F377926

General Info

Members Datasets Scaffolds Average Seq Length
271 165 542 256

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0175966|Ga0496114_0175966_665_1564
Length 286
Sequence VDRAVRDDLHPALTPSLTEPTDDHLGRQDRTVNALAARGLLVTGGAYSFFAPKDANAAPTASADQLQEGRNLFLANCASCHGVNAEGTDSGPSLVGVGAASVDFQVSTGRMPLAGPNVQAPQNKVKFSEPEIAAMAAYVASLGAGPAIPEEKWTTVIPPGTPENNRAIATGGEIYRVNCAMCHNFAGAGGALTRGKYAPALNDATPRQIYEAMATGPQSMPVFNDRNISPEGKQQVISYLAAQSEQTNVGGFSLGNLGPVSEGLFAWVFGLGLLIAGAVWLGKKAA

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
60 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
141 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
142 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
143 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
144 2643221679 Angustibacter sp. Root456 Isolate Unclassified
145 2643221711 Terrabacter sp. Root85 Isolate Unclassified
146 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
147 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
148 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
149 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
150 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
151 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
152 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
153 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
154 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
155 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
156 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
157 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
158 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
159 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
160 2891562705 Microbispora tritici MT50 Isolate Unclassified
161 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
162 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
163 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
164 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
165 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.45
Metatranscriptomes 3.32
Isolates 9.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 17.34
Rhizosphere 74.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0175966 3300048917 Bacteria 1867
2 JGI24735J21928_10052896 3300002067 Bacteria 1171
3 rootH1_10071426 3300003323 Bacteria 1952
4 Ga0006562J51391_1006995 3300003578 Bacteria 4600
5 Ga0070658_10008053 3300005327 Bacteria 8474
6 Ga0070658_10073698 3300005327 Bacteria 2800
7 Ga0070658_10300087 3300005327 Bacteria 1370
8 Ga0070683_100035422 3300005329 Bacteria 4563
9 Ga0070683_100116922 3300005329 Bacteria 2518
10 Ga0070683_100118822 3300005329 Bacteria 2496
11 Ga0070683_100149294 3300005329 Bacteria 2216
12 Ga0070683_100350975 3300005329 Bacteria 1405
13 Ga0070683_100379052 3300005329 Bacteria 1348
14 Ga0070683_100403507 3300005329 Bacteria 1304
15 Ga0070682_100045202 3300005337 Bacteria 2729
16 Ga0070660_100362369 3300005339 Bacteria 1195
17 Ga0070668_100466144 3300005347 Bacteria 1089
18 Ga0070678_100396725 3300005456 Bacteria 1197
19 Ga0070681_10075573 3300005458 Bacteria 3329
20 Ga0070681_10279086 3300005458 Bacteria 1581
21 Ga0070679_100013030 3300005530 Bacteria 7962
22 Ga0070679_100270389 3300005530 Bacteria 1654
23 Ga0070684_100080271 3300005535 Bacteria 2886
24 Ga0070672_100252906 3300005543 Bacteria 1484
25 Ga0070696_100017504 3300005546 Bacteria 4837
26 Ga0068852_100569292 3300005616 Bacteria 1135
