F377863

General Info

Members Datasets Scaffolds Average Seq Length
271 209 543 133

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0418085|Ga0495592_0418085_337_798
Length 153
Sequence MAVTFAQNANVPRPPLPPEVDEFLRRPNPAVVATLRPDGSPHTAATWYLWDGERILLNMDESRLRLRFMRRDPRVALTALGDESWYRHVSLLGRVVSLEPDSDLAGIDRLARHYTGEPFSRRGASRVSALVEVETWHAWEGSGPWPPSAAPPG

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
45 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
110 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
111 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
112 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
115 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
116 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
117 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
118 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
119 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 9.96
Rhizosphere 85.98
Stem 0
Stem Tuber 0
Unclassified 11.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0418085 3300046454 Bacteria 846
2 rootH1_10092461 3300003316 Bacteria 1348
3 rootH1_10046400 3300003316 Bacteria 9928
4 rootH1_10046400 3300003323 Bacteria 2981
5 Ga0070683_101562327 3300005329 Bacteria 634
6 Ga0070682_101090041 3300005337 Bacteria 668
7 Ga0068868_100306117 3300005338 Bacteria 1351
8 Ga0070660_100640032 3300005339 Bacteria 890
9 Ga0070668_100029221 3300005347 Bacteria 4185
10 Ga0070714_100011246 3300005435 Bacteria 7095
11 Ga0070714_100043783 3300005435 Bacteria 3788
12 Ga0070714_100435130 3300005435 Bacteria 1244
13 Ga0070710_10446186 3300005437 Bacteria 876
14 Ga0070711_100930879 3300005439 Bacteria 743
15 Ga0070694_100247217 3300005444 Bacteria 1348
16 Ga0070662_100112226 3300005457 Bacteria 2078
17 Ga0070684_100460009 3300005535 Bacteria 1176
18 Ga0070696_100646427 3300005546 Unclassified 857
19 Ga0070693_100604302 3300005547 Bacteria 792
20 Ga0070704_100043617 3300005549 Bacteria 3110
21 Ga0068855_100214792 3300005563 Bacteria 2160
22 Ga0068857_100395869 3300005577 Bacteria 1285
23 Ga0068854_100973292 3300005578 Bacteria 750
24 Ga0068854_101382820 3300005578 Bacteria 636
25 Ga0068856_100034167 3300005614 Bacteria 4981
26 Ga0070702_100773041 3300005615 Unclassified 740
27 Ga0068852_100297718 3300005616 Bacteria 1560
28 Ga0068866_10174152 3300005718 Bacteria 1266
29 Ga0081455_10002368 3300005937 Bacteria 22508
30 Ga0081540_1106874 3300005983 Bacteria 1192
31 Ga0081539_10000883 3300005985 Bacteria 57339
32 Ga0070717_10404911 3300006028 Bacteria 1226
33 Ga0070717_10531786 3300006028 Bacteria 1064
34 Ga0070716_100411133 3300006173 Unclassified 976
35 Ga0070712_100046357 3300006175 Bacteria 3005
36 Ga0070712_100078659 3300006175 Bacteria 2381
37 Ga0070712_100534749 3300006175 Bacteria 986
38 Ga0070712_100635792 3300006175 Bacteria 906
39 Ga0097621_101471420 3300006237 Bacteria 646
40 Ga0075428_100006201 3300006844 Bacteria 13298
41 Ga0075431_100112715 3300006847 Bacteria 2807
42 Ga0075433_10040608 3300006852 Bacteria 4028
43 Ga0075433_10277175 3300006852 Bacteria 1486
