F377850

General Info

Members Datasets Scaffolds Average Seq Length
271 171 542 190

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0189651|Ga0466960_0189651_164_790
Length 208
Sequence MTRADEQPAPRSEPALGRRESRRRDALAQAATDYVLEHGLVGLSLRPLAAAVGTSDRMLLYHFDGKDDLVATVLRLSNDRSVAEVRALAPTADVRSAVLALWQAVTSPRLDRCQRLYVEAAALGLFGREPYSSVVRAANRVWVAAVAEWLVACGMPASLAPRAVALLDAALMGFQLDLPLDADDPAQRLAVHDLADAVAAIAQGQGSA

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
153 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2643221576 Nocardioides sp. Root614 Isolate Unclassified
164 2643221590 Nocardioides sp. Root682 Isolate Unclassified
165 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
166 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
167 2738541305 Nocardioides sp. CF167 Isolate Unclassified
168 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
169 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
170 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
171 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.46
Metatranscriptomes 0.74
Isolates 4.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 14.02
Rhizosphere 78.97
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0189651 3300044901 Bacteria 1118
2 JGI24735J21928_10027944 3300002067 Bacteria 1686
3 Ga0006562J51391_1078795 3300003578 Bacteria 2140
4 Ga0070683_100002280 3300005329 Bacteria 15201
5 Ga0070690_100403650 3300005330 Bacteria 1004
6 Ga0068869_100363584 3300005334 Bacteria 1182
7 Ga0070682_100048059 3300005337 Bacteria 2655
8 Ga0070682_101290623 3300005337 Bacteria 620
9 Ga0070660_100200278 3300005339 Bacteria 1619
10 Ga0070691_10112914 3300005341 Bacteria 1361
11 Ga0070687_100144229 3300005343 Bacteria 1390
12 Ga0070692_10097349 3300005345 Bacteria 1608
13 Ga0070668_100255351 3300005347 Bacteria 1456
14 Ga0070675_100476485 3300005354 Bacteria 1122
15 Ga0070659_100063372 3300005366 Bacteria 2925
16 Ga0070667_100390775 3300005367 Bacteria 1265
17 Ga0070663_100516300 3300005455 Bacteria 994
18 Ga0070678_100335747 3300005456 Bacteria 1295
19 Ga0070681_10150900 3300005458 Bacteria 2250
20 Ga0070685_10076225 3300005466 Bacteria 2000
21 Ga0070698_100000205 3300005471 Bacteria 56962
22 Ga0070679_100017869 3300005530 Bacteria 6869
23 Ga0070684_100041218 3300005535 Bacteria 3980
24 Ga0070684_100079945 3300005535 Bacteria 2891
25 Ga0070684_101545690 3300005535 Bacteria 626
26 Ga0068853_100713421 3300005539 Bacteria 957
27 Ga0070686_100245562 3300005544 Bacteria 1305
28 Ga0070693_100068635 3300005547 Bacteria 2081
29 Ga0070665_100003394 3300005548 Bacteria 17030
30 Ga0068855_100009324 3300005563 Bacteria 11852
31 Ga0068855_100200305 3300005563 Bacteria 2248
32 Ga0068857_100066532 3300005577 Bacteria 3207
33 Ga0070702_100132117 3300005615 Bacteria 1578
34 Ga0068852_100793630 3300005616 Unclassified 961
35 Ga0068864_100172654 3300005618 Bacteria 1972
36 Ga0068858_100046068 3300005842 Bacteria 4043
37 Ga0068860_100078984 3300005843 Bacteria 3129
38 Ga0068862_100184876 3300005844 Bacteria 1872
39 Ga0081455_10241958 3300005937 Bacteria 1325