27 Ga0068859_100294197 3300005617 Bacteria 1717
28 Ga0068864_100122492 3300005618 Bacteria 2327
29 Ga0097621_100410420 3300006237 Bacteria 1214
30 Ga0068865_100042794 3300006881 Bacteria 3091
31 Ga0097620_100294194 3300006931 Bacteria 1717
32 Ga0105245_10052355 3300009098 Bacteria 3661
33 Ga0105245_10090832 3300009098 Bacteria 2810
34 Ga0105245_10353110 3300009098 Bacteria 1457
35 Ga0105243_10005640 3300009148 Bacteria 9745
36 Ga0105242_10015298 3300009176 Bacteria 5958
37 Ga0105248_10118278 3300009177 Bacteria 2989
38 Ga0105238_10409132 3300009551 Bacteria 1350
39 Ga0105238_10660451 3300009551 Bacteria 1056
40 Ga0105249_10098578 3300009553 Bacteria 2745
41 Ga0105249_10431307 3300009553 Bacteria 1354
42 Ga0105239_10296401 3300010375 Bacteria 1821
43 Ga0105246_10377050 3300011119 Bacteria 1171
44 Ga0157370_10103900 3300013104 Bacteria 2659
45 Ga0163162_10298204 3300013306 Bacteria 1744
46 Ga0157375_10022557 3300013308 Bacteria 5795
47 Ga0157375_10038259 3300013308 Bacteria 4605
48 Ga0157375_10095650 3300013308 Bacteria 3041
49 Ga0157375_10129631 3300013308 Bacteria 2640
50 Ga0157375_10212976 3300013308 Bacteria 2090
51 Ga0163163_10020839 3300014325 Bacteria 6180
52 Ga0163163_10353188 3300014325 Bacteria 1526
53 Ga0157380_10117258 3300014326 Bacteria 2248
54 Ga0157380_10245800 3300014326 Bacteria 1616
55 Ga0157379_10216921 3300014968 Bacteria 1733
56 Ga0157376_10210058 3300014969 Bacteria 1796
57 Ga0157376_10366530 3300014969 Bacteria 1383
58 Ga0163161_10012192 3300017792 Bacteria 5962
59 Ga0197907_10429599 3300020069 Bacteria 1172
60 Ga0197907_10654088 3300020069 Bacteria 2809
61 Ga0206350_10943926 3300020080 Bacteria 1332
62 Ga0206354_11507739 3300020081 Bacteria 1107
63 Ga0206353_10794140 3300020082 Bacteria 1250
64 Ga0206353_11900773 3300020082 Bacteria 2272
65 Ga0224712_10025693 3300022467 Bacteria 2073
66 Ga0207660_10286165 3300025917 Bacteria 1309
67 Ga0207657_10160128 3300025919 Bacteria 1829
68 Ga0207652_10015344 3300025921 Bacteria 6221
69 Ga0207687_10063767 3300025927 Bacteria 2610
70 Ga0207687_10079942 3300025927 Bacteria 2358
71 Ga0207706_10667897 3300025933 Bacteria 889
72 Ga0207686_10462313 3300025934 Bacteria 978
73 Ga0207669_10210101 3300025937 Bacteria 1420
74 Ga0207704_10408709 3300025938 Bacteria 1073
75 Ga0207691_10044566 3300025940 Bacteria 4081
76 Ga0207711_10058037 3300025941 Bacteria 3329
77 Ga0207661_10067601 3300025944 Bacteria 2907
78 Ga0207661_10094713 3300025944 Bacteria 2495
79 Ga0207661_10113299 3300025944 Bacteria 2298
80 Ga0207661_10454969 3300025944 Bacteria 1166
81 Ga0207712_10069214 3300025961 Bacteria 2532
82 Ga0207668_10052205 3300025972 Bacteria 2828
83 Ga0207677_10049597 3300026023 Bacteria 2834
84 Ga0207677_10138380 3300026023 Bacteria 1860
85 Ga0207674_10077634 3300026116 Bacteria 3326
86 Ga0207698_10321364 3300026142 Bacteria 1450
87 Ga0316575_10002706 3300031665 Bacteria 5980
88 Ga0316579_10017581 3300031691 Bacteria 3136
89 Ga0316579_10144746 3300031691 Bacteria 1146
90 Ga0316576_10000990 3300031727 Bacteria 14606
91 Ga0316578_10000405 3300031728 Bacteria 14028
92 Ga0316578_10009569 3300031728 Bacteria 4986
93 Ga0316578_10041424 3300031728 Bacteria 2667
94 Ga0316577_10014730 3300031733 Bacteria 4296
95 Ga0316577_10056926 3300031733 Bacteria 2183
96 Ga0316577_10173767 3300031733 Bacteria 1216
97 Ga0307409_100166126 3300031995 Bacteria 1937
98 Ga0307409_100727516 3300031995 Bacteria 994
99 Ga0316583_10012671 3300032133 Bacteria 3042
100 Ga0316583_10056613 3300032133 Bacteria 1377
