F377926
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 271 | 165 | 542 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300048917|Ga0496114_0175966|Ga0496114_0175966_665_1564 |
| Length | 286 |
| Sequence | VDRAVRDDLHPALTPSLTEPTDDHLGRQDRTVNALAARGLLVTGGAYSFFAPKDANAAPTASADQLQEGRNLFLANCASCHGVNAEGTDSGPSLVGVGAASVDFQVSTGRMPLAGPNVQAPQNKVKFSEPEIAAMAAYVASLGAGPAIPEEKWTTVIPPGTPENNRAIATGGEIYRVNCAMCHNFAGAGGALTRGKYAPALNDATPRQIYEAMATGPQSMPVFNDRNISPEGKQQVISYLAAQSEQTNVGGFSLGNLGPVSEGLFAWVFGLGLLIAGAVWLGKKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 17 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 18 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 19 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 21 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 39 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 40 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 43 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 60 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 61 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 62 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 63 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 64 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 65 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 66 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 67 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 68 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 69 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 70 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 71 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 72 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 73 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 74 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 75 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 76 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 77 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 90 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 91 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 92 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 93 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 94 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 95 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 96 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 97 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 100 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 101 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 102 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 103 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 104 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 105 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 106 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 136 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 137 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 141 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 142 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 143 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 144 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 145 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 146 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 147 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 148 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 149 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 150 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 151 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 152 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 153 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 154 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 155 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 156 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 157 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 158 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 159 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 160 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 161 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 162 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 163 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 164 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 165 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.45 |