44 Ga0075434_100353834 3300006871 Bacteria 1490
45 Ga0105240_10327711 3300009093 Bacteria 1744
46 Ga0105245_10011428 3300009098 Bacteria 7731
47 Ga0114129_10009741 3300009147 Bacteria 13703
48 Ga0114129_10179925 3300009147 Bacteria 2878
49 Ga0105243_10243643 3300009148 Bacteria 1601
50 Ga0105242_10186880 3300009176 Bacteria 1832
51 Ga0105249_10172216 3300009553 Bacteria 2100
52 Ga0105239_10066109 3300010375 Bacteria 3972
53 Ga0105239_10913085 3300010375 Unclassified 1008
54 Ga0105246_10461989 3300011119 Bacteria 1069
55 Ga0105246_11932903 3300011119 Unclassified 567
56 Ga0157329_1026720 3300012491 Bacteria 577
57 Ga0157327_1005200 3300012512 Bacteria 1043
58 Ga0157370_10874439 3300013104 Bacteria 816
59 Ga0157378_10281969 3300013297 Bacteria 1602
60 Ga0163163_10298480 3300014325 Unclassified 1663
61 Ga0163161_10252509 3300017792 Bacteria 1375
62 Ga0197907_11494269 3300020069 Bacteria 1514
63 Ga0206354_10807352 3300020081 Bacteria 2060
64 Ga0207642_10308217 3300025899 Bacteria 920
65 Ga0207693_10011711 3300025915 Bacteria 7094
66 Ga0207693_10085556 3300025915 Bacteria 2470
67 Ga0207693_10092655 3300025915 Bacteria 2368
68 Ga0207663_10084373 3300025916 Bacteria 2089
69 Ga0207700_10000024 3300025928 Bacteria 147545
70 Ga0207664_10007398 3300025929 Bacteria 7613
71 Ga0207706_10566418 3300025933 Bacteria 977
72 Ga0207665_10016190 3300025939 Bacteria 4895
73 Ga0207661_11807649 3300025944 Bacteria 557
74 Ga0207667_10449092 3300025949 Bacteria 1310
75 Ga0207712_10016023 3300025961 Bacteria 4845
76 Ga0207668_10016850 3300025972 Bacteria 4570
77 Ga0207640_11826222 3300025981 Unclassified 550
78 Ga0207677_10205029 3300026023 Bacteria 1570
79 Ga0207639_10179452 3300026041 Bacteria 1800
80 Ga0207702_10162343 3300026078 Bacteria 2041
81 Ga0207641_11177447 3300026088 Unclassified 766
82 Ga0207674_10416486 3300026116 Bacteria 1298
83 Ga0207675_100003466 3300026118 Bacteria 15420
84 Ga0268264_10500496 3300028381 Bacteria 1185
85 Ga0265319_1002094 3300028563 Bacteria 11181
86 Ga0265334_10000322 3300028573 Bacteria 26260
87 Ga0265318_10001871 3300028577 Bacteria 11838
88 Ga0265323_10081587 3300028653 Bacteria 1092
89 Ga0265338_10001558 3300028800 Bacteria 37008
90 Ga0265338_10039184 3300028800 Bacteria 4476
91 Ga0265330_10311717 3300031235 Bacteria 663
92 Ga0265332_10020769 3300031238 Bacteria 2901
93 Ga0265328_10005299 3300031239 Bacteria 5535
94 Ga0265325_10000728 3300031241 Bacteria 23816
95 Ga0265329_10002218 3300031242 Bacteria 8969
96 Ga0265340_10008602 3300031247 Bacteria 5501
97 Ga0265339_10010401 3300031249 Bacteria 5780
98 Ga0265331_10002581 3300031250 Bacteria 12179
99 Ga0265327_10004211 3300031251 Bacteria 12930
100 Ga0265316_10022972 3300031344 Bacteria 5247
101 Ga0265313_10003384 3300031595 Bacteria 12970
102 Ga0265314_10012282 3300031711 Bacteria 6999
103 Ga0265342_10015816 3300031712 Bacteria 4951
104 Ga0307405_10161207 3300031731 Bacteria 1589
105 Ga0307410_11052119 3300031852 Bacteria 704
106 Ga0307416_102260621 3300032002 Bacteria 645
107 Ga0307414_10694208 3300032004 Bacteria 921
108 Ga0373945_0030287 3300035116 Bacteria 1907