40 Ga0075365_10095775 3300006038 Bacteria 2027
41 Ga0075365_10234393 3300006038 Bacteria 1289
42 Ga0070716_100714744 3300006173 Bacteria 767
43 Ga0075370_10296494 3300006353 Bacteria 961
44 Ga0068865_100022985 3300006881 Bacteria 4076
45 Ga0105240_10149270 3300009093 Bacteria 2786
46 Ga0111539_11310671 3300009094 Bacteria 840
47 Ga0111539_11684543 3300009094 Bacteria 735
48 Ga0105245_10024034 3300009098 Bacteria 5349
49 Ga0105245_10209059 3300009098 Bacteria 1877
50 Ga0105245_10218158 3300009098 Bacteria 1839
51 Ga0105245_10630598 3300009098 Bacteria 1101
52 Ga0105245_11364601 3300009098 Bacteria 758
53 Ga0105243_10133647 3300009148 Bacteria 2108
54 Ga0105243_10282792 3300009148 Bacteria 1495
55 Ga0105242_10424624 3300009176 Bacteria 1246
56 Ga0105248_10227604 3300009177 Bacteria 2099
57 Ga0105237_10029008 3300009545 Bacteria 5628
58 Ga0105237_10430616 3300009545 Bacteria 1325
59 Ga0105238_10360527 3300009551 Bacteria 1443
60 Ga0105238_10483731 3300009551 Bacteria 1237
61 Ga0105249_10063540 3300009553 Bacteria 3392
62 Ga0105249_10077824 3300009553 Bacteria 3076
63 Ga0105239_10107081 3300010375 Bacteria 3097
64 Ga0105239_10340116 3300010375 Bacteria 1693
65 Ga0105239_12008754 3300010375 Bacteria 671
66 Ga0105246_10009246 3300011119 Bacteria 6070
67 Ga0105246_10234419 3300011119 Bacteria 1447
68 Ga0105246_10793034 3300011119 Bacteria 840
69 Ga0157369_10277684 3300013105 Bacteria 1745
70 Ga0157374_10607828 3300013296 Bacteria 1103
71 Ga0163162_10014120 3300013306 Bacteria 7805
72 Ga0157372_10103855 3300013307 Bacteria 3248
73 Ga0157372_10260241 3300013307 Bacteria 2015
74 Ga0157372_10422455 3300013307 Bacteria 1554
75 Ga0157375_10333972 3300013308 Bacteria 1681
76 Ga0157375_10605399 3300013308 Bacteria 1255
77 Ga0157375_11025996 3300013308 Bacteria 964
78 Ga0163163_10017777 3300014325 Bacteria 6638
79 Ga0163163_11544821 3300014325 Bacteria 725
80 Ga0182008_10041862 3300014497 Bacteria 2284
81 Ga0157379_10065393 3300014968 Bacteria 3250
82 Ga0163161_10183592 3300017792 Bacteria 1605
83 Ga0206354_10199777 3300020081 Bacteria 1202
84 Ga0207647_10025114 3300025904 Bacteria 3921
85 Ga0207647_10029139 3300025904 Bacteria 3576
86 Ga0207647_10349482 3300025904 Bacteria 837
87 Ga0207705_10257009 3300025909 Bacteria 1333
88 Ga0207707_10062362 3300025912 Bacteria 3244
89 Ga0207695_10265567 3300025913 Bacteria 1613
90 Ga0207671_10017986 3300025914 Bacteria 5437
91 Ga0207671_10486020 3300025914 Bacteria 984
92 Ga0207662_10147179 3300025918 Bacteria 1496
93 Ga0207657_10052503 3300025919 Bacteria 3537
94 Ga0207652_10037211 3300025921 Bacteria 4119
95 Ga0207694_10194276 3300025924 Bacteria 1650
96 Ga0207694_10511791 3300025924 Bacteria 1006
97 Ga0207687_10029959 3300025927 Bacteria 3665
98 Ga0207687_10669517 3300025927 Bacteria 879
99 Ga0207690_10534285 3300025932 Bacteria 952
100 Ga0207686_10839033 3300025934 Bacteria 739
101 Ga0207709_10123588 3300025935 Bacteria 1752
102 Ga0207709_10221881 3300025935 Bacteria 1364
103 Ga0207704_10164663 3300025938 Bacteria 1582
104 Ga0207704_10433655 3300025938 Bacteria 1045