| Metatranscriptomes | 3.32 |
| Isolates | 9.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.74 |
| Nodule | 0 |
| Rhizoplane | 17.34 |
| Rhizosphere | 74.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496114_0175966 | 3300048917 | Bacteria | 1867 |
| 2 | JGI24735J21928_10052896 | 3300002067 | Bacteria | 1171 |
| 3 | rootH1_10071426 | 3300003323 | Bacteria | 1952 |
| 4 | Ga0006562J51391_1006995 | 3300003578 | Bacteria | 4600 |
| 5 | Ga0070658_10008053 | 3300005327 | Bacteria | 8474 |
| 6 | Ga0070658_10073698 | 3300005327 | Bacteria | 2800 |
| 7 | Ga0070658_10300087 | 3300005327 | Bacteria | 1370 |
| 8 | Ga0070683_100035422 | 3300005329 | Bacteria | 4563 |
| 9 | Ga0070683_100116922 | 3300005329 | Bacteria | 2518 |
| 10 | Ga0070683_100118822 | 3300005329 | Bacteria | 2496 |
| 11 | Ga0070683_100149294 | 3300005329 | Bacteria | 2216 |
| 12 | Ga0070683_100350975 | 3300005329 | Bacteria | 1405 |
| 13 | Ga0070683_100379052 | 3300005329 | Bacteria | 1348 |
| 14 | Ga0070683_100403507 | 3300005329 | Bacteria | 1304 |
| 15 | Ga0070682_100045202 | 3300005337 | Bacteria | 2729 |
| 16 | Ga0070660_100362369 | 3300005339 | Bacteria | 1195 |
| 17 | Ga0070668_100466144 | 3300005347 | Bacteria | 1089 |
| 18 | Ga0070678_100396725 | 3300005456 | Bacteria | 1197 |
| 19 | Ga0070681_10075573 | 3300005458 | Bacteria | 3329 |
| 20 | Ga0070681_10279086 | 3300005458 | Bacteria | 1581 |
| 21 | Ga0070679_100013030 | 3300005530 | Bacteria | 7962 |
| 22 | Ga0070679_100270389 | 3300005530 | Bacteria | 1654 |
| 23 | Ga0070684_100080271 | 3300005535 | Bacteria | 2886 |
| 24 | Ga0070672_100252906 | 3300005543 | Bacteria | 1484 |
| 25 | Ga0070696_100017504 | 3300005546 | Bacteria | 4837 |
| 26 | Ga0068852_100569292 | 3300005616 | Bacteria | 1135 |
| 27 | Ga0068859_100294197 | 3300005617 | Bacteria | 1717 |
| 28 | Ga0068864_100122492 | 3300005618 | Bacteria | 2327 |
| 29 | Ga0097621_100410420 | 3300006237 | Bacteria | 1214 |
| 30 | Ga0068865_100042794 | 3300006881 | Bacteria | 3091 |
| 31 | Ga0097620_100294194 | 3300006931 | Bacteria | 1717 |
| 32 | Ga0105245_10052355 | 3300009098 | Bacteria | 3661 |
| 33 | Ga0105245_10090832 | 3300009098 | Bacteria | 2810 |
| 34 | Ga0105245_10353110 | 3300009098 | Bacteria | 1457 |
| 35 | Ga0105243_10005640 | 3300009148 | Bacteria | 9745 |
| 36 | Ga0105242_10015298 | 3300009176 | Bacteria | 5958 |
| 37 | Ga0105248_10118278 | 3300009177 | Bacteria | 2989 |
| 38 | Ga0105238_10409132 | 3300009551 | Bacteria | 1350 |
| 39 | Ga0105238_10660451 | 3300009551 | Bacteria | 1056 |
| 40 | Ga0105249_10098578 | 3300009553 | Bacteria | 2745 |
| 41 | Ga0105249_10431307 | 3300009553 | Bacteria | 1354 |
| 42 | Ga0105239_10296401 | 3300010375 | Bacteria | 1821 |
| 43 | Ga0105246_10377050 | 3300011119 | Bacteria | 1171 |
| 44 | Ga0157370_10103900 | 3300013104 | Bacteria | 2659 |
| 45 | Ga0163162_10298204 | 3300013306 | Bacteria | 1744 |
| 46 | Ga0157375_10022557 | 3300013308 | Bacteria | 5795 |
| 47 | Ga0157375_10038259 | 3300013308 | Bacteria | 4605 |
| 48 | Ga0157375_10095650 | 3300013308 | Bacteria | 3041 |
| 49 | Ga0157375_10129631 | 3300013308 | Bacteria | 2640 |
| 50 | Ga0157375_10212976 | 3300013308 | Bacteria | 2090 |
| 51 | Ga0163163_10020839 | 3300014325 | Bacteria | 6180 |
| 52 | Ga0163163_10353188 | 3300014325 | Bacteria | 1526 |
| 53 | Ga0157380_10117258 | 3300014326 | Bacteria | 2248 |