109 Ga0373953_0194088 3300035117 Bacteria 877
110 Ga0373957_0237034 3300035120 Bacteria 766
111 Ga0373943_0007198 3300035170 Bacteria 4994
112 Ga0373946_0005228 3300035171 Bacteria 4679
113 Ga0373955_0036092 3300035172 Bacteria 2622
114 Ga0373931_0683691 3300035691 Bacteria 676
115 Ga0373935_0095576 3300035692 Bacteria 1952
116 Ga0373933_0011994 3300035724 Bacteria 4785
117 Ga0373947_0003247 3300035725 Bacteria 9646
118 Ga0373925_0002933 3300037068 Bacteria 13456
119 Ga0395900_0747824 3300037418 Bacteria 908
120 Ga0395900_1025637 3300037418 Bacteria 744
121 Ga0395900_1072799 3300037418 Unclassified 723
122 Ga0395898_0699501 3300037466 Bacteria 955
123 Ga0395901_0262070 3300038443 Bacteria 1799
124 Ga0395901_1367090 3300038443 Bacteria 668
125 Ga0451789_0236061 3300041443 Bacteria 1308
126 Ga0451793_0195234 3300041452 Bacteria 3524
127 Ga0451797_1306250 3300041453 Bacteria 1518
128 Ga0451798_0368699 3300041458 Bacteria 919
129 Ga0451800_1432209 3300041459 Bacteria 2335
130 Ga0451800_1488988 3300041459 Bacteria 670
131 Ga0451802_0307848 3300041460 Bacteria 3649
132 Ga0451807_0663594 3300041486 Bacteria 1430
133 Ga0451839_0962676 3300041496 Unclassified 625
134 Ga0451839_1075735 3300041496 Bacteria 2742
135 Ga0451841_1255553 3300041498 Bacteria 1082
136 Ga0451845_0996772 3300041501 Bacteria 1516
137 Ga0451847_0526705 3300041503 Bacteria 1953
138 Ga0451851_1125156 3300041507 Bacteria 1510
139 Ga0451855_0289001 3300041511 Bacteria 879
140 Ga0451853_0066660 3300041512 Bacteria 1445
141 Ga0466969_0043825 3300044656 Bacteria 2228
142 Ga0466972_0090132 3300044658 Bacteria 1455
143 Ga0466972_0425482 3300044658 Bacteria 623
144 Ga0466965_0152848 3300044683 Bacteria 1207
145 Ga0466966_0207233 3300044684 Bacteria 1185
146 Ga0466961_0018550 3300044693 Bacteria 4477
147 Ga0466964_0786809 3300044706 Bacteria 537
148 Ga0466964_0906820 3300044706 Unclassified 504
149 Ga0466971_0014919 3300044719 Bacteria 3419
150 Ga0466968_0320154 3300044735 Unclassified 749
151 Ga0466960_0411000 3300044901 Bacteria 781
152 Ga0466960_0727077 3300044901 Bacteria 597
153 Ga0466960_0808572 3300044901 Unclassified 568
154 Ga0466959_0009317 3300045049 Bacteria 6977
155 Ga0451576_0103779 3300045051 Bacteria 2957
156 Ga0451576_1443034 3300045051 Unclassified 716
157 Ga0466958_0134974 3300045836 Bacteria 1551
158 Ga0466967_0067243 3300045976 Bacteria 3196
159 Ga0466967_0283543 3300045976 Unclassified 1590
160 Ga0466967_0542951 3300045976 Bacteria 1144
161 Ga0466967_0741022 3300045976 Bacteria 974
162 Ga0495629_0006218 3300046459 Bacteria 8863
163 Ga0495629_0011797 3300046459 Bacteria 6340
164 Ga0495629_0034124 3300046459 Bacteria 3597
165 Ga0495641_0010504 3300046461 Bacteria 5360
166 Ga0495641_0162332 3300046461 Bacteria 999
167 Ga0495641_0268812 3300046461 Bacteria 767
168 Ga0495651_0324079 3300046462 Unclassified 1026
169 Ga0495580_0020847 3300046472 Bacteria 4844
170 Ga0495582_0000977 3300046473 Bacteria 15988
171 Ga0495639_0000843 3300046475 Bacteria 13973
172 Ga0495662_0028826 3300046476 Bacteria 2680
173 Ga0495664_0022478 3300046477 Bacteria 3655