105 Ga0207711_10138437 3300025941 Bacteria 2188
106 Ga0207689_10101746 3300025942 Bacteria 2360
107 Ga0207661_10011956 3300025944 Bacteria 6305
108 Ga0207661_10049702 3300025944 Bacteria 3339
109 Ga0207661_10133682 3300025944 Bacteria 2128
110 Ga0207661_10640693 3300025944 Bacteria 976
111 Ga0207667_10012040 3300025949 Bacteria 10004
112 Ga0207667_10663703 3300025949 Bacteria 1047
113 Ga0207712_10048479 3300025961 Bacteria 2955
114 Ga0207668_10094988 3300025972 Bacteria 2200
115 Ga0207640_11405546 3300025981 Bacteria 625
116 Ga0207639_10632546 3300026041 Bacteria 989
117 Ga0207678_10415946 3300026067 Bacteria 1165
118 Ga0207708_10256822 3300026075 Bacteria 1409
119 Ga0207702_10035514 3300026078 Bacteria 4168
120 Ga0207676_10156376 3300026095 Bacteria 1970
121 Ga0207674_10005602 3300026116 Bacteria 14888
122 Ga0207698_11001288 3300026142 Bacteria 846
123 Ga0207698_11030658 3300026142 Bacteria 834
124 Ga0268266_10002564 3300028379 Bacteria 19275
125 Ga0268266_10095377 3300028379 Bacteria 2613
126 Ga0268264_10703592 3300028381 Bacteria 1004
127 Ga0316576_10023979 3300031727 Bacteria 4257
128 Ga0316576_10353963 3300031727 Bacteria 1092
129 Ga0307405_10229791 3300031731 Bacteria 1367
130 Ga0307405_11203854 3300031731 Bacteria 655
131 Ga0307413_10248096 3300031824 Bacteria 1319
132 Ga0307413_10664367 3300031824 Bacteria 861
133 Ga0307410_10274454 3300031852 Bacteria 1320
134 Ga0307406_10075011 3300031901 Bacteria 2230
135 Ga0307407_10608471 3300031903 Bacteria 814
136 Ga0307412_10963776 3300031911 Bacteria 751
137 Ga0307409_100307647 3300031995 Bacteria 1477
138 Ga0316574_0040037 3300035398 Bacteria 2884
139 Ga0316584_0561654 3300036712 Bacteria 795
140 Ga0395898_0188326 3300037466 Bacteria 1972
141 Ga0395901_0006333 3300038443 Bacteria 11989
142 Ga0242420_029914 3300038996 Bacteria 1007
143 Ga0466965_0267823 3300044683 Bacteria 920
144 Ga0466963_0022445 3300044694 Bacteria 3997
145 Ga0466963_0025803 3300044694 Bacteria 3752
146 Ga0466964_0046484 3300044706 Bacteria 1769
147 Ga0466957_0108664 3300044842 Bacteria 1757
148 Ga0466960_0211219 3300044901 Bacteria 1064
149 Ga0466960_0345881 3300044901 Bacteria 847
150 Ga0451576_1038866 3300045051 Bacteria 858
151 Ga0466967_0146673 3300045976 Bacteria 2201
152 Ga0466967_0202528 3300045976 Bacteria 1880
153 Ga0466967_0265431 3300045976 Bacteria 1643
154 Ga0466967_0372288 3300045976 Bacteria 1385
155 Ga0466967_0494952 3300045976 Bacteria 1199
156 Ga0466967_0709717 3300045976 Bacteria 996
157 Ga0466967_1004771 3300045976 Bacteria 830
158 Ga0495603_0106143 3300046455 Bacteria 1639
159 Ga0495582_0097917 3300046473 Bacteria 1641
160 Ga0495584_0098521 3300046491 Bacteria 1477
161 Ga0495676_0102328 3300047321 Bacteria 2117
162 Ga0495593_0170399 3300047673 Bacteria 1098
163 Ga0496100_0664593 3300048903 Bacteria 812
164 Ga0496100_0829773 3300048903 Bacteria 725
165 Ga0496101_0085579 3300048904 Bacteria 2336
166 Ga0496101_0110373 3300048904 Bacteria 2070
167 Ga0496102_0029461 3300048905 Bacteria 4911
168 Ga0496102_0033782 3300048905 Bacteria 4599
169 Ga0496102_0048062 3300048905 Bacteria 3879
