F377831

General Info

Members Datasets Scaffolds Average Seq Length
271 96 542 258

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000010|Ga0451577_0000010_198012_198878
Length 288
Sequence LKNLAEITCRVFLYRIPATMKLNLKNPLVFLDLETTGINVVTDRIVEVAFLKIFPDGKEEEKLMLINPGMPIPPQSTAIHGISDEDVKDAPLFKEVAKNLAKFIEGCDLAGFNSNRFDIPLLTEEFLRADVDLDLKRRKFVDVQTIFHRMEKRTLAAAYKFYLQKELENAHSAMIDTKATYEVLQAQLERYEGATFEEGGKVSVPIVNEIGQLSAFSSFDRNVDYAGRIVFDDQGVEVINFGKHKGKPVEKVLADEPSYYNWMMNGEFPLYTKKVLTGIKLRSLNRKL

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
57 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
68 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
78 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
86 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
87 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
88 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
89 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
90 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
93 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
94 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
95 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
96 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 0.74
Rhizosphere 96.68
Stem 0
Stem Tuber 0
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0000010 3300042876 Bacteria 616686
2 JGI24740J21852_10000667 3300001979 Bacteria 14865
3 rootH2_10012104 3300003320 Bacteria 1538
4 Ga0070658_10020598 3300005327 Bacteria 5286
5 Ga0070658_10056690 3300005327 Bacteria 3185
6 Ga0070658_10169489 3300005327 Bacteria 1834
7 Ga0068869_100240241 3300005334 Bacteria 1443
8 Ga0070680_100008098 3300005336 Bacteria 8023
9 Ga0070680_100015888 3300005336 Bacteria 5910
10 Ga0070680_100047434 3300005336 Bacteria 3498
11 Ga0070680_100122582 3300005336 Bacteria 2171
12 Ga0070680_100241355 3300005336 Bacteria 1527
13 Ga0070660_100010310 3300005339 Bacteria 6599
14 Ga0070660_100014040 3300005339 Bacteria 5766
15 Ga0070660_100037391 3300005339 Bacteria 3680
16 Ga0070660_100061118 3300005339 Bacteria 2925
17 Ga0070660_100300267 3300005339 Bacteria 1316
18 Ga0070659_100010717 3300005366 Bacteria 6756
19 Ga0070659_100148459 3300005366 Bacteria 1911
20 Ga0070659_100246727 3300005366 Bacteria 1479
21 Ga0070667_100112385 3300005367 Bacteria 2363
22 Ga0070711_100392731 3300005439 Bacteria 1124
23 Ga0070663_100017969 3300005455 Bacteria 4626
24 Ga0070663_100319946 3300005455 Bacteria 1247
25 Ga0070663_100529067 3300005455 Bacteria 983
26 Ga0070681_10027266 3300005458 Bacteria 5745
27 Ga0070681_10240478 3300005458 Bacteria 1724
28 Ga0070681_10285452 3300005458 Bacteria 1561
29 Ga0068867_100358408 3300005459 Bacteria 1219
30 Ga0070679_100000801 3300005530 Bacteria 27256
31 Ga0070679_100006211 3300005530 Bacteria 11128
32 Ga0070679_100017968 3300005530 Bacteria 6853
33 Ga0070679_100057508 3300005530 Bacteria 3876
34 Ga0070679_100073738 3300005530 Bacteria 3404
35 Ga0070679_100200009 3300005530 Bacteria 1965
36 Ga0070684_100457518 3300005535 Bacteria 1180
37 Ga0068853_100062098 3300005539 Bacteria 3232
38 Ga0068855_100002605 3300005563 Bacteria 22234
39 Ga0068855_100009660 3300005563 Bacteria 11642
40 Ga0068855_100041312 3300005563 Bacteria 5467
41 Ga0068855_100103157 3300005563 Bacteria 3282
42 Ga0068855_100185312 3300005563 Bacteria 2351