101 Ga0316585_10004779 3300032137 Bacteria 3795
102 Ga0316585_10017257 3300032137 Bacteria 2181
103 Ga0316580_10002265 3300032139 Bacteria 5265
104 Ga0316574_0011508 3300035398 Bacteria 5029
105 Ga0316574_0209928 3300035398 Bacteria 1249
106 Ga0316574_0304219 3300035398 Bacteria 1013
107 Ga0373937_0612305 3300036401 Bacteria 1034
108 Ga0316582_0001546 3300036647 Bacteria 10199
109 Ga0316582_0009891 3300036647 Bacteria 5197
110 Ga0316584_0006572 3300036712 Bacteria 7875
111 Ga0316584_0123689 3300036712 Bacteria 1932
112 Ga0316584_0204794 3300036712 Bacteria 1454
113 Ga0395900_0140193 3300037418 Bacteria 2476
114 Ga0395900_0411197 3300037418 Bacteria 1315
115 Ga0395898_0080878 3300037466 Bacteria 3133
116 Ga0395901_0004635 3300038443 Bacteria 13872
117 Ga0395901_0023376 3300038443 Bacteria 6335
118 Ga0395901_0040909 3300038443 Bacteria 4801
119 Ga0395901_0142129 3300038443 Bacteria 2522
120 Ga0395901_0712333 3300038443 Bacteria 1000
121 Ga0466961_0403789 3300044693 Bacteria 829
122 Ga0466960_0011906 3300044901 Bacteria 3658
123 Ga0495641_0075765 3300046461 Bacteria 1508
124 Ga0495653_0285574 3300046463 Bacteria 1081
125 Ga0495582_0032633 3300046473 Bacteria 2863
126 Ga0495582_0111228 3300046473 Bacteria 1538
127 Ga0495639_0255444 3300046475 Bacteria 867
128 Ga0495664_0177035 3300046477 Bacteria 1294
129 Ga0495608_0351222 3300046511 Bacteria 907
130 Ga0495632_0051233 3300046519 Bacteria 2033
131 Ga0495645_0226981 3300046543 Bacteria 1253
132 Ga0495658_0081502 3300046683 Bacteria 1900
133 Ga0495658_0237224 3300046683 Bacteria 1145
134 Ga0495658_0358568 3300046683 Bacteria 927
135 Ga0495581_0091290 3300047315 Bacteria 1767
136 Ga0495581_0191389 3300047315 Bacteria 1196
137 Ga0495676_0129320 3300047321 Bacteria 1826
138 Ga0495680_0208368 3300047322 Bacteria 1400
139 Ga0496100_0037362 3300048903 Bacteria 3070
140 Ga0496100_0047872 3300048903 Bacteria 2757
141 Ga0496100_0147077 3300048903 Bacteria 1677
142 Ga0496101_0001413 3300048904 Bacteria 14365
143 Ga0496101_0081071 3300048904 Bacteria 2399
144 Ga0496101_0099003 3300048904 Bacteria 2179
145 Ga0496101_0223060 3300048904 Bacteria 1463
146 Ga0496101_0405694 3300048904 Bacteria 1073
147 Ga0496102_0002010 3300048905 Bacteria 17559
148 Ga0496102_0004618 3300048905 Bacteria 11653
149 Ga0496102_0492523 3300048905 Bacteria 1147
150 Ga0496102_0610040 3300048905 Bacteria 1014
151 Ga0496103_0002957 3300048906 Bacteria 10533
152 Ga0496103_0012638 3300048906 Bacteria 5008
153 Ga0496104_0039375 3300048907 Bacteria 4426
154 Ga0496104_0061878 3300048907 Bacteria 3549
155 Ga0496104_0143769 3300048907 Bacteria 2291
156 Ga0496105_0044244 3300048908 Bacteria 3672
157 Ga0496105_0049911 3300048908 Bacteria 3456
158 Ga0496105_0059158 3300048908 Bacteria 3162
159 Ga0496106_0113991 3300048909 Bacteria 2108
160 Ga0496106_0186269 3300048909 Bacteria 1649
161 Ga0496107_0139501 3300048910 Bacteria 1792
162 Ga0496108_0163840 3300048911 Bacteria 1922
163 Ga0496108_0281716 3300048911 Bacteria 1447
164 Ga0496109_0046824 3300048912 Bacteria 3929
165 Ga0496109_0056596 3300048912 Bacteria 3578
166 Ga0496109_0073324 3300048912 Bacteria 3146
167 Ga0496109_0173865 3300048912 Bacteria 2021
168 Ga0496109_0265384 3300048912 Bacteria 1617
169 Ga0496110_0052176 3300048913 Bacteria 3594
170 Ga0496110_0198626 3300048913 Bacteria 1822
171 Ga0496110_0611109 3300048913 Bacteria 988
172 Ga0496111_0016121 3300048914 Bacteria 5147
173 Ga0496111_0044131 3300048914 Bacteria 3204
174 Ga0496111_0066138 3300048914 Bacteria 2624