| 54 | Ga0157380_10245800 | 3300014326 | Bacteria | 1616 |
| 55 | Ga0157379_10216921 | 3300014968 | Bacteria | 1733 |
| 56 | Ga0157376_10210058 | 3300014969 | Bacteria | 1796 |
| 57 | Ga0157376_10366530 | 3300014969 | Bacteria | 1383 |
| 58 | Ga0163161_10012192 | 3300017792 | Bacteria | 5962 |
| 59 | Ga0197907_10429599 | 3300020069 | Bacteria | 1172 |
| 60 | Ga0197907_10654088 | 3300020069 | Bacteria | 2809 |
| 61 | Ga0206350_10943926 | 3300020080 | Bacteria | 1332 |
| 62 | Ga0206354_11507739 | 3300020081 | Bacteria | 1107 |
| 63 | Ga0206353_10794140 | 3300020082 | Bacteria | 1250 |
| 64 | Ga0206353_11900773 | 3300020082 | Bacteria | 2272 |
| 65 | Ga0224712_10025693 | 3300022467 | Bacteria | 2073 |
| 66 | Ga0207660_10286165 | 3300025917 | Bacteria | 1309 |
| 67 | Ga0207657_10160128 | 3300025919 | Bacteria | 1829 |
| 68 | Ga0207652_10015344 | 3300025921 | Bacteria | 6221 |
| 69 | Ga0207687_10063767 | 3300025927 | Bacteria | 2610 |
| 70 | Ga0207687_10079942 | 3300025927 | Bacteria | 2358 |
| 71 | Ga0207706_10667897 | 3300025933 | Bacteria | 889 |
| 72 | Ga0207686_10462313 | 3300025934 | Bacteria | 978 |
| 73 | Ga0207669_10210101 | 3300025937 | Bacteria | 1420 |
| 74 | Ga0207704_10408709 | 3300025938 | Bacteria | 1073 |
| 75 | Ga0207691_10044566 | 3300025940 | Bacteria | 4081 |
| 76 | Ga0207711_10058037 | 3300025941 | Bacteria | 3329 |
| 77 | Ga0207661_10067601 | 3300025944 | Bacteria | 2907 |
| 78 | Ga0207661_10094713 | 3300025944 | Bacteria | 2495 |
| 79 | Ga0207661_10113299 | 3300025944 | Bacteria | 2298 |
| 80 | Ga0207661_10454969 | 3300025944 | Bacteria | 1166 |
| 81 | Ga0207712_10069214 | 3300025961 | Bacteria | 2532 |
| 82 | Ga0207668_10052205 | 3300025972 | Bacteria | 2828 |
| 83 | Ga0207677_10049597 | 3300026023 | Bacteria | 2834 |
| 84 | Ga0207677_10138380 | 3300026023 | Bacteria | 1860 |
| 85 | Ga0207674_10077634 | 3300026116 | Bacteria | 3326 |
| 86 | Ga0207698_10321364 | 3300026142 | Bacteria | 1450 |
| 87 | Ga0316575_10002706 | 3300031665 | Bacteria | 5980 |
| 88 | Ga0316579_10017581 | 3300031691 | Bacteria | 3136 |
| 89 | Ga0316579_10144746 | 3300031691 | Bacteria | 1146 |
| 90 | Ga0316576_10000990 | 3300031727 | Bacteria | 14606 |
| 91 | Ga0316578_10000405 | 3300031728 | Bacteria | 14028 |
| 92 | Ga0316578_10009569 | 3300031728 | Bacteria | 4986 |
| 93 | Ga0316578_10041424 | 3300031728 | Bacteria | 2667 |
| 94 | Ga0316577_10014730 | 3300031733 | Bacteria | 4296 |
| 95 | Ga0316577_10056926 | 3300031733 | Bacteria | 2183 |
| 96 | Ga0316577_10173767 | 3300031733 | Bacteria | 1216 |
| 97 | Ga0307409_100166126 | 3300031995 | Bacteria | 1937 |
| 98 | Ga0307409_100727516 | 3300031995 | Bacteria | 994 |
| 99 | Ga0316583_10012671 | 3300032133 | Bacteria | 3042 |
| 100 | Ga0316583_10056613 | 3300032133 | Bacteria | 1377 |
| 101 | Ga0316585_10004779 | 3300032137 | Bacteria | 3795 |
| 102 | Ga0316585_10017257 | 3300032137 | Bacteria | 2181 |
| 103 | Ga0316580_10002265 | 3300032139 | Bacteria | 5265 |
| 104 | Ga0316574_0011508 | 3300035398 | Bacteria | 5029 |
| 105 | Ga0316574_0209928 | 3300035398 | Bacteria | 1249 |
| 106 | Ga0316574_0304219 | 3300035398 | Bacteria | 1013 |
| 107 | Ga0373937_0612305 | 3300036401 | Bacteria | 1034 |
| 108 | Ga0316582_0001546 | 3300036647 | Bacteria | 10199 |
| 109 | Ga0316582_0009891 | 3300036647 | Bacteria | 5197 |
| 110 | Ga0316584_0006572 | 3300036712 | Bacteria | 7875 |
| 111 | Ga0316584_0123689 | 3300036712 | Bacteria | 1932 |
| 112 | Ga0316584_0204794 | 3300036712 | Bacteria | 1454 |
| 113 | Ga0395900_0140193 | 3300037418 | Bacteria | 2476 |
| 114 | Ga0395900_0411197 | 3300037418 | Bacteria | 1315 |
| 115 | Ga0395898_0080878 | 3300037466 | Bacteria | 3133 |
| 116 | Ga0395901_0004635 | 3300038443 | Bacteria | 13872 |
| 117 | Ga0395901_0023376 | 3300038443 | Bacteria | 6335 |
| 118 | Ga0395901_0040909 | 3300038443 | Bacteria | 4801 |