43 Ga0068855_100258202 3300005563 Bacteria 1942
44 Ga0068856_100040266 3300005614 Bacteria 4589
45 Ga0068856_100081627 3300005614 Bacteria 3208
46 Ga0068852_100009127 3300005616 Bacteria 7343
47 Ga0068859_100009307 3300005617 Bacteria 9920
48 Ga0068864_100172634 3300005618 Bacteria 1972
49 Ga0068860_100014269 3300005843 Bacteria 7790
50 Ga0068862_100005283 3300005844 Bacteria 10823
51 Ga0097620_100009307 3300006931 Bacteria 9920
52 Ga0105249_10712597 3300009553 Bacteria 1064
53 Ga0157373_10000518 3300013100 Bacteria 30285
54 Ga0157373_10002859 3300013100 Bacteria 13069
55 Ga0157373_10037415 3300013100 Bacteria 3478
56 Ga0157373_10172943 3300013100 Unclassified 1520
57 Ga0157373_10180150 3300013100 Unclassified 1488
58 Ga0157371_10001204 3300013102 Bacteria 27630
59 Ga0157371_10001543 3300013102 Bacteria 23683
60 Ga0157371_10001838 3300013102 Bacteria 21398
61 Ga0157371_10003294 3300013102 Bacteria 14779
62 Ga0157371_10006770 3300013102 Bacteria 9369
63 Ga0157371_10009128 3300013102 Bacteria 7832
64 Ga0157371_10026708 3300013102 Bacteria 4193
65 Ga0157371_10057883 3300013102 Bacteria 2749
66 Ga0157371_10070927 3300013102 Bacteria 2467
67 Ga0157371_10301572 3300013102 Bacteria 1160
68 Ga0157370_10001635 3300013104 Bacteria 27664
69 Ga0157370_10006077 3300013104 Bacteria 13398
70 Ga0157370_10012352 3300013104 Bacteria 8862
71 Ga0157370_10209707 3300013104 Bacteria 1806
72 Ga0157370_10293477 3300013104 Bacteria 1501
73 Ga0157370_10352157 3300013104 Bacteria 1357
74 Ga0157369_10001688 3300013105 Bacteria 26948
75 Ga0157369_10006342 3300013105 Bacteria 13726
76 Ga0157369_10084447 3300013105 Bacteria 3394
77 Ga0157369_10085206 3300013105 Bacteria 3377
78 Ga0157378_10126074 3300013297 Bacteria 2365
79 Ga0157378_10757128 3300013297 Unclassified 994
80 Ga0163162_10628795 3300013306 Bacteria 1198
81 Ga0157372_10012239 3300013307 Bacteria 9137
82 Ga0157372_10015721 3300013307 Bacteria 8116
83 Ga0157372_10019305 3300013307 Bacteria 7342
84 Ga0157372_10062652 3300013307 Bacteria 4167
85 Ga0157372_10085485 3300013307 Bacteria 3578
86 Ga0157372_10137392 3300013307 Bacteria 2815
87 Ga0157372_10195224 3300013307 Bacteria 2345
88 Ga0157372_10212087 3300013307 Bacteria 2244
89 Ga0157372_10237934 3300013307 Bacteria 2112
90 Ga0157372_10265330 3300013307 Bacteria 1994
91 Ga0157380_10000992 3300014326 Bacteria 18046
92 Ga0157380_10052469 3300014326 Bacteria 3229
93 Ga0157380_10272670 3300014326 Bacteria 1543
94 Ga0207647_10081148 3300025904 Bacteria 1944
95 Ga0207647_10156190 3300025904 Bacteria 1332
96 Ga0207705_10002369 3300025909 Bacteria 14570
97 Ga0207705_10012153 3300025909 Bacteria 6222
98 Ga0207705_10037333 3300025909 Bacteria 3476
99 Ga0207705_10301064 3300025909 Unclassified 1230
100 Ga0207707_10012873 3300025912 Bacteria 7280
101 Ga0207660_10012315 3300025917 Bacteria 5593
102 Ga0207660_10035780 3300025917 Bacteria 3449
103 Ga0207660_10204530 3300025917 Bacteria 1543
104 Ga0207657_10031431 3300025919 Bacteria 4809
105 Ga0207657_10067322 3300025919 Bacteria 3045
106 Ga0207657_10198486 3300025919 Bacteria 1615
107 Ga0207657_10564656 3300025919 Bacteria 889
108 Ga0207652_10000600 3300025921 Bacteria 35986
109 Ga0207652_10000887 3300025921 Bacteria 28316
110 Ga0207652_10002352 3300025921 Bacteria 15994
111 Ga0207652_10004000 3300025921 Bacteria 12042