175 Ga0496112_0133233 3300048915 Bacteria 2456
176 Ga0496112_0265419 3300048915 Bacteria 1666
177 Ga0496113_0099316 3300048916 Bacteria 2254
178 Ga0496113_0224789 3300048916 Bacteria 1496
179 Ga0496114_0007032 3300048917 Bacteria 8878
180 Ga0496114_0017594 3300048917 Bacteria 5772
181 Ga0496114_0022749 3300048917 Bacteria 5109
182 Ga0496114_0099055 3300048917 Bacteria 2486
183 Ga0496114_0185463 3300048917 Bacteria 1818
184 Ga0496115_0084055 3300048918 Bacteria 2595
185 Ga0496119_0199954 3300048922 Bacteria 1035
186 Ga0496125_0173558 3300048928 Bacteria 1446
187 Ga0501031_0005900 3300049568 Bacteria 7979
188 Ga0501031_0021206 3300049568 Bacteria 4236
189 Ga0501031_0200636 3300049568 Bacteria 1302
190 Ga0501033_0053278 3300049570 Bacteria 2996
191 Ga0501036_0001393 3300049572 Bacteria 18583
192 Ga0501036_0561076 3300049572 Bacteria 948
193 Ga0501037_0038294 3300049573 Bacteria 3533
194 Ga0501038_0012511 3300049574 Bacteria 7754
195 Ga0501038_0034937 3300049574 Bacteria 4418
196 Ga0501038_0514159 3300049574 Bacteria 914
197 Ga0501039_0099899 3300049575 Bacteria 2264
198 Ga0501039_0246810 3300049575 Bacteria 1404
199 Ga0501040_0000488 3300049576 Bacteria 23676
200 Ga0501041_0001193 3300049577 Bacteria 14188
201 Ga0501041_0286760 3300049577 Bacteria 1036
202 Ga0501042_0084592 3300049578 Bacteria 2274
203 Ga0501043_0035170 3300049579 Bacteria 3941
204 Ga0501046_0025288 3300049580 Bacteria 4860
205 Ga0501046_0104637 3300049580 Bacteria 2169
206 Ga0501048_0286543 3300049582 Bacteria 1171
207 Ga0501048_0447036 3300049582 Bacteria 925
208 Ga0501069_0051470 3300049585 Bacteria 2292
209 Ga0501069_0142572 3300049585 Bacteria 1375
210 Ga0501070_0237355 3300049586 Bacteria 1493
211 Ga0501070_0299032 3300049586 Bacteria 1311
212 Ga0501071_0019784 3300049587 Bacteria 4674
213 Ga0501071_0266411 3300049587 Bacteria 1294
214 Ga0501072_0009342 3300049588 Bacteria 7453
215 Ga0501072_0305764 3300049588 Bacteria 1264
216 Ga0501073_0034180 3300049589 Bacteria 3619
217 Ga0501073_0168805 3300049589 Bacteria 1515
218 Ga0501074_0017224 3300049590 Bacteria 5243
219 Ga0501074_0075099 3300049590 Bacteria 2427
220 Ga0501075_0008855 3300049591 Bacteria 7016
221 Ga0501075_0057936 3300049591 Bacteria 2917
222 Ga0501076_0007041 3300049592 Bacteria 8168
223 Ga0501076_0011392 3300049592 Bacteria 6621
224 Ga0501077_0013039 3300049593 Bacteria 5208
225 Ga0501079_0004280 3300049741 Bacteria 10590
226 Ga0501079_0025502 3300049741 Bacteria 4533
227 Ga0501080_0092287 3300049742 Bacteria 2812
228 Ga0501081_0010971 3300049743 Bacteria 5922
229 Ga0501083_0200474 3300049744 Bacteria 1302
230 Ga0501044_0374864 3300049823 Bacteria 1339
231 Ga0501045_0008794 3300049824 Bacteria 7049
232 Ga0501045_0011253 3300049824 Bacteria 6279
233 Ga0501045_0140678 3300049824 Bacteria 1794
234 Ga0501045_0154959 3300049824 Bacteria 1705
235 Ga0501045_0265047 3300049824 Bacteria 1279
236 Ga0495655_0075112 3300053083 Bacteria 954
237 Ga0495619_0269023 3300053085 Bacteria 1181
238 Ga0500643_000507 3300053087 Bacteria 27797
239 Ga0500616_0016781 3300053153 Bacteria 4161
240 Ga0501084_0043786 3300054114 Bacteria 3745
241 Ga0501084_0249291 3300054114 Bacteria 1499
242 Ga0587070_006206 3300059491 Bacteria 1602
243 Ga0501082_0034035 3300060353 Bacteria 4395
244 Ga0501082_0045012 3300060353 Bacteria 3806
245 Ga0530510_0002699 3300061734 Bacteria 12206
246 Ga0530510_0359498 3300061734 Bacteria 1094
247 2585299838 2582581312 Bacteria 7308206
248 2643850474 2643221567 Bacteria 4163945