174 Ga0495664_0025216 3300046477 Bacteria 3461
175 Ga0495594_0316343 3300046499 Bacteria 889
176 Ga0495596_0124383 3300046500 Bacteria 1001
177 Ga0495607_0159406 3300046501 Bacteria 1147
178 Ga0495608_0016523 3300046511 Bacteria 5107
179 Ga0495618_0001958 3300046514 Bacteria 13508
180 Ga0495618_0047043 3300046514 Bacteria 2723
181 Ga0495628_0131873 3300046516 Bacteria 1910
182 Ga0495628_0215723 3300046516 Bacteria 1442
183 Ga0495628_0448553 3300046516 Bacteria 937
184 Ga0495630_0001489 3300046517 Bacteria 16209
185 Ga0495630_0005703 3300046517 Bacteria 8799
186 Ga0495630_0151820 3300046517 Bacteria 1762
187 Ga0495630_0268931 3300046517 Bacteria 1302
188 Ga0495666_0000603 3300046526 Bacteria 16101
189 Ga0495652_0033234 3300046529 Bacteria 4505
190 Ga0495652_0190568 3300046529 Unclassified 1565
191 Ga0495665_0001987 3300046531 Bacteria 11055
192 Ga0495640_0071137 3300046533 Bacteria 2334
193 Ga0495640_0149998 3300046533 Bacteria 1498
194 Ga0495586_0000945 3300046535 Bacteria 16490
195 Ga0495587_0192137 3300046536 Unclassified 1156
196 Ga0495598_0116424 3300046537 Bacteria 902
197 Ga0495609_0279036 3300046538 Unclassified 684
198 Ga0495667_0046494 3300046559 Bacteria 2870
199 Ga0495667_0474863 3300046559 Bacteria 784
200 Ga0495656_0176596 3300046615 Bacteria 1047
201 Ga0495668_0505792 3300046616 Unclassified 666
202 Ga0495634_0001811 3300046642 Bacteria 18452
203 Ga0495635_0004402 3300046663 Bacteria 9759
204 Ga0495635_0017213 3300046663 Bacteria 5048
205 Ga0495635_0030883 3300046663 Bacteria 3721
206 Ga0495659_0044142 3300046664 Unclassified 1602
207 Ga0495657_0010578 3300046675 Bacteria 6936
208 Ga0495646_0196591 3300046680 Unclassified 1100
209 Ga0495647_0000107 3300046681 Bacteria 20741
210 Ga0495658_0000454 3300046683 Bacteria 22724
211 Ga0495613_0018837 3300046689 Bacteria 5144
212 Ga0495613_0444961 3300046689 Bacteria 878
213 Ga0495624_0001246 3300046690 Bacteria 20090
214 Ga0495589_0087082 3300046794 Unclassified 1517
215 Ga0495600_0013896 3300046809 Bacteria 5072
216 Ga0495581_0007758 3300047315 Bacteria 6211
217 Ga0495676_0058488 3300047321 Bacteria 3032
218 Ga0495680_0001905 3300047322 Bacteria 21903
219 Ga0495680_0042166 3300047322 Bacteria 3623
220 Ga0495675_0366715 3300047444 Unclassified 845
221 Ga0495684_0020158 3300047471 Bacteria 5135
222 Ga0495684_0022972 3300047471 Bacteria 4797
223 Ga0495684_0042361 3300047471 Bacteria 3487
224 Ga0495593_0001393 3300047673 Bacteria 14154
225 Ga0495602_0730612 3300048088 Unclassified 670
226 Ga0495614_0000135 3300048089 Bacteria 26206
227 Ga0496101_0183703 3300048904 Bacteria 1611
228 Ga0496104_0036672 3300048907 Bacteria 4584
229 Ga0496104_1742871 3300048907 Bacteria 525
230 Ga0496107_0000820 3300048910 Bacteria 18076
231 Ga0496108_0218181 3300048911 Unclassified 1657
232 Ga0496108_0721199 3300048911 Bacteria 864
233 Ga0496108_1536229 3300048911 Bacteria 553
234 Ga0496109_0290599 3300048912 Bacteria 1541
235 Ga0496109_1309174 3300048912 Bacteria 661
236 Ga0496109_1599551 3300048912 Bacteria 586
237 Ga0496110_1379995 3300048913 Unclassified 614
