2293 292
66 3300049571 Ga0501034_0198194 Ga0501034_0198194_74_973 292
67 3300053138 Ga0500564_054889 Ga0500564_054889_722_1621 292
68 3300053150 Ga0500603_001723 Ga0500603_001723_3338_4237 292
69 3300061719 Ga0466962_0003071 Ga0466962_0003071_3991_4968 292
70 3300005617 Ga0068859_100005984 Ga0068859_10000598410 294
71 3300005841 Ga0068863_100010491 Ga0068863_1000104912 294
72 3300006931 Ga0097620_100005984 Ga0097620_10000598410 294
73 3300026035 Ga0207703_10094702 Ga0207703_100947022 294
74 3300026088 Ga0207641_10041403 Ga0207641_100414033 294
75 3300048921 Ga0496118_0081948 Ga0496118_0081948_971_1951 294
76 iso_pu_bacteria 8002784119 8002791722 296
77 3300048919 Ga0496116_0000174 Ga0496116_0000174_119788_120756 297
78 3300048920 Ga0496117_0014779 Ga0496117_0014779_1411_2379 297
79 3300048921 Ga0496118_0052113 Ga0496118_0052113_595_1563 297
80 3300048922 Ga0496119_0006264 Ga0496119_0006264_8557_9525 297
81 3300048923 Ga0496120_0100001 Ga0496120_0100001_44_1012 297
82 iso_pu_bacteria 2767802112 2768643893 297
83 3300026067 Ga0207678_10055441 Ga0207678_100554413 298
84 3300047315 Ga0495581_0046750 Ga0495581_0046750_994_1971 298
85 3300047317 Ga0495604_0041513 Ga0495604_0041513_2595_3572 298
86 3300048929 Ga0496126_0004908 Ga0496126_0004908_3616_4593 298
87 3300041452 Ga0451793_0960293 Ga0451793_0960293_352_1350 299
88 3300044683 Ga0466965_0000010 Ga0466965_0000010_65755_66699 299
89 3300046462 Ga0495651_0203290 Ga0495651_0203290_37_1014 299
90 3300046511 Ga0495608_0064902 Ga0495608_0064902_100_1077 299
91 3300046516 Ga0495628_0060547 Ga0495628_0060547_687_1664 299
92 3300046679 Ga0495623_0201450 Ga0495623_0201450_71_1048 299
93 3300047322 Ga0495680_0027216 Ga0495680_0027216_3280_4257 299
94 3300031901 Ga0307406_10023596 Ga0307406_100235963 300
95 iso_pu_bacteria 2833709550 2833712382 300
96 3300005327 Ga0070658_10004626 Ga0070658_100046262 301
97 3300005339 Ga0070660_100171652 Ga0070660_1001716521 301
98 3300005539 Ga0068853_100442198 Ga0068853_1004421982 301
99 3300005563 Ga0068855_100066043 Ga0068855_1000660433 301
100 3300013104 Ga0157370_10430102 Ga0157370_104301021 301
101 3300025904 Ga0207647_10016136 Ga0207647_100161362 301
102 3300025909 Ga0207705_10000001 Ga0207705_100000011211 301
103 3300025919 Ga0207657_10120233 Ga0207657_101202331 301
104 3300025932 Ga0207690_10008705 Ga0207690_100087055 301
105 3300026067 Ga0207678_10011109 Ga0207678_100111093 301
106 3300048903 Ga0496100_0120952 Ga0496100_0120952_185_1174 301
107 3300048904 Ga0496101_0023867 Ga0496101_0023867_2066_3055 301
108 3300048905 Ga0496102_0035923 Ga0496102_0035923_121_1110 301
109 3300048907 Ga0496104_0007696 Ga0496104_0007696_2198_3187 301
110 3300048907 Ga0496104_0332226 Ga0496104_0332226_330_1319 301
111 3300048908 Ga0496105_0105967 Ga0496105_0105967_405_1394 301
112 3300048910 Ga0496107_0005670 Ga0496107_0005670_1486_2475 301
113 3300048913 Ga0496110_0294821 Ga0496110_0294821_312_1301 301
114 3300048915 Ga0496112_0010387 Ga0496112_0010387_510_1499 301
115 3300048917 Ga0496114_0018085 Ga0496114_0018085_3938_4942 301
116 3300048917 Ga0496114_0044361 Ga0496114_0044361_639_1628 301
117 3300048918 Ga0496115_0134742 Ga0496115_0134742_823_1812 301
118 iso_pu_bacteria 2757320536 2758227432 301
119 iso_pu_bacteria 2904509784 2904513051 301
120 iso_pu_bacteria 2977228692 2977229285 301
121 iso_pu_bacteria 2977236895 2977238677 301
122 iso_pu_bacteria 2984542743 2984543539 301
123 iso_pu_bacteria 8016254467 8016256304 301