170 Ga0496102_0159567 3300048905 Bacteria 2121
171 Ga0496102_0205516 3300048905 Bacteria 1857
172 Ga0496103_0688260 3300048906 Bacteria 648
173 Ga0496104_0003528 3300048907 Bacteria 13489
174 Ga0496105_0008742 3300048908 Bacteria 7880
175 Ga0496106_0054461 3300048909 Bacteria 3022
176 Ga0496106_0473246 3300048909 Bacteria 1006
177 Ga0496107_0037601 3300048910 Bacteria 3473
178 Ga0496107_0074346 3300048910 Bacteria 2472
179 Ga0496107_0321289 3300048910 Bacteria 1152
180 Ga0496108_0015031 3300048911 Bacteria 6320
181 Ga0496108_0024776 3300048911 Bacteria 4941
182 Ga0496109_0035803 3300048912 Bacteria 4480
183 Ga0496109_0173597 3300048912 Bacteria 2023
184 Ga0496109_0186539 3300048912 Bacteria 1948
185 Ga0496109_0381987 3300048912 Bacteria 1330
186 Ga0496109_0898276 3300048912 Bacteria 824
187 Ga0496110_0019258 3300048913 Bacteria 5740
188 Ga0496110_0480708 3300048913 Bacteria 1131
189 Ga0496110_0725869 3300048913 Unclassified 896
190 Ga0496110_0786518 3300048913 Bacteria 855
191 Ga0496111_0051229 3300048914 Bacteria 2980
192 Ga0496111_0187070 3300048914 Bacteria 1539
193 Ga0496112_0147933 3300048915 Bacteria 2317
194 Ga0496113_0485886 3300048916 Bacteria 992
195 Ga0496114_0008182 3300048917 Bacteria 8291
196 Ga0496114_0010627 3300048917 Bacteria 7323
197 Ga0496114_0038767 3300048917 Bacteria 3942
198 Ga0496114_0093556 3300048917 Bacteria 2556
199 Ga0496114_1082414 3300048917 Bacteria 686
200 Ga0496115_0050460 3300048918 Bacteria 3333
201 Ga0501032_0110441 3300049569 Bacteria 1820
202 Ga0501033_0124903 3300049570 Bacteria 1866
203 Ga0501034_0034835 3300049571 Bacteria 5105
204 Ga0501034_0190469 3300049571 Bacteria 2013
205 Ga0501036_0004481 3300049572 Bacteria 11293
206 Ga0501037_0113109 3300049573 Bacteria 1955
207 Ga0501038_0017971 3300049574 Bacteria 6387
208 Ga0501038_0102828 3300049574 Bacteria 2376
209 Ga0501039_0025720 3300049575 Bacteria 4524
210 Ga0501039_0760495 3300049575 Bacteria 756
211 Ga0501042_0050135 3300049578 Bacteria 2977
212 Ga0501042_0230521 3300049578 Bacteria 1336
213 Ga0501046_0007991 3300049580 Bacteria 9250
214 Ga0501047_0202555 3300049581 Bacteria 1845
215 Ga0501048_0136837 3300049582 Bacteria 1731
216 Ga0501048_0549125 3300049582 Bacteria 829
217 Ga0501067_0007882 3300049583 Bacteria 5918
218 Ga0501067_0029742 3300049583 Bacteria 3027
219 Ga0501067_0137439 3300049583 Bacteria 1360
220 Ga0501068_0006221 3300049584 Bacteria 6566
221 Ga0501068_0030239 3300049584 Bacteria 3211
222 Ga0501068_0037930 3300049584 Bacteria 2885
223 Ga0501069_0005753 3300049585 Bacteria 6463
224 Ga0501069_0082670 3300049585 Bacteria 1810
225 Ga0501070_0007377 3300049586 Bacteria 9338
226 Ga0501070_0027269 3300049586 Bacteria 4791
227 Ga0501070_0151429 3300049586 Bacteria 1914
228 Ga0501070_0362514 3300049586 Bacteria 1175
229 Ga0501071_0043933 3300049587 Bacteria 3205
230 Ga0501071_0053217 3300049587 Bacteria 2919
231 Ga0501072_0014007 3300049588 Bacteria 6146
232 Ga0501072_0127039 3300049588 Bacteria 2031
233 Ga0501073_0102676 3300049589 Bacteria 1985
234 Ga0501074_0001671 3300049590 Bacteria 15095
235 Ga0501074_0023905 3300049590 Bacteria 4440