238 Ga0496111_0094193 3300048914 Unclassified 2196
239 Ga0496111_0900638 3300048914 Bacteria 637
240 Ga0496112_0003276 3300048915 Bacteria 13366
241 Ga0496112_0328273 3300048915 Bacteria 1474
242 Ga0496113_1069548 3300048916 Unclassified 634
243 Ga0496114_0096367 3300048917 Bacteria 2519
244 Ga0496114_1505606 3300048917 Bacteria 561
245 Ga0496115_0101126 3300048918 Bacteria 2363
246 Ga0501047_0718785 3300049581 Bacteria 816
247 Ga0501048_0312428 3300049582 Bacteria 1119
248 Ga0501070_0048630 3300049586 Bacteria 3522
249 Ga0501076_1733134 3300049592 Bacteria 512
250 Ga0501079_0112240 3300049741 Bacteria 2118
251 Ga0501081_0082966 3300049743 Bacteria 2246
252 nmdc:mga05p37_60422_c1 3300050507 Bacteria 4667
253 nmdc:mga05p37_93522_c1 3300050507 Bacteria 3704
254 nmdc:mga06r32_778146_c1 3300050510 Unclassified 919
255 nmdc:mga0n895_143447_c1 3300050512 Bacteria 2417
256 nmdc:mga0n895_1545427_c1 3300050512 Bacteria 629
257 nmdc:mga0n895_288999_c1 3300050512 Bacteria 1662
258 nmdc:mga08x19_134121_c1 3300050514 Bacteria 1668
259 nmdc:mga0a205_5874_c1 3300050515 Bacteria 11053
260 nmdc:mga0a205_589722_c1 3300050515 Bacteria 965
261 nmdc:mga0a205_66449_c1 3300050515 Bacteria 3484
262 Ga0495601_0004714 3300053077 Bacteria 7902
263 Ga0495601_0431993 3300053077 Bacteria 852
264 Ga0495612_0002460 3300053078 Bacteria 7632
265 Ga0495595_0017233 3300053084 Unclassified 3107
266 Ga0495619_0021985 3300053085 Bacteria 4077
267 Ga0495619_0070131 3300053085 Bacteria 2343
268 Ga0500566_0098107 3300053094 Bacteria 1610
269 Ga0501084_0403661 3300054114 Bacteria 1155
270 Ga0501082_0144537 3300060353 Bacteria 2064
271 Ga0466962_0010016 3300061719 Bacteria 4548
272 Ga0530510_1195873 3300061734 Bacteria 583
273 Ga0495592_0418085
274 rootH1_10092461
275 rootH1_10046400
276 Ga0070683_101562327
277 Ga0070682_101090041
278 Ga0068868_100306117
279 Ga0070660_100640032
280 Ga0070668_100029221
281 Ga0070714_100011246
282 Ga0070714_100043783
283 Ga0070714_100435130
284 Ga0070710_10446186
285 Ga0070711_100930879
286 Ga0070694_100247217
287 Ga0070662_100112226
288 Ga0070684_100460009
289 Ga0070696_100646427
290 Ga0070693_100604302
291 Ga0070704_100043617
292 Ga0068855_100214792
293 Ga0068857_100395869
294 Ga0068854_100973292
295 Ga0068854_101382820
296 Ga0068856_100034167
297 Ga0070702_100773041
298 Ga0068852_100297718
299 Ga0068866_10174152
300 Ga0081455_10002368
301 Ga0081540_1106874
302 Ga0081539_10000883
303 Ga0070717_10404911
304 Ga0070717_10531786
305 Ga0070716_100411133
306 Ga0070712_100046357
307 Ga0070712_100078659
308 Ga0070712_100534749
309 Ga0070712_100635792
310 Ga0097621_101471420
311 Ga0075428_100006201
312 Ga0075431_100112715
313 Ga0075433_10040608
314 Ga0075433_10277175
315 Ga0075434_100353834
316 Ga0105240_10327711
317 Ga0105245_10011428
318 Ga0114129_10009741
319 Ga0114129_10179925
320 Ga0105243_10243643
321 Ga0105242_10186880
322 Ga0105249_10172216
323 Ga0105239_10066109
324 Ga0105239_10913085
325 Ga0105246_10461989
326 Ga0105246_11932903
327 Ga0157329_1026720
328 Ga0157327_1005200
329 Ga0157370_10874439
330 Ga0157378_10281969