| 119 | Ga0395901_0142129 | 3300038443 | Bacteria | 2522 |
| 120 | Ga0395901_0712333 | 3300038443 | Bacteria | 1000 |
| 121 | Ga0466961_0403789 | 3300044693 | Bacteria | 829 |
| 122 | Ga0466960_0011906 | 3300044901 | Bacteria | 3658 |
| 123 | Ga0495641_0075765 | 3300046461 | Bacteria | 1508 |
| 124 | Ga0495653_0285574 | 3300046463 | Bacteria | 1081 |
| 125 | Ga0495582_0032633 | 3300046473 | Bacteria | 2863 |
| 126 | Ga0495582_0111228 | 3300046473 | Bacteria | 1538 |
| 127 | Ga0495639_0255444 | 3300046475 | Bacteria | 867 |
| 128 | Ga0495664_0177035 | 3300046477 | Bacteria | 1294 |
| 129 | Ga0495608_0351222 | 3300046511 | Bacteria | 907 |
| 130 | Ga0495632_0051233 | 3300046519 | Bacteria | 2033 |
| 131 | Ga0495645_0226981 | 3300046543 | Bacteria | 1253 |
| 132 | Ga0495658_0081502 | 3300046683 | Bacteria | 1900 |
| 133 | Ga0495658_0237224 | 3300046683 | Bacteria | 1145 |
| 134 | Ga0495658_0358568 | 3300046683 | Bacteria | 927 |
| 135 | Ga0495581_0091290 | 3300047315 | Bacteria | 1767 |
| 136 | Ga0495581_0191389 | 3300047315 | Bacteria | 1196 |
| 137 | Ga0495676_0129320 | 3300047321 | Bacteria | 1826 |
| 138 | Ga0495680_0208368 | 3300047322 | Bacteria | 1400 |
| 139 | Ga0496100_0037362 | 3300048903 | Bacteria | 3070 |
| 140 | Ga0496100_0047872 | 3300048903 | Bacteria | 2757 |
| 141 | Ga0496100_0147077 | 3300048903 | Bacteria | 1677 |
| 142 | Ga0496101_0001413 | 3300048904 | Bacteria | 14365 |
| 143 | Ga0496101_0081071 | 3300048904 | Bacteria | 2399 |
| 144 | Ga0496101_0099003 | 3300048904 | Bacteria | 2179 |
| 145 | Ga0496101_0223060 | 3300048904 | Bacteria | 1463 |
| 146 | Ga0496101_0405694 | 3300048904 | Bacteria | 1073 |
| 147 | Ga0496102_0002010 | 3300048905 | Bacteria | 17559 |
| 148 | Ga0496102_0004618 | 3300048905 | Bacteria | 11653 |
| 149 | Ga0496102_0492523 | 3300048905 | Bacteria | 1147 |
| 150 | Ga0496102_0610040 | 3300048905 | Bacteria | 1014 |
| 151 | Ga0496103_0002957 | 3300048906 | Bacteria | 10533 |
| 152 | Ga0496103_0012638 | 3300048906 | Bacteria | 5008 |
| 153 | Ga0496104_0039375 | 3300048907 | Bacteria | 4426 |
| 154 | Ga0496104_0061878 | 3300048907 | Bacteria | 3549 |
| 155 | Ga0496104_0143769 | 3300048907 | Bacteria | 2291 |
| 156 | Ga0496105_0044244 | 3300048908 | Bacteria | 3672 |
| 157 | Ga0496105_0049911 | 3300048908 | Bacteria | 3456 |
| 158 | Ga0496105_0059158 | 3300048908 | Bacteria | 3162 |
| 159 | Ga0496106_0113991 | 3300048909 | Bacteria | 2108 |
| 160 | Ga0496106_0186269 | 3300048909 | Bacteria | 1649 |
| 161 | Ga0496107_0139501 | 3300048910 | Bacteria | 1792 |
| 162 | Ga0496108_0163840 | 3300048911 | Bacteria | 1922 |
| 163 | Ga0496108_0281716 | 3300048911 | Bacteria | 1447 |
| 164 | Ga0496109_0046824 | 3300048912 | Bacteria | 3929 |
| 165 | Ga0496109_0056596 | 3300048912 | Bacteria | 3578 |
| 166 | Ga0496109_0073324 | 3300048912 | Bacteria | 3146 |
| 167 | Ga0496109_0173865 | 3300048912 | Bacteria | 2021 |
| 168 | Ga0496109_0265384 | 3300048912 | Bacteria | 1617 |
| 169 | Ga0496110_0052176 | 3300048913 | Bacteria | 3594 |
| 170 | Ga0496110_0198626 | 3300048913 | Bacteria | 1822 |
| 171 | Ga0496110_0611109 | 3300048913 | Bacteria | 988 |
| 172 | Ga0496111_0016121 | 3300048914 | Bacteria | 5147 |
| 173 | Ga0496111_0044131 | 3300048914 | Bacteria | 3204 |
| 174 | Ga0496111_0066138 | 3300048914 | Bacteria | 2624 |
| 175 | Ga0496112_0133233 | 3300048915 | Bacteria | 2456 |
| 176 | Ga0496112_0265419 | 3300048915 | Bacteria | 1666 |
| 177 | Ga0496113_0099316 | 3300048916 | Bacteria | 2254 |
| 178 | Ga0496113_0224789 | 3300048916 | Bacteria | 1496 |
| 179 | Ga0496114_0007032 | 3300048917 | Bacteria | 8878 |
| 180 | Ga0496114_0017594 | 3300048917 | Bacteria | 5772 |
| 181 | Ga0496114_0022749 | 3300048917 | Bacteria | 5109 |
| 182 | Ga0496114_0099055 | 3300048917 | Bacteria | 2486 |
| 183 | Ga0496114_0185463 | 3300048917 | Bacteria | 1818 |
| 184 | Ga0496115_0084055 | 3300048918 | Bacteria | 2595 |