249 2644134231 2643221624 Bacteria 4384879
250 2644446203 2643221679 Bacteria 3839507
251 2644609440 2643221711 Bacteria 4865335
252 2676488033 2675903060 Bacteria 10051191
253 2731908036 2731639228 Bacteria 4187555
254 2784471948 2784132109 Bacteria 3141763
255 2799184124 2799112218 Bacteria 4315149
256 2812374649 2811994882 Bacteria 4688362
257 2819427249 2818991318 Bacteria 5266538
258 2819666273 2818991458 Bacteria 4794049
259 2819693107 2818991462 Bacteria 4320267
260 2819730253 2818991469 Bacteria 4644110
261 2856743605 2856741275 Bacteria 8096094
262 2873320928 2873314349 Bacteria 8512634
263 2884697406 2884693830 Bacteria 11273186
264 2891397809 2891395885 Bacteria 9251614
265 2891554476 2891554331 Bacteria 8812224
266 2891564908 2891562705 Bacteria 8039471
267 2895430992 2895427314 Bacteria 13147766
268 2895452914 2895442618 Bacteria 11027144
269 2919449941 2919446982 Bacteria 3994487
270 8055070851 8055066027 Bacteria 9479577
271 8055179942 8055172936 Bacteria 9305943
272 Ga0496114_0175966
273 JGI24735J21928_10052896
274 rootH1_10071426
275 Ga0006562J51391_1006995
276 Ga0070658_10008053
277 Ga0070658_10073698
278 Ga0070658_10300087
279 Ga0070683_100035422
280 Ga0070683_100116922
281 Ga0070683_100118822
282 Ga0070683_100149294
283 Ga0070683_100350975
284 Ga0070683_100379052
285 Ga0070683_100403507
286 Ga0070682_100045202
287 Ga0070660_100362369
288 Ga0070668_100466144
289 Ga0070678_100396725
290 Ga0070681_10075573
291 Ga0070681_10279086
292 Ga0070679_100013030
293 Ga0070679_100270389
294 Ga0070684_100080271
295 Ga0070672_100252906
296 Ga0070696_100017504
297 Ga0068852_100569292
298 Ga0068859_100294197
299 Ga0068864_100122492
300 Ga0097621_100410420
301 Ga0068865_100042794
302 Ga0097620_100294194
303 Ga0105245_10052355
304 Ga0105245_10090832
305 Ga0105245_10353110
306 Ga0105243_10005640
307 Ga0105242_10015298
308 Ga0105248_10118278
309 Ga0105238_10409132
310 Ga0105238_10660451
311 Ga0105249_10098578
312 Ga0105249_10431307
313 Ga0105239_10296401
314 Ga0105246_10377050
315 Ga0157370_10103900
316 Ga0163162_10298204
317 Ga0157375_10022557
318 Ga0157375_10038259
319 Ga0157375_10095650
320 Ga0157375_10129631
321 Ga0157375_10212976
322 Ga0163163_10020839
323 Ga0163163_10353188
324 Ga0157380_10117258
325 Ga0157380_10245800
326 Ga0157379_10216921
327 Ga0157376_10210058
328 Ga0157376_10366530
329 Ga0163161_10012192
330 Ga0197907_10429599
331 Ga0197907_10654088
332 Ga0206350_10943926
333 Ga0206354_11507739
334 Ga0206353_10794140
335 Ga0206353_11900773
336 Ga0224712_10025693
337 Ga0207660_10286165
338 Ga0207657_10160128
339 Ga0207652_10015344
340 Ga0207687_10063767
341 Ga0207687_10079942
342 Ga0207706_10667897
343 Ga0207686_10462313
344 Ga0207669_10210101
345 Ga0207704_10408709
346 Ga0207691_10044566
347 Ga0207711_10058037
348 Ga0207661_10067601
349 Ga0207661_10094713
350 Ga0207661_10113299
351 Ga0207661_10454969
352 Ga0207712_10069214
353 Ga0207668_10052205
354 Ga0207677_10049597
355 Ga0207677_10138380
356 Ga0207674_10077634
357 Ga0207698_10321364
358 Ga0316575_10002706
359 Ga0316579_10017581
360 Ga0316579_10144746
361 Ga0316576_10000990
362 Ga0316578_10000405
363 Ga0316578_10009569
364 Ga0316578_10041424
365 Ga0316577_10014730
366 Ga0316577_10056926
367 Ga0316577_10173767
368 Ga0307409_100166126
369 Ga0307409_100727516
370 Ga0316583_10012671
371 Ga0316583_10056613
372 Ga0316585_10004779
373 Ga0316585_10017257
374 Ga0316580_10002265
375 Ga0316574_0011508
376 Ga0316574_0209928