331 Ga0163163_10298480
332 Ga0163161_10252509
333 Ga0197907_11494269
334 Ga0206354_10807352
335 Ga0207642_10308217
336 Ga0207693_10011711
337 Ga0207693_10085556
338 Ga0207693_10092655
339 Ga0207663_10084373
340 Ga0207700_10000024
341 Ga0207664_10007398
342 Ga0207706_10566418
343 Ga0207665_10016190
344 Ga0207661_11807649
345 Ga0207667_10449092
346 Ga0207712_10016023
347 Ga0207668_10016850
348 Ga0207640_11826222
349 Ga0207677_10205029
350 Ga0207639_10179452
351 Ga0207702_10162343
352 Ga0207641_11177447
353 Ga0207674_10416486
354 Ga0207675_100003466
355 Ga0268264_10500496
356 Ga0265319_1002094
357 Ga0265334_10000322
358 Ga0265318_10001871
359 Ga0265323_10081587
360 Ga0265338_10001558
361 Ga0265338_10039184
362 Ga0265330_10311717
363 Ga0265332_10020769
364 Ga0265328_10005299
365 Ga0265325_10000728
366 Ga0265329_10002218
367 Ga0265340_10008602
368 Ga0265339_10010401
369 Ga0265331_10002581
370 Ga0265327_10004211
371 Ga0265316_10022972
372 Ga0265313_10003384
373 Ga0265314_10012282
374 Ga0265342_10015816
375 Ga0307405_10161207
376 Ga0307410_11052119
377 Ga0307416_102260621
378 Ga0307414_10694208
379 Ga0373945_0030287
380 Ga0373953_0194088
381 Ga0373957_0237034
382 Ga0373943_0007198
383 Ga0373946_0005228
384 Ga0373955_0036092
385 Ga0373931_0683691
386 Ga0373935_0095576
387 Ga0373933_0011994
388 Ga0373947_0003247
389 Ga0373925_0002933
390 Ga0395900_0747824
391 Ga0395900_1025637
392 Ga0395900_1072799
393 Ga0395898_0699501
394 Ga0395901_0262070
395 Ga0395901_1367090
396 Ga0451789_0236061
397 Ga0451793_0195234
398 Ga0451797_1306250
399 Ga0451798_0368699
400 Ga0451800_1432209
401 Ga0451800_1488988
402 Ga0451802_0307848
403 Ga0451807_0663594
404 Ga0451839_0962676
405 Ga0451839_1075735
406 Ga0451841_1255553
407 Ga0451845_0996772
408 Ga0451847_0526705
409 Ga0451851_1125156
410 Ga0451855_0289001
411 Ga0451853_0066660
412 Ga0466969_0043825
413 Ga0466972_0090132
414 Ga0466972_0425482
415 Ga0466965_0152848
416 Ga0466966_0207233
417 Ga0466961_0018550
418 Ga0466964_0786809
419 Ga0466964_0906820
420 Ga0466971_0014919
421 Ga0466968_0320154
422 Ga0466960_0411000
423 Ga0466960_0727077
424 Ga0466960_0808572
425 Ga0466959_0009317
426 Ga0451576_0103779
427 Ga0451576_1443034
428 Ga0466958_0134974
429 Ga0466967_0067243
430 Ga0466967_0283543
431 Ga0466967_0542951
432 Ga0466967_0741022
433 Ga0495629_0006218
434 Ga0495629_0011797
435 Ga0495629_0034124
436 Ga0495641_0010504
437 Ga0495641_0162332
438 Ga0495641_0268812
439 Ga0495651_0324079
440 Ga0495580_0020847
441 Ga0495582_0000977
442 Ga0495639_0000843
443 Ga0495662_0028826
444 Ga0495664_0022478
445 Ga0495664_0025216
446 Ga0495594_0316343
447 Ga0495596_0124383
448 Ga0495607_0159406
449 Ga0495608_0016523
450 Ga0495618_0001958
451 Ga0495618_0047043
452 Ga0495628_0131873
453 Ga0495628_0215723
454 Ga0495628_0448553
455 Ga0495630_0001489
456 Ga0495630_0005703
457 Ga0495630_0151820
458 Ga0495630_0268931
459 Ga0495666_0000603
460 Ga0495652_0033234
461 Ga0495652_0190568
462 Ga0495665_0001987
463 Ga0495640_0071137
464 Ga0495640_0149998
465 Ga0495586_0000945
466 Ga0495587_0192137