| 185 | Ga0496119_0199954 | 3300048922 | Bacteria | 1035 |
| 186 | Ga0496125_0173558 | 3300048928 | Bacteria | 1446 |
| 187 | Ga0501031_0005900 | 3300049568 | Bacteria | 7979 |
| 188 | Ga0501031_0021206 | 3300049568 | Bacteria | 4236 |
| 189 | Ga0501031_0200636 | 3300049568 | Bacteria | 1302 |
| 190 | Ga0501033_0053278 | 3300049570 | Bacteria | 2996 |
| 191 | Ga0501036_0001393 | 3300049572 | Bacteria | 18583 |
| 192 | Ga0501036_0561076 | 3300049572 | Bacteria | 948 |
| 193 | Ga0501037_0038294 | 3300049573 | Bacteria | 3533 |
| 194 | Ga0501038_0012511 | 3300049574 | Bacteria | 7754 |
| 195 | Ga0501038_0034937 | 3300049574 | Bacteria | 4418 |
| 196 | Ga0501038_0514159 | 3300049574 | Bacteria | 914 |
| 197 | Ga0501039_0099899 | 3300049575 | Bacteria | 2264 |
| 198 | Ga0501039_0246810 | 3300049575 | Bacteria | 1404 |
| 199 | Ga0501040_0000488 | 3300049576 | Bacteria | 23676 |
| 200 | Ga0501041_0001193 | 3300049577 | Bacteria | 14188 |
| 201 | Ga0501041_0286760 | 3300049577 | Bacteria | 1036 |
| 202 | Ga0501042_0084592 | 3300049578 | Bacteria | 2274 |
| 203 | Ga0501043_0035170 | 3300049579 | Bacteria | 3941 |
| 204 | Ga0501046_0025288 | 3300049580 | Bacteria | 4860 |
| 205 | Ga0501046_0104637 | 3300049580 | Bacteria | 2169 |
| 206 | Ga0501048_0286543 | 3300049582 | Bacteria | 1171 |
| 207 | Ga0501048_0447036 | 3300049582 | Bacteria | 925 |
| 208 | Ga0501069_0051470 | 3300049585 | Bacteria | 2292 |
| 209 | Ga0501069_0142572 | 3300049585 | Bacteria | 1375 |
| 210 | Ga0501070_0237355 | 3300049586 | Bacteria | 1493 |
| 211 | Ga0501070_0299032 | 3300049586 | Bacteria | 1311 |
| 212 | Ga0501071_0019784 | 3300049587 | Bacteria | 4674 |
| 213 | Ga0501071_0266411 | 3300049587 | Bacteria | 1294 |
| 214 | Ga0501072_0009342 | 3300049588 | Bacteria | 7453 |
| 215 | Ga0501072_0305764 | 3300049588 | Bacteria | 1264 |
| 216 | Ga0501073_0034180 | 3300049589 | Bacteria | 3619 |
| 217 | Ga0501073_0168805 | 3300049589 | Bacteria | 1515 |
| 218 | Ga0501074_0017224 | 3300049590 | Bacteria | 5243 |
| 219 | Ga0501074_0075099 | 3300049590 | Bacteria | 2427 |
| 220 | Ga0501075_0008855 | 3300049591 | Bacteria | 7016 |
| 221 | Ga0501075_0057936 | 3300049591 | Bacteria | 2917 |
| 222 | Ga0501076_0007041 | 3300049592 | Bacteria | 8168 |
| 223 | Ga0501076_0011392 | 3300049592 | Bacteria | 6621 |
| 224 | Ga0501077_0013039 | 3300049593 | Bacteria | 5208 |
| 225 | Ga0501079_0004280 | 3300049741 | Bacteria | 10590 |
| 226 | Ga0501079_0025502 | 3300049741 | Bacteria | 4533 |
| 227 | Ga0501080_0092287 | 3300049742 | Bacteria | 2812 |
| 228 | Ga0501081_0010971 | 3300049743 | Bacteria | 5922 |
| 229 | Ga0501083_0200474 | 3300049744 | Bacteria | 1302 |
| 230 | Ga0501044_0374864 | 3300049823 | Bacteria | 1339 |
| 231 | Ga0501045_0008794 | 3300049824 | Bacteria | 7049 |
| 232 | Ga0501045_0011253 | 3300049824 | Bacteria | 6279 |
| 233 | Ga0501045_0140678 | 3300049824 | Bacteria | 1794 |
| 234 | Ga0501045_0154959 | 3300049824 | Bacteria | 1705 |
| 235 | Ga0501045_0265047 | 3300049824 | Bacteria | 1279 |
| 236 | Ga0495655_0075112 | 3300053083 | Bacteria | 954 |
| 237 | Ga0495619_0269023 | 3300053085 | Bacteria | 1181 |
| 238 | Ga0500643_000507 | 3300053087 | Bacteria | 27797 |
| 239 | Ga0500616_0016781 | 3300053153 | Bacteria | 4161 |
| 240 | Ga0501084_0043786 | 3300054114 | Bacteria | 3745 |
| 241 | Ga0501084_0249291 | 3300054114 | Bacteria | 1499 |
| 242 | Ga0587070_006206 | 3300059491 | Bacteria | 1602 |
| 243 | Ga0501082_0034035 | 3300060353 | Bacteria | 4395 |
| 244 | Ga0501082_0045012 | 3300060353 | Bacteria | 3806 |
| 245 | Ga0530510_0002699 | 3300061734 | Bacteria | 12206 |
| 246 | Ga0530510_0359498 | 3300061734 | Bacteria | 1094 |
| 247 | 2585299838 | 2582581312 | Bacteria | 7308206 |
| 248 | 2643850474 | 2643221567 | Bacteria | 4163945 |
| 249 | 2644134231 | 2643221624 | Bacteria | 4384879 |
| 250 | 2644446203 | 2643221679 | Bacteria | 3839507 |