377 Ga0316574_0304219
378 Ga0373937_0612305
379 Ga0316582_0001546
380 Ga0316582_0009891
381 Ga0316584_0006572
382 Ga0316584_0123689
383 Ga0316584_0204794
384 Ga0395900_0140193
385 Ga0395900_0411197
386 Ga0395898_0080878
387 Ga0395901_0004635
388 Ga0395901_0023376
389 Ga0395901_0040909
390 Ga0395901_0142129
391 Ga0395901_0712333
392 Ga0466961_0403789
393 Ga0466960_0011906
394 Ga0495641_0075765
395 Ga0495653_0285574
396 Ga0495582_0032633
397 Ga0495582_0111228
398 Ga0495639_0255444
399 Ga0495664_0177035
400 Ga0495608_0351222
401 Ga0495632_0051233
402 Ga0495645_0226981
403 Ga0495658_0081502
404 Ga0495658_0237224
405 Ga0495658_0358568
406 Ga0495581_0091290
407 Ga0495581_0191389
408 Ga0495676_0129320
409 Ga0495680_0208368
410 Ga0496100_0037362
411 Ga0496100_0047872
412 Ga0496100_0147077
413 Ga0496101_0001413
414 Ga0496101_0081071
415 Ga0496101_0099003
416 Ga0496101_0223060
417 Ga0496101_0405694
418 Ga0496102_0002010
419 Ga0496102_0004618
420 Ga0496102_0492523
421 Ga0496102_0610040
422 Ga0496103_0002957
423 Ga0496103_0012638
424 Ga0496104_0039375
425 Ga0496104_0061878
426 Ga0496104_0143769
427 Ga0496105_0044244
428 Ga0496105_0049911
429 Ga0496105_0059158
430 Ga0496106_0113991
431 Ga0496106_0186269
432 Ga0496107_0139501
433 Ga0496108_0163840
434 Ga0496108_0281716
435 Ga0496109_0046824
436 Ga0496109_0056596
437 Ga0496109_0073324
438 Ga0496109_0173865
439 Ga0496109_0265384
440 Ga0496110_0052176
441 Ga0496110_0198626
442 Ga0496110_0611109
443 Ga0496111_0016121
444 Ga0496111_0044131
445 Ga0496111_0066138
446 Ga0496112_0133233
447 Ga0496112_0265419
448 Ga0496113_0099316
449 Ga0496113_0224789
450 Ga0496114_0007032
451 Ga0496114_0017594
452 Ga0496114_0022749
453 Ga0496114_0099055
454 Ga0496114_0185463
455 Ga0496115_0084055
456 Ga0496119_0199954
457 Ga0496125_0173558
458 Ga0501031_0005900
459 Ga0501031_0021206
460 Ga0501031_0200636
461 Ga0501033_0053278
462 Ga0501036_0001393
463 Ga0501036_0561076
464 Ga0501037_0038294
465 Ga0501038_0012511
466 Ga0501038_0034937
467 Ga0501038_0514159
468 Ga0501039_0099899
469 Ga0501039_0246810
470 Ga0501040_0000488
471 Ga0501041_0001193
472 Ga0501041_0286760
473 Ga0501042_0084592
474 Ga0501043_0035170
475 Ga0501046_0025288
476 Ga0501046_0104637
477 Ga0501048_0286543
478 Ga0501048_0447036
479 Ga0501069_0051470
480 Ga0501069_0142572
481 Ga0501070_0237355
482 Ga0501070_0299032
483 Ga0501071_0019784
484 Ga0501071_0266411
485 Ga0501072_0009342
486 Ga0501072_0305764
487 Ga0501073_0034180
488 Ga0501073_0168805
489 Ga0501074_0017224
490 Ga0501074_0075099
491 Ga0501075_0008855
492 Ga0501075_0057936
493 Ga0501076_0007041
494 Ga0501076_0011392
495 Ga0501077_0013039
496 Ga0501079_0004280
497 Ga0501079_0025502
498 Ga0501080_0092287
499 Ga0501081_0010971
500 Ga0501083_0200474
501 Ga0501044_0374864
502 Ga0501045_0008794
503 Ga0501045_0011253
504 Ga0501045_0140678
505 Ga0501045_0154959
506 Ga0501045_0265047
507 Ga0495655_0075112
508 Ga0495619_0269023
509 Ga0500643_000507
510 Ga0500616_0016781
511 Ga0501084_0043786
512 Ga0501084_0249291
513 Ga0587070_006206
514 Ga0501082_0034035
515 Ga0501082_0045012
516 Ga0530510_0002699
517 Ga0530510_0359498
518 2585299838
519 2643850474
520 2644134231
521 2644446203
522 2644609440
523 2676488033
524 2731908036
525 2784471948
526 2799184124
527 2812374649
528 2819427249
529 2819666273
530 2819693107
531 2819730253
532 2856743605
533 2873320928
534 2884697406
535 2891397809
536 2891554476
537 2891564908
538 2895430992
539 2895452914
540 2919449941
541 8055070851
542 8055179942