467 Ga0495598_0116424
468 Ga0495609_0279036
469 Ga0495667_0046494
470 Ga0495667_0474863
471 Ga0495656_0176596
472 Ga0495668_0505792
473 Ga0495634_0001811
474 Ga0495635_0004402
475 Ga0495635_0017213
476 Ga0495635_0030883
477 Ga0495659_0044142
478 Ga0495657_0010578
479 Ga0495646_0196591
480 Ga0495647_0000107
481 Ga0495658_0000454
482 Ga0495613_0018837
483 Ga0495613_0444961
484 Ga0495624_0001246
485 Ga0495589_0087082
486 Ga0495600_0013896
487 Ga0495581_0007758
488 Ga0495676_0058488
489 Ga0495680_0001905
490 Ga0495680_0042166
491 Ga0495675_0366715
492 Ga0495684_0020158
493 Ga0495684_0022972
494 Ga0495684_0042361
495 Ga0495593_0001393
496 Ga0495602_0730612
497 Ga0495614_0000135
498 Ga0496101_0183703
499 Ga0496104_0036672
500 Ga0496104_1742871
501 Ga0496107_0000820
502 Ga0496108_0218181
503 Ga0496108_0721199
504 Ga0496108_1536229
505 Ga0496109_0290599
506 Ga0496109_1309174
507 Ga0496109_1599551
508 Ga0496110_1379995
509 Ga0496111_0094193
510 Ga0496111_0900638
511 Ga0496112_0003276
512 Ga0496112_0328273
513 Ga0496113_1069548
514 Ga0496114_0096367
515 Ga0496114_1505606
516 Ga0496115_0101126
517 Ga0501047_0718785
518 Ga0501048_0312428
519 Ga0501070_0048630
520 Ga0501076_1733134
521 Ga0501079_0112240
522 Ga0501081_0082966
523 nmdc:mga05p37_60422_c1
524 nmdc:mga05p37_93522_c1
525 nmdc:mga06r32_778146_c1
526 nmdc:mga0n895_143447_c1
527 nmdc:mga0n895_1545427_c1
528 nmdc:mga0n895_288999_c1
529 nmdc:mga08x19_134121_c1
530 nmdc:mga0a205_5874_c1
531 nmdc:mga0a205_589722_c1
532 nmdc:mga0a205_66449_c1
533 Ga0495601_0004714
534 Ga0495601_0431993
535 Ga0495612_0002460
536 Ga0495595_0017233
537 Ga0495619_0021985
538 Ga0495619_0070131
539 Ga0500566_0098107
540 Ga0501084_0403661
541 Ga0501082_0144537
542 Ga0466962_0010016
543 Ga0530510_1195873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

16

102

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.9197 6 126
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8785 6 126
5jab-assembly2.cif.gz_D structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8643 4 128
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8279 6 128
5jab-assembly2.cif.gz_D structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.7866 4 128
ID Description Score Start End Superfamily
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9032 6 126 2.30.110.10
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8758 6 126 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8241 7 128 2.30.110.10
1w9aB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7872 8 133 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7817 7 128 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7V9DHH2-F1-model_v4 TIGR03618 family F420-dependent PPOX class oxidoreductase 0.9859 1 129 GO:0005829
GO:0016627
GO:0070967
AF-F6EPW5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9806 1 129 GO:0005829
GO:0016627
GO:0070967
AF-A0A4R1V4U3-F1-model_v4 deleted 0.9768 1 129
AF-A0A022LMF2-F1-model_v4 F420-dependent oxidoreductase 0.9762 5 129 GO:0005829
GO:0016627
GO:0070967
AF-A0A1G6IQI1-F1-model_v4 deleted 0.9677 11 136

Map