| 251 | 2644609440 | 2643221711 | Bacteria | 4865335 |
| 252 | 2676488033 | 2675903060 | Bacteria | 10051191 |
| 253 | 2731908036 | 2731639228 | Bacteria | 4187555 |
| 254 | 2784471948 | 2784132109 | Bacteria | 3141763 |
| 255 | 2799184124 | 2799112218 | Bacteria | 4315149 |
| 256 | 2812374649 | 2811994882 | Bacteria | 4688362 |
| 257 | 2819427249 | 2818991318 | Bacteria | 5266538 |
| 258 | 2819666273 | 2818991458 | Bacteria | 4794049 |
| 259 | 2819693107 | 2818991462 | Bacteria | 4320267 |
| 260 | 2819730253 | 2818991469 | Bacteria | 4644110 |
| 261 | 2856743605 | 2856741275 | Bacteria | 8096094 |
| 262 | 2873320928 | 2873314349 | Bacteria | 8512634 |
| 263 | 2884697406 | 2884693830 | Bacteria | 11273186 |
| 264 | 2891397809 | 2891395885 | Bacteria | 9251614 |
| 265 | 2891554476 | 2891554331 | Bacteria | 8812224 |
| 266 | 2891564908 | 2891562705 | Bacteria | 8039471 |
| 267 | 2895430992 | 2895427314 | Bacteria | 13147766 |
| 268 | 2895452914 | 2895442618 | Bacteria | 11027144 |
| 269 | 2919449941 | 2919446982 | Bacteria | 3994487 |
| 270 | 8055070851 | 8055066027 | Bacteria | 9479577 |
| 271 | 8055179942 | 8055172936 | Bacteria | 9305943 |
| 272 | Ga0496114_0175966 | |||
| 273 | JGI24735J21928_10052896 | |||
| 274 | rootH1_10071426 | |||
| 275 | Ga0006562J51391_1006995 | |||
| 276 | Ga0070658_10008053 | |||
| 277 | Ga0070658_10073698 | |||
| 278 | Ga0070658_10300087 | |||
| 279 | Ga0070683_100035422 | |||
| 280 | Ga0070683_100116922 | |||
| 281 | Ga0070683_100118822 | |||
| 282 | Ga0070683_100149294 | |||
| 283 | Ga0070683_100350975 | |||
| 284 | Ga0070683_100379052 | |||
| 285 | Ga0070683_100403507 | |||
| 286 | Ga0070682_100045202 | |||
| 287 | Ga0070660_100362369 | |||
| 288 | Ga0070668_100466144 | |||
| 289 | Ga0070678_100396725 | |||
| 290 | Ga0070681_10075573 | |||
| 291 | Ga0070681_10279086 | |||
| 292 | Ga0070679_100013030 | |||
| 293 | Ga0070679_100270389 | |||
| 294 | Ga0070684_100080271 | |||
| 295 | Ga0070672_100252906 | |||
| 296 | Ga0070696_100017504 | |||
| 297 | Ga0068852_100569292 | |||
| 298 | Ga0068859_100294197 | |||
| 299 | Ga0068864_100122492 | |||
| 300 | Ga0097621_100410420 | |||
| 301 | Ga0068865_100042794 | |||
| 302 | Ga0097620_100294194 | |||
| 303 | Ga0105245_10052355 | |||
| 304 | Ga0105245_10090832 | |||
| 305 | Ga0105245_10353110 | |||
| 306 | Ga0105243_10005640 | |||
| 307 | Ga0105242_10015298 | |||
| 308 | Ga0105248_10118278 | |||
| 309 | Ga0105238_10409132 | |||
| 310 | Ga0105238_10660451 | |||
| 311 | Ga0105249_10098578 | |||
| 312 | Ga0105249_10431307 | |||
| 313 | Ga0105239_10296401 | |||
| 314 | Ga0105246_10377050 | |||
| 315 | Ga0157370_10103900 | |||
| 316 | Ga0163162_10298204 | |||
| 317 | Ga0157375_10022557 | |||
| 318 | Ga0157375_10038259 | |||
| 319 | Ga0157375_10095650 | |||
| 320 | Ga0157375_10129631 | |||
| 321 | Ga0157375_10212976 | |||
| 322 | Ga0163163_10020839 | |||
| 323 | Ga0163163_10353188 | |||
| 324 | Ga0157380_10117258 | |||
| 325 | Ga0157380_10245800 | |||
| 326 | Ga0157379_10216921 | |||
| 327 | Ga0157376_10210058 | |||
| 328 | Ga0157376_10366530 | |||
| 329 | Ga0163161_10012192 | |||
| 330 | Ga0197907_10429599 | |||
| 331 | Ga0197907_10654088 | |||
| 332 | Ga0206350_10943926 | |||
| 333 | Ga0206354_11507739 | |||
| 334 | Ga0206353_10794140 | |||
| 335 | Ga0206353_11900773 | |||
| 336 | Ga0224712_10025693 | |||
| 337 | Ga0207660_10286165 | |||
| 338 | Ga0207657_10160128 | |||
| 339 | Ga0207652_10015344 | |||
| 340 | Ga0207687_10063767 | |||
| 341 | Ga0207687_10079942 | |||
| 342 | Ga0207706_10667897 | |||
| 343 | Ga0207686_10462313 | |||
| 344 | Ga0207669_10210101 | |||
| 345 | Ga0207704_10408709 | |||
| 346 | Ga0207691_10044566 | |||
| 347 | Ga0207711_10058037 | |||
| 348 | Ga0207661_10067601 | |||
| 349 | Ga0207661_10094713 | |||
| 350 | Ga0207661_10113299 | |||
| 351 | Ga0207661_10454969 | |||