236 Ga0501074_0028690 3300049590 Bacteria 4033
237 Ga0501074_0099556 3300049590 Bacteria 2081
238 Ga0501076_0586033 3300049592 Bacteria 920
239 Ga0501076_0622661 3300049592 Bacteria 890
240 Ga0501077_0051967 3300049593 Bacteria 2603
241 Ga0501202_144845 3300049652 Bacteria 617
242 Ga0501259_033433 3300049688 Bacteria 982
243 Ga0501080_0007838 3300049742 Bacteria 9661
244 Ga0501080_0034591 3300049742 Bacteria 4718
245 Ga0501080_0206505 3300049742 Bacteria 1801
246 Ga0501083_0011999 3300049744 Bacteria 6069
247 Ga0501035_0182374 3300049822 Bacteria 1808
248 Ga0501035_0281976 3300049822 Bacteria 1404
249 Ga0501045_0090626 3300049824 Bacteria 2259
250 nmdc:mga0yw44_77622_c1 3300050492 Bacteria 1762
251 nmdc:mga0yw44_85626_c1 3300050492 Bacteria 1983
252 Ga0495619_0087751 3300053085 Bacteria 2104
253 Ga0501084_0074315 3300054114 Bacteria 2846
254 Ga0501084_0424761 3300054114 Bacteria 1123
255 Ga0501082_0167568 3300060353 Bacteria 1909
256 Ga0501082_0967371 3300060353 Bacteria 744
257 Ga0530510_0467477 3300061734 Bacteria 954
258 Ga0530510_0611138 3300061734 Bacteria 829
259 2643889548 2643221576 Bacteria 5214352
260 2643958604 2643221590 Bacteria 5214697
261 2644455756 2643221681 Bacteria 3707866
262 2645724025 2643221962 Bacteria 3874254
263 2738871133 2738541305 Bacteria 4910150
264 2774393076 2773857762 Bacteria 5971770
265 2774393971 2773857762 Bacteria 5971770
266 2809195156 2808606439 Bacteria 5952208
267 2809198313 2808606439 Bacteria 5952208
268 2812349488 2811994878 Bacteria 5992952
269 2812350038 2811994878 Bacteria 5992952
270 2891969362 2891968417 Bacteria 5821697
271 2891972346 2891968417 Bacteria 5821697
272 Ga0466960_0189651
273 JGI24735J21928_10027944
274 Ga0006562J51391_1078795
275 Ga0070683_100002280
276 Ga0070690_100403650
277 Ga0068869_100363584
278 Ga0070682_100048059
279 Ga0070682_101290623
280 Ga0070660_100200278
281 Ga0070691_10112914
282 Ga0070687_100144229
283 Ga0070692_10097349
284 Ga0070668_100255351
285 Ga0070675_100476485
286 Ga0070659_100063372
287 Ga0070667_100390775
288 Ga0070663_100516300
289 Ga0070678_100335747
290 Ga0070681_10150900
291 Ga0070685_10076225
292 Ga0070698_100000205
293 Ga0070679_100017869
294 Ga0070684_100041218
295 Ga0070684_100079945
296 Ga0070684_101545690
297 Ga0068853_100713421
298 Ga0070686_100245562
299 Ga0070693_100068635
300 Ga0070665_100003394
301 Ga0068855_100009324
302 Ga0068855_100200305
303 Ga0068857_100066532
304 Ga0070702_100132117
305 Ga0068852_100793630
306 Ga0068864_100172654
307 Ga0068858_100046068
308 Ga0068860_100078984
309 Ga0068862_100184876
310 Ga0081455_10241958
311 Ga0075365_10095775
312 Ga0075365_10234393
313 Ga0070716_100714744
314 Ga0075370_10296494
315 Ga0068865_100022985
316 Ga0105240_10149270
317 Ga0111539_11310671
318 Ga0111539_11684543
319 Ga0105245_10024034
320 Ga0105245_10209059
321 Ga0105245_10218158
322 Ga0105245_10630598
323 Ga0105245_11364601
324 Ga0105243_10133647
325 Ga0105243_10282792
326 Ga0105242_10424624
327 Ga0105248_10227604
328 Ga0105237_10029008
329 Ga0105237_10430616
330 Ga0105238_10360527