112 Ga0207652_10105515 3300025921 Bacteria 2493
113 Ga0207652_10110168 3300025921 Bacteria 2441
114 Ga0207650_10110576 3300025925 Bacteria 2126
115 Ga0207690_10008101 3300025932 Bacteria 6236
116 Ga0207690_10193473 3300025932 Bacteria 1540
117 Ga0207690_10490861 3300025932 Bacteria 992
118 Ga0207689_10321455 3300025942 Bacteria 1284
119 Ga0207661_10175963 3300025944 Bacteria 1866
120 Ga0207667_10005073 3300025949 Bacteria 16090
121 Ga0207667_10011470 3300025949 Bacteria 10296
122 Ga0207667_10015715 3300025949 Bacteria 8585
123 Ga0207667_10076934 3300025949 Bacteria 3462
124 Ga0207667_10131408 3300025949 Unclassified 2579
125 Ga0207640_10123179 3300025981 Bacteria 1862
126 Ga0207658_10087818 3300025986 Bacteria 2402
127 Ga0207639_10164892 3300026041 Bacteria 1871
128 Ga0207678_10033101 3300026067 Bacteria 4504
129 Ga0207678_10091820 3300026067 Bacteria 2595
130 Ga0207678_10347837 3300026067 Bacteria 1278
131 Ga0207702_10009280 3300026078 Bacteria 8264
132 Ga0207648_10385071 3300026089 Bacteria 1268
133 Ga0207676_10194582 3300026095 Bacteria 1787
134 Ga0207674_10093777 3300026116 Bacteria 2990
135 Ga0207698_10232360 3300026142 Bacteria 1675
136 Ga0268265_10112060 3300028380 Bacteria 2229
137 Ga0268264_10026855 3300028381 Bacteria 4704
138 Ga0265323_10000254 3300028653 Bacteria 31452
139 Ga0265336_10012606 3300028666 Bacteria 2839
140 Ga0265338_10000658 3300028800 Bacteria 59815
141 Ga0265324_10101081 3300029957 Bacteria 980
142 Ga0265330_10067888 3300031235 Bacteria 1545
143 Ga0265320_10122519 3300031240 Bacteria 1185
144 Ga0265327_10000819 3300031251 Bacteria 46924
145 Ga0265327_10087752 3300031251 Unclassified 1523
146 Ga0265316_10003908 3300031344 Bacteria 14933
147 Ga0265316_10007790 3300031344 Bacteria 10029
148 Ga0265316_10021740 3300031344 Bacteria 5426
149 Ga0307408_100247708 3300031548 Bacteria 1468
150 Ga0316579_10092661 3300031691 Bacteria 1443
151 Ga0316579_10099587 3300031691 Bacteria 1391
152 Ga0316578_10004829 3300031728 Bacteria 6436
153 Ga0316578_10017833 3300031728 Bacteria 3874
154 Ga0316578_10021592 3300031728 Bacteria 3574
155 Ga0316578_10092465 3300031728 Bacteria 1808
156 Ga0316577_10072898 3300031733 Bacteria 1917
157 Ga0316580_10067816 3300032139 Bacteria 1093
158 Ga0316574_0026736 3300035398 Bacteria 3472
159 Ga0316574_0081379 3300035398 Bacteria 2057
160 Ga0316574_0257040 3300035398 Bacteria 1116
161 Ga0316584_0020791 3300036712 Unclassified 4765
162 Ga0316584_0080323 3300036712 Bacteria 2443
163 Ga0316584_0304419 3300036712 Bacteria 1153
164 Ga0395899_0003391 3300037312 Bacteria 12645
165 Ga0395899_0004023 3300037312 Bacteria 11589
166 Ga0395899_0030777 3300037312 Bacteria 4035
167 Ga0395899_0055503 3300037312 Bacteria 2930
168 Ga0395900_0018481 3300037418 Bacteria 7108
169 Ga0395900_0024537 3300037418 Bacteria 6174
170 Ga0395900_0067597 3300037418 Bacteria 3671
171 Ga0395900_0128270 3300037418 Unclassified 2600
172 Ga0395900_0343965 3300037418 Bacteria 1466
173 Ga0395900_0434517 3300037418 Bacteria 1271
174 Ga0395898_0003899 3300037466 Bacteria 16477
175 Ga0395898_0005541 3300037466 Bacteria 13617
176 Ga0395898_0029512 3300037466 Bacteria 5493
177 Ga0395898_0037931 3300037466 Bacteria 4777
178 Ga0395898_0039549 3300037466 Bacteria 4668
179 Ga0395898_0045346 3300037466 Bacteria 4322
180 Ga0395905_0066477 3300037471 Bacteria 3376