| 352 | Ga0207712_10069214 | |||
| 353 | Ga0207668_10052205 | |||
| 354 | Ga0207677_10049597 | |||
| 355 | Ga0207677_10138380 | |||
| 356 | Ga0207674_10077634 | |||
| 357 | Ga0207698_10321364 | |||
| 358 | Ga0316575_10002706 | |||
| 359 | Ga0316579_10017581 | |||
| 360 | Ga0316579_10144746 | |||
| 361 | Ga0316576_10000990 | |||
| 362 | Ga0316578_10000405 | |||
| 363 | Ga0316578_10009569 | |||
| 364 | Ga0316578_10041424 | |||
| 365 | Ga0316577_10014730 | |||
| 366 | Ga0316577_10056926 | |||
| 367 | Ga0316577_10173767 | |||
| 368 | Ga0307409_100166126 | |||
| 369 | Ga0307409_100727516 | |||
| 370 | Ga0316583_10012671 | |||
| 371 | Ga0316583_10056613 | |||
| 372 | Ga0316585_10004779 | |||
| 373 | Ga0316585_10017257 | |||
| 374 | Ga0316580_10002265 | |||
| 375 | Ga0316574_0011508 | |||
| 376 | Ga0316574_0209928 | |||
| 377 | Ga0316574_0304219 | |||
| 378 | Ga0373937_0612305 | |||
| 379 | Ga0316582_0001546 | |||
| 380 | Ga0316582_0009891 | |||
| 381 | Ga0316584_0006572 | |||
| 382 | Ga0316584_0123689 | |||
| 383 | Ga0316584_0204794 | |||
| 384 | Ga0395900_0140193 | |||
| 385 | Ga0395900_0411197 | |||
| 386 | Ga0395898_0080878 | |||
| 387 | Ga0395901_0004635 | |||
| 388 | Ga0395901_0023376 | |||
| 389 | Ga0395901_0040909 | |||
| 390 | Ga0395901_0142129 | |||
| 391 | Ga0395901_0712333 | |||
| 392 | Ga0466961_0403789 | |||
| 393 | Ga0466960_0011906 | |||
| 394 | Ga0495641_0075765 | |||
| 395 | Ga0495653_0285574 | |||
| 396 | Ga0495582_0032633 | |||
| 397 | Ga0495582_0111228 | |||
| 398 | Ga0495639_0255444 | |||
| 399 | Ga0495664_0177035 | |||
| 400 | Ga0495608_0351222 | |||
| 401 | Ga0495632_0051233 | |||
| 402 | Ga0495645_0226981 | |||
| 403 | Ga0495658_0081502 | |||
| 404 | Ga0495658_0237224 | |||
| 405 | Ga0495658_0358568 | |||
| 406 | Ga0495581_0091290 | |||
| 407 | Ga0495581_0191389 | |||
| 408 | Ga0495676_0129320 | |||
| 409 | Ga0495680_0208368 | |||
| 410 | Ga0496100_0037362 | |||
| 411 | Ga0496100_0047872 | |||
| 412 | Ga0496100_0147077 | |||
| 413 | Ga0496101_0001413 | |||
| 414 | Ga0496101_0081071 | |||
| 415 | Ga0496101_0099003 | |||
| 416 | Ga0496101_0223060 | |||
| 417 | Ga0496101_0405694 | |||
| 418 | Ga0496102_0002010 | |||
| 419 | Ga0496102_0004618 | |||
| 420 | Ga0496102_0492523 | |||
| 421 | Ga0496102_0610040 | |||
| 422 | Ga0496103_0002957 | |||
| 423 | Ga0496103_0012638 | |||
| 424 | Ga0496104_0039375 | |||
| 425 | Ga0496104_0061878 | |||
| 426 | Ga0496104_0143769 | |||
| 427 | Ga0496105_0044244 | |||
| 428 | Ga0496105_0049911 | |||
| 429 | Ga0496105_0059158 | |||
| 430 | Ga0496106_0113991 | |||
| 431 | Ga0496106_0186269 | |||
| 432 | Ga0496107_0139501 | |||
| 433 | Ga0496108_0163840 | |||
| 434 | Ga0496108_0281716 | |||
| 435 | Ga0496109_0046824 | |||
| 436 | Ga0496109_0056596 | |||
| 437 | Ga0496109_0073324 | |||
| 438 | Ga0496109_0173865 | |||
| 439 | Ga0496109_0265384 | |||
| 440 | Ga0496110_0052176 | |||
| 441 | Ga0496110_0198626 | |||
| 442 | Ga0496110_0611109 | |||
| 443 | Ga0496111_0016121 | |||
| 444 | Ga0496111_0044131 | |||
| 445 | Ga0496111_0066138 | |||
| 446 | Ga0496112_0133233 | |||
| 447 | Ga0496112_0265419 | |||
| 448 | Ga0496113_0099316 | |||
| 449 | Ga0496113_0224789 | |||
| 450 | Ga0496114_0007032 | |||
| 451 | Ga0496114_0017594 | |||
| 452 | Ga0496114_0022749 | |||
| 453 | Ga0496114_0099055 | |||
| 454 | Ga0496114_0185463 | |||
| 455 | Ga0496115_0084055 | |||
| 456 | Ga0496119_0199954 | |||
| 457 | Ga0496125_0173558 | |||
| 458 | Ga0501031_0005900 | |||
| 459 | Ga0501031_0021206 | |||
| 460 | Ga0501031_0200636 | |||
| 461 | Ga0501033_0053278 | |||
| 462 | Ga0501036_0001393 | |||
| 463 | Ga0501036_0561076 | |||
| 464 | Ga0501037_0038294 | |||
| 465 | Ga0501038_0012511 | |||
| 466 | Ga0501038_0034937 | |||
| 467 | Ga0501038_0514159 | |||
| 468 | Ga0501039_0099899 | |||
| 469 | Ga0501039_0246810 | |||
| 470 | Ga0501040_0000488 | |||
| 471 | Ga0501041_0001193 | |||
| 472 | Ga0501041_0286760 | |||