331 Ga0105238_10483731
332 Ga0105249_10063540
333 Ga0105249_10077824
334 Ga0105239_10107081
335 Ga0105239_10340116
336 Ga0105239_12008754
337 Ga0105246_10009246
338 Ga0105246_10234419
339 Ga0105246_10793034
340 Ga0157369_10277684
341 Ga0157374_10607828
342 Ga0163162_10014120
343 Ga0157372_10103855
344 Ga0157372_10260241
345 Ga0157372_10422455
346 Ga0157375_10333972
347 Ga0157375_10605399
348 Ga0157375_11025996
349 Ga0163163_10017777
350 Ga0163163_11544821
351 Ga0182008_10041862
352 Ga0157379_10065393
353 Ga0163161_10183592
354 Ga0206354_10199777
355 Ga0207647_10025114
356 Ga0207647_10029139
357 Ga0207647_10349482
358 Ga0207705_10257009
359 Ga0207707_10062362
360 Ga0207695_10265567
361 Ga0207671_10017986
362 Ga0207671_10486020
363 Ga0207662_10147179
364 Ga0207657_10052503
365 Ga0207652_10037211
366 Ga0207694_10194276
367 Ga0207694_10511791
368 Ga0207687_10029959
369 Ga0207687_10669517
370 Ga0207690_10534285
371 Ga0207686_10839033
372 Ga0207709_10123588
373 Ga0207709_10221881
374 Ga0207704_10164663
375 Ga0207704_10433655
376 Ga0207711_10138437
377 Ga0207689_10101746
378 Ga0207661_10011956
379 Ga0207661_10049702
380 Ga0207661_10133682
381 Ga0207661_10640693
382 Ga0207667_10012040
383 Ga0207667_10663703
384 Ga0207712_10048479
385 Ga0207668_10094988
386 Ga0207640_11405546
387 Ga0207639_10632546
388 Ga0207678_10415946
389 Ga0207708_10256822
390 Ga0207702_10035514
391 Ga0207676_10156376
392 Ga0207674_10005602
393 Ga0207698_11001288
394 Ga0207698_11030658
395 Ga0268266_10002564
396 Ga0268266_10095377
397 Ga0268264_10703592
398 Ga0316576_10023979
399 Ga0316576_10353963
400 Ga0307405_10229791
401 Ga0307405_11203854
402 Ga0307413_10248096
403 Ga0307413_10664367
404 Ga0307410_10274454
405 Ga0307406_10075011
406 Ga0307407_10608471
407 Ga0307412_10963776
408 Ga0307409_100307647
409 Ga0316574_0040037
410 Ga0316584_0561654
411 Ga0395898_0188326
412 Ga0395901_0006333
413 Ga0242420_029914
414 Ga0466965_0267823
415 Ga0466963_0022445
416 Ga0466963_0025803
417 Ga0466964_0046484
418 Ga0466957_0108664
419 Ga0466960_0211219
420 Ga0466960_0345881
421 Ga0451576_1038866
422 Ga0466967_0146673
423 Ga0466967_0202528
424 Ga0466967_0265431
425 Ga0466967_0372288
426 Ga0466967_0494952
427 Ga0466967_0709717
428 Ga0466967_1004771
429 Ga0495603_0106143
430 Ga0495582_0097917
431 Ga0495584_0098521
432 Ga0495676_0102328
433 Ga0495593_0170399
434 Ga0496100_0664593
435 Ga0496100_0829773
436 Ga0496101_0085579
437 Ga0496101_0110373
438 Ga0496102_0029461
439 Ga0496102_0033782
440 Ga0496102_0048062
441 Ga0496102_0159567
442 Ga0496102_0205516
443 Ga0496103_0688260
444 Ga0496104_0003528
445 Ga0496105_0008742
446 Ga0496106_0054461
447 Ga0496106_0473246
448 Ga0496107_0037601
449 Ga0496107_0074346
450 Ga0496107_0321289
451 Ga0496108_0015031
452 Ga0496108_0024776
453 Ga0496109_0035803
454 Ga0496109_0173597
455 Ga0496109_0186539
456 Ga0496109_0381987
457 Ga0496109_0898276
458 Ga0496110_0019258
459 Ga0496110_0480708
460 Ga0496110_0725869
461 Ga0496110_0786518
462 Ga0496111_0051229
463 Ga0496111_0187070
464 Ga0496112_0147933
465 Ga0496113_0485886
466 Ga0496114_0008182