124 3300037068 Ga0373925_0002919 Ga0373925_0002919_3825_4820 302
125 3300045976 Ga0466967_0650841 Ga0466967_0650841_58_1023 302
126 iso_pu_bacteria 2974294766 2974295739 302
127 iso_pu_bacteria 2974324384 2974324463 302
128 iso_pu_bacteria 2643221632 2644181770 303
129 3300009036 Ga0105244_10017930 Ga0105244_100179303 304
130 3300009148 Ga0105243_10014346 Ga0105243_100143462 304
131 3300025728 Ga0207655_1002019 Ga0207655_10020192 304
132 3300025935 Ga0207709_10007509 Ga0207709_100075092 304
133 3300026067 Ga0207678_10000719 Ga0207678_100007196 304
134 iso_pu_bacteria 2904430863 2904431157 304
135 iso_pu_bacteria 2904501621 2904502257 304
136 iso_pu_bacteria 2908674828 2908677269 304
137 iso_pu_bacteria 2928500415 2928503179 304
138 3300014326 Ga0157380_10339387 Ga0157380_103393871 305
139 3300046462 Ga0495651_0021873 Ga0495651_0021873_1220_2224 305
140 3300046463 Ga0495653_0008311 Ga0495653_0008311_3225_4229 305
141 3300046472 Ga0495580_0014571 Ga0495580_0014571_1826_2830 305
142 3300046476 Ga0495662_0003540 Ga0495662_0003540_2265_3269 305
143 3300046477 Ga0495664_0044315 Ga0495664_0044315_1013_2017 305
144 3300046515 Ga0495620_0005591 Ga0495620_0005591_5470_6447 305
145 3300046516 Ga0495628_0010956 Ga0495628_0010956_6361_7365 305
146 3300046522 Ga0495643_0020189 Ga0495643_0020189_783_1760 305
147 3300046524 Ga0495648_0041618 Ga0495648_0041618_1067_2044 305
148 3300046526 Ga0495666_0025436 Ga0495666_0025436_748_1752 305
149 3300046533 Ga0495640_0020654 Ga0495640_0020654_1013_2017 305
150 3300046535 Ga0495586_0004068 Ga0495586_0004068_3658_4662 305
151 3300046536 Ga0495587_0012024 Ga0495587_0012024_583_1587 305
152 3300046542 Ga0495597_0061283 Ga0495597_0061283_492_1469 305
153 3300046543 Ga0495645_0033213 Ga0495645_0033213_975_1979 305
154 3300046557 Ga0495622_0016357 Ga0495622_0016357_2121_3098 305
155 3300046559 Ga0495667_0009816 Ga0495667_0009816_931_1935 305
156 3300046616 Ga0495668_0021497 Ga0495668_0021497_659_1636 305
157 3300046642 Ga0495634_0064625 Ga0495634_0064625_72_1076 305
158 3300046660 Ga0495625_0027159 Ga0495625_0027159_2679_3656 305
159 3300046663 Ga0495635_0092621 Ga0495635_0092621_443_1447 305
160 3300046675 Ga0495657_0100513 Ga0495657_0100513_385_1389 305
161 3300046680 Ga0495646_0013202 Ga0495646_0013202_856_1860 305
162 3300046689 Ga0495613_0002952 Ga0495613_0002952_5208_6212 305
163 3300046689 Ga0495613_0007787 Ga0495613_0007787_6341_7318 305
164 3300046794 Ga0495589_0006285 Ga0495589_0006285_4372_5349 305
165 3300046810 Ga0495660_0045849 Ga0495660_0045849_817_1794 305
166 3300047317 Ga0495604_0005758 Ga0495604_0005758_4550_5554 305
167 3300047319 Ga0495674_0010990 Ga0495674_0010990_1362_2366 305
168 3300047321 Ga0495676_0007470 Ga0495676_0007470_5038_6015 305
169 3300047323 Ga0495683_0065405 Ga0495683_0065405_51_1028 305
170 3300047447 Ga0495685_007805 Ga0495685_007805_684_1661 305
171 3300047471 Ga0495684_0155108 Ga0495684_0155108_274_1278 305
172 3300047471 Ga0495684_0325137 Ga0495684_0325137_23_1027 305
173 3300048088 Ga0495602_0246834 Ga0495602_0246834_168_1172 305
174 3300048091 Ga0495626_0016714 Ga0495626_0016714_1478_2455 305
175 3300048920 Ga0496117_0000069 Ga0496117_0000069_36935_37909 305
176 3300048922 Ga0496119_0012414 Ga0496119_0012414_1770_2744 305
177 3300048925 Ga0496122_0001562 Ga0496122_0001562_19163_20137 305
178 3300048926 Ga0496123_0009079 Ga0496123_0009079_5864_6838 305
179 3300048928 Ga0496125_0006174 Ga0496125_0006174_4530_5504 305