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

166

240

0.8

PF00034

Cytochrom_C

Cytochrome c

66

143

0.7

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

64

139

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dii-assembly1.cif.gz_D crystal structure of p-cresol methylhydroxylase at 2.5 a resolution 0.8315 145 214
7e1x-assembly1.cif.gz_O cryo-em structure of hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv in presence of tb47 0.8068 47 254
7qhm-assembly1.cif.gz_C cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.8055 45 255
6adq-assembly1.cif.gz_C respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.8054 45 255
6lod-assembly1.cif.gz_E cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.7986 142 220
ID Description Score Start End Superfamily
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9364 136 220 1.10.760.10
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8418 136 220 1.10.760.10
3dp5A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7557 145 217 1.10.760.10
1wveC00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7396 136 214 1.10.760.10
5mcsA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7253 144 216 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2D6I075-F1-model_v4 Cystathionine beta-lyase 0.9421 43 207 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A2D6I075-F1-model_v4 Cystathionine beta-lyase 0.9204 43 207 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A4R4KTG3-F1-model_v4 C-type cytochrome 0.9051 54 196 GO:0009055
GO:0020037
GO:0046872
AF-A0A3D3BQT2-F1-model_v4 Cystathionine beta-lyase 0.8952 43 164 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A538B2Y7-F1-model_v4 Cytochrome c 0.8905 49 154 GO:0009055
GO:0020037
GO:0046872

Map