467 Ga0496114_0010627
468 Ga0496114_0038767
469 Ga0496114_0093556
470 Ga0496114_1082414
471 Ga0496115_0050460
472 Ga0501032_0110441
473 Ga0501033_0124903
474 Ga0501034_0034835
475 Ga0501034_0190469
476 Ga0501036_0004481
477 Ga0501037_0113109
478 Ga0501038_0017971
479 Ga0501038_0102828
480 Ga0501039_0025720
481 Ga0501039_0760495
482 Ga0501042_0050135
483 Ga0501042_0230521
484 Ga0501046_0007991
485 Ga0501047_0202555
486 Ga0501048_0136837
487 Ga0501048_0549125
488 Ga0501067_0007882
489 Ga0501067_0029742
490 Ga0501067_0137439
491 Ga0501068_0006221
492 Ga0501068_0030239
493 Ga0501068_0037930
494 Ga0501069_0005753
495 Ga0501069_0082670
496 Ga0501070_0007377
497 Ga0501070_0027269
498 Ga0501070_0151429
499 Ga0501070_0362514
500 Ga0501071_0043933
501 Ga0501071_0053217
502 Ga0501072_0014007
503 Ga0501072_0127039
504 Ga0501073_0102676
505 Ga0501074_0001671
506 Ga0501074_0023905
507 Ga0501074_0028690
508 Ga0501074_0099556
509 Ga0501076_0586033
510 Ga0501076_0622661
511 Ga0501077_0051967
512 Ga0501202_144845
513 Ga0501259_033433
514 Ga0501080_0007838
515 Ga0501080_0034591
516 Ga0501080_0206505
517 Ga0501083_0011999
518 Ga0501035_0182374
519 Ga0501035_0281976
520 Ga0501045_0090626
521 nmdc:mga0yw44_77622_c1
522 nmdc:mga0yw44_85626_c1
523 Ga0495619_0087751
524 Ga0501084_0074315
525 Ga0501084_0424761
526 Ga0501082_0167568
527 Ga0501082_0967371
528 Ga0530510_0467477
529 Ga0530510_0611138
530 2643889548
531 2643958604
532 2644455756
533 2645724025
534 2738871133
535 2774393076
536 2774393971
537 2809195156
538 2809198313
539 2812349488
540 2812350038
541 2891969362
542 2891972346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

27

73

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.7861 3 181
1qvu-assembly1.cif.gz_A crystal structure of the multidrug binding transcriptional repressor qacr bound to two drugs: ethidium and proflavine 0.773 5 182
3btj-assembly1.cif.gz_A crystal structure of qacr(e58q) bound to dequalinium 0.7725 5 182
3bti-assembly1.cif.gz_A crystal structure of qacr(e58q) bound to berberine 0.7712 5 182
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.7708 3 181
ID Description Score Start End Superfamily
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.867 4 51 1.10.10.60
1qpiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8629 3 61 1.10.10.60
3fiwA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8553 3 53 1.10.10.60
3zqlD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8433 3 57 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8388 5 57 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A5B1M4U3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9731 2 180 GO:0003677
GO:0006355
AF-A0A371PAK1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9613 2 178 GO:0000976
GO:0003700
AF-A0A641AKC0-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9585 2 179 GO:0000976
GO:0003700
AF-A0A5B1M4U3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9574 2 180 GO:0003677
GO:0006355
AF-A0A3A5H504-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9571 1 181 GO:0000976
GO:0003700

Map