180 3300048929 Ga0496126_0003925 Ga0496126_0003925_1690_2664 305
181 3300049574 Ga0501038_0097031 Ga0501038_0097031_1011_1979 305
182 3300053077 Ga0495601_0156504 Ga0495601_0156504_354_1358 305
183 3300005339 Ga0070660_100118401 Ga0070660_1001184013 306
184 3300005367 Ga0070667_100099302 Ga0070667_1000993022 306
185 3300005466 Ga0070685_10016459 Ga0070685_100164593 306
186 3300005614 Ga0068856_100217343 Ga0068856_1002173432 306
187 3300005617 Ga0068859_100084609 Ga0068859_1000846092 306
188 3300005842 Ga0068858_100000023 Ga0068858_100000023149 306
189 3300006931 Ga0097620_100084608 Ga0097620_1000846083 306
190 3300025913 Ga0207695_10010909 Ga0207695_100109099 306
191 3300025919 Ga0207657_10018615 Ga0207657_100186155 306
192 3300025920 Ga0207649_10231902 Ga0207649_102319022 306
193 3300025927 Ga0207687_10247106 Ga0207687_102471062 306
194 3300025949 Ga0207667_10086754 Ga0207667_100867542 306
195 3300025986 Ga0207658_10104650 Ga0207658_101046502 306
196 3300026035 Ga0207703_10000137 Ga0207703_1000013760 306
197 3300026078 Ga0207702_10371095 Ga0207702_103710951 306
198 3300044765 Ga0466970_0006527 Ga0466970_0006527_3417_4388 306
199 3300049571 Ga0501034_0219239 Ga0501034_0219239_849_1841 306
200 3300049572 Ga0501036_0077421 Ga0501036_0077421_134_1126 306
201 3300049579 Ga0501043_0098757 Ga0501043_0098757_841_1833 306
202 3300049581 Ga0501047_0079571 Ga0501047_0079571_540_1532 306
203 3300049822 Ga0501035_0059493 Ga0501035_0059493_1761_2753 306
204 3300003762 Ga0055542_1010041 Ga0055542_10100412 307
205 3300005327 Ga0070658_10135771 Ga0070658_101357712 307
206 3300005327 Ga0070658_10238006 Ga0070658_102380061 307
207 3300005329 Ga0070683_100042945 Ga0070683_1000429453 307
208 3300005345 Ga0070692_10047695 Ga0070692_100476952 307
209 3300005458 Ga0070681_10060752 Ga0070681_100607523 307
210 3300005539 Ga0068853_100039962 Ga0068853_1000399623 307
211 3300005543 Ga0070672_100408823 Ga0070672_1004088231 307
212 3300005563 Ga0068855_100005744 Ga0068855_1000057442 307
213 3300005563 Ga0068855_100115930 Ga0068855_1001159302 307
214 3300005564 Ga0070664_100291609 Ga0070664_1002916092 307
215 3300005577 Ga0068857_100006574 Ga0068857_1000065742 307
216 3300005577 Ga0068857_100074199 Ga0068857_1000741993 307
217 3300005834 Ga0068851_10000015 Ga0068851_1000001547 307
218 3300006051 Ga0075364_10078040 Ga0075364_100780402 307
219 3300009098 Ga0105245_10207480 Ga0105245_102074802 307
220 3300009174 Ga0105241_10052488 Ga0105241_100524882 307
221 3300010375 Ga0105239_10451593 Ga0105239_104515932 307
222 3300013104 Ga0157370_10196982 Ga0157370_101969822 307
223 3300014325 Ga0163163_10106431 Ga0163163_101064312 307
224 3300025254 Ga0209148_1000836 Ga0209148_100083619 307
225 3300025321 Ga0207656_10000001 Ga0207656_10000001837 307
226 3300025911 Ga0207654_10000001 Ga0207654_10000001128 307
227 3300025912 Ga0207707_10001735 Ga0207707_100017351 307
228 3300025914 Ga0207671_10000001 Ga0207671_10000001836 307
229 3300025914 Ga0207671_10101624 Ga0207671_101016242 307
230 3300025917 Ga0207660_10022477 Ga0207660_100224773 307
231 3300025924 Ga0207694_10000052 Ga0207694_10000052111 307
232 3300025940 Ga0207691_10311578 Ga0207691_103115781 307
233 3300025941 Ga0207711_10009069 Ga0207711_1000906910 307
234 3300025949 Ga0207667_10004379 Ga0207667_100043793 307
235 3300025949 Ga0207667_10316071 Ga0207667_103160711 307
236 3300026041 Ga0207639_10029799 Ga0207639_100297993 307
237 3300026078 Ga0207702_10080080 Ga0207702_100800803 307