| 473 | Ga0501042_0084592 | |||
| 474 | Ga0501043_0035170 | |||
| 475 | Ga0501046_0025288 | |||
| 476 | Ga0501046_0104637 | |||
| 477 | Ga0501048_0286543 | |||
| 478 | Ga0501048_0447036 | |||
| 479 | Ga0501069_0051470 | |||
| 480 | Ga0501069_0142572 | |||
| 481 | Ga0501070_0237355 | |||
| 482 | Ga0501070_0299032 | |||
| 483 | Ga0501071_0019784 | |||
| 484 | Ga0501071_0266411 | |||
| 485 | Ga0501072_0009342 | |||
| 486 | Ga0501072_0305764 | |||
| 487 | Ga0501073_0034180 | |||
| 488 | Ga0501073_0168805 | |||
| 489 | Ga0501074_0017224 | |||
| 490 | Ga0501074_0075099 | |||
| 491 | Ga0501075_0008855 | |||
| 492 | Ga0501075_0057936 | |||
| 493 | Ga0501076_0007041 | |||
| 494 | Ga0501076_0011392 | |||
| 495 | Ga0501077_0013039 | |||
| 496 | Ga0501079_0004280 | |||
| 497 | Ga0501079_0025502 | |||
| 498 | Ga0501080_0092287 | |||
| 499 | Ga0501081_0010971 | |||
| 500 | Ga0501083_0200474 | |||
| 501 | Ga0501044_0374864 | |||
| 502 | Ga0501045_0008794 | |||
| 503 | Ga0501045_0011253 | |||
| 504 | Ga0501045_0140678 | |||
| 505 | Ga0501045_0154959 | |||
| 506 | Ga0501045_0265047 | |||
| 507 | Ga0495655_0075112 | |||
| 508 | Ga0495619_0269023 | |||
| 509 | Ga0500643_000507 | |||
| 510 | Ga0500616_0016781 | |||
| 511 | Ga0501084_0043786 | |||
| 512 | Ga0501084_0249291 | |||
| 513 | Ga0587070_006206 | |||
| 514 | Ga0501082_0034035 | |||
| 515 | Ga0501082_0045012 | |||
| 516 | Ga0530510_0002699 | |||
| 517 | Ga0530510_0359498 | |||
| 518 | 2585299838 | |||
| 519 | 2643850474 | |||
| 520 | 2644134231 | |||
| 521 | 2644446203 | |||
| 522 | 2644609440 | |||
| 523 | 2676488033 | |||
| 524 | 2731908036 | |||
| 525 | 2784471948 | |||
| 526 | 2799184124 | |||
| 527 | 2812374649 | |||
| 528 | 2819427249 | |||
| 529 | 2819666273 | |||
| 530 | 2819693107 | |||
| 531 | 2819730253 | |||
| 532 | 2856743605 | |||
| 533 | 2873320928 | |||
| 534 | 2884697406 | |||
| 535 | 2891397809 | |||
| 536 | 2891554476 | |||
| 537 | 2891564908 | |||
| 538 | 2895430992 | |||
| 539 | 2895452914 | |||
| 540 | 2919449941 | |||
| 541 | 8055070851 | |||
| 542 | 8055179942 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dii-assembly1.cif.gz_D | crystal structure of p-cresol methylhydroxylase at 2.5 a resolution | 0.8315 | 145 | 214 |
| 7e1x-assembly1.cif.gz_O | cryo-em structure of hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv in presence of tb47 | 0.8068 | 47 | 254 |
| 7qhm-assembly1.cif.gz_C | cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) | 0.8055 | 45 | 255 |
| 6adq-assembly1.cif.gz_C | respiratory complex ciii2civ2sod2 from mycobacterium smegmatis | 0.8054 | 45 | 255 |
| 6lod-assembly1.cif.gz_E | cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii | 0.7986 | 142 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP35_148_241_1.10.760.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9364 | 136 | 220 | 1.10.760.10 |
| af_P9WP35_148_241_1.10.760.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8418 | 136 | 220 | 1.10.760.10 |
| 3dp5A00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7557 | 145 | 217 | 1.10.760.10 |
| 1wveC00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7396 | 136 | 214 | 1.10.760.10 |
| 5mcsA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7253 | 144 | 216 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6I075-F1-model_v4 | Cystathionine beta-lyase | 0.9421 | 43 | 207 |
GO:0009055
GO:0016829 GO:0020037 GO:0046872 |
| AF-A0A2D6I075-F1-model_v4 | Cystathionine beta-lyase | 0.9204 | 43 | 207 |
GO:0009055
GO:0016829 GO:0020037 GO:0046872 |
| AF-A0A4R4KTG3-F1-model_v4 | C-type cytochrome | 0.9051 | 54 | 196 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A3D3BQT2-F1-model_v4 | Cystathionine beta-lyase | 0.8952 | 43 | 164 |
GO:0009055
GO:0016829 GO:0020037 GO:0046872 |
| AF-A0A538B2Y7-F1-model_v4 | Cytochrome c | 0.8905 | 49 | 154 |
GO:0009055
GO:0020037 GO:0046872 |