238 3300026078 Ga0207702_10462796 Ga0207702_104627962 307
239 3300026116 Ga0207674_10006779 Ga0207674_1000677916 307
240 3300026116 Ga0207674_10122573 Ga0207674_101225732 307
241 3300026142 Ga0207698_10012110 Ga0207698_100121103 307
242 3300026142 Ga0207698_10016794 Ga0207698_100167942 307
243 3300028800 Ga0265338_10002348 Ga0265338_100023485 307
244 3300031649 Ga0307514_10002337 Ga0307514_100023379 307
245 3300031911 Ga0307412_10270793 Ga0307412_102707932 307
246 3300037466 Ga0395898_0285536 Ga0395898_0285536_175_1161 307
247 3300041452 Ga0451793_1423462 Ga0451793_1423462_74_1012 307
248 3300048918 Ga0496115_0019837 Ga0496115_0019837_562_1548 307
249 3300048920 Ga0496117_0038438 Ga0496117_0038438_1617_2618 307
250 3300048921 Ga0496118_0033118 Ga0496118_0033118_1011_2012 307
251 3300048922 Ga0496119_0004878 Ga0496119_0004878_10124_11125 307
252 3300048922 Ga0496119_0012964 Ga0496119_0012964_396_1397 307
253 3300048922 Ga0496119_0022720 Ga0496119_0022720_551_1537 307
254 3300048923 Ga0496120_0000326 Ga0496120_0000326_74827_75828 307
255 3300048923 Ga0496120_0001833 Ga0496120_0001833_1416_2417 307
256 3300048925 Ga0496122_0000208 Ga0496122_0000208_104123_105124 307
257 3300048926 Ga0496123_0000003 Ga0496123_0000003_101757_102758 307
258 3300048927 Ga0496124_0040921 Ga0496124_0040921_2919_3920 307
259 3300048928 Ga0496125_0050710 Ga0496125_0050710_2220_3221 307
260 3300048929 Ga0496126_0026278 Ga0496126_0026278_2619_3620 307
261 3300049571 Ga0501034_0075567 Ga0501034_0075567_2181_3155 307
262 3300049572 Ga0501036_0200167 Ga0501036_0200167_198_1169 307
263 3300049822 Ga0501035_0163506 Ga0501035_0163506_780_1754 307
264 3300049823 Ga0501044_0262689 Ga0501044_0262689_511_1485 307
265 3300053080 Ga0500635_0029814 Ga0500635_0029814_743_1729 307
266 3300053140 Ga0500573_0000024 Ga0500573_0000024_52889_53878 307
267 3300053140 Ga0500573_0000154 Ga0500573_0000154_10930_11949 307
268 3300053153 Ga0500616_0001756 Ga0500616_0001756_6647_7612 307
269 iso_pu_bacteria 2852643534 2852644230 307
270 iso_pu_bacteria 2946033335 2946036403 307
271 iso_pu_bacteria 8046352972 8046355235 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

108

322

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8713 17 300
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8692 17 300
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8644 17 299
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8624 17 300
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8598 17 300
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8914 64 303 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8788 17 298 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8741 64 303 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8691 21 296 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8683 64 307 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7J9Z9B0-F1-model_v4 ABC transporter permease subunit 0.9134 18 304 GO:0005886
GO:0055085
AF-A0A6L8I140-F1-model_v4 Sugar ABC transporter permease 0.9113 20 295 GO:0005886
GO:0055085
AF-A0A0U2L168-F1-model_v4 ABC transporter permease 0.911 22 299 GO:0005886
GO:0055085
AF-A0A3D9JSF9-F1-model_v4 Carbohydrate ABC transporter membrane protein 1 (CUT1 family) 0.9093 17 305 GO:0005886
GO:0055085
AF-A0A3D4Y351-F1-model_v4 Sugar ABC transporter permease 0.9089 17 296 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
78.88 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map