181 Ga0395905_0667538 3300037471 Bacteria 942
182 Ga0316581_0041959 3300037588 Bacteria 1395
183 Ga0395901_0023441 3300038443 Bacteria 6328
184 Ga0395901_0023984 3300038443 Bacteria 6258
185 Ga0395901_0132640 3300038443 Bacteria 2617
186 Ga0395901_0174261 3300038443 Bacteria 2256
187 Ga0395901_0223787 3300038443 Bacteria 1966
188 Ga0400489_17777 3300039093 Bacteria 4780
189 Ga0451795_0960193 3300041456 Bacteria 1384
190 Ga0451795_1286730 3300041456 Bacteria 4371
191 Ga0451577_0018082 3300042876 Bacteria 6498
192 Ga0451577_0028688 3300042876 Bacteria 5031
193 Ga0451577_0032190 3300042876 Bacteria 4726
194 Ga0451577_0033973 3300042876 Bacteria 4599
195 Ga0451577_0060949 3300042876 Unclassified 3364
196 Ga0451577_0095393 3300042876 Bacteria 2656
197 Ga0451577_0168477 3300042876 Unclassified 1974
198 Ga0451577_0225777 3300042876 Unclassified 1693
199 Ga0451577_0388115 3300042876 Bacteria 1267
200 Ga0451577_0548775 3300042876 Bacteria 1049
201 Ga0453683_0000032 3300044673 Bacteria 241702
202 Ga0453683_0000084 3300044673 Bacteria 142500
203 Ga0453683_0000111 3300044673 Bacteria 122663
204 Ga0453683_0000205 3300044673 Bacteria 79756
205 Ga0453683_0006944 3300044673 Bacteria 7719
206 Ga0453683_0014307 3300044673 Bacteria 5154
207 Ga0453683_0050865 3300044673 Unclassified 2596
208 Ga0453683_0147203 3300044673 Bacteria 1487
209 Ga0453683_0248935 3300044673 Bacteria 1132
210 Ga0453683_0346823 3300044673 Bacteria 953
211 Ga0453684_0000130 3300044712 Bacteria 331761
212 Ga0453684_0000148 3300044712 Bacteria 308453
213 Ga0453684_0000574 3300044712 Bacteria 137306
214 Ga0453684_0000636 3300044712 Bacteria 127361
215 Ga0453684_0003469 3300044712 Bacteria 35413
216 Ga0453684_0012437 3300044712 Bacteria 14033
217 Ga0453684_0013365 3300044712 Bacteria 13347
218 Ga0453684_0018217 3300044712 Bacteria 10799
219 Ga0453684_0032039 3300044712 Bacteria 7369
220 Ga0453684_0048368 3300044712 Bacteria 5626
221 Ga0453684_0049506 3300044712 Bacteria 5541
222 Ga0453684_0050174 3300044712 Bacteria 5492
223 Ga0453684_0054060 3300044712 Bacteria 5234
224 Ga0453684_0061904 3300044712 Bacteria 4799
225 Ga0453684_0077206 3300044712 Bacteria 4177
226 Ga0453684_0093196 3300044712 Bacteria 3711
227 Ga0453684_0093860 3300044712 Bacteria 3694
228 Ga0453684_0113874 3300044712 Unclassified 3280
229 Ga0453684_0165972 3300044712 Bacteria 2606
230 Ga0453684_0176745 3300044712 Bacteria 2510
231 Ga0453684_0186945 3300044712 Bacteria 2427
232 Ga0453684_0197146 3300044712 Bacteria 2350
233 Ga0453684_0212412 3300044712 Bacteria 2248
234 Ga0453684_0232658 3300044712 Unclassified 2127
235 Ga0453684_0349363 3300044712 Bacteria 1668
236 Ga0453684_0441345 3300044712 Bacteria 1450
237 Ga0453684_1430037 3300044712 Unclassified 716
238 Ga0451576_0000112 3300045051 Bacteria 209574
239 Ga0451576_0000353 3300045051 Bacteria 110215
240 Ga0451576_0000387 3300045051 Bacteria 102723
241 Ga0451576_0000411 3300045051 Bacteria 99403
242 Ga0451576_0002226 3300045051 Bacteria 29843
243 Ga0451576_0003284 3300045051 Bacteria 22460
244 Ga0451576_0005026 3300045051 Bacteria 16796
245 Ga0451576_0005715 3300045051 Bacteria 15507
246 Ga0451576_0006721 3300045051 Bacteria 14012
247 Ga0451576_0027647 3300045051 Bacteria 6089
248 Ga0451576_0049731 3300045051 Bacteria 4399
249 Ga0451576_0062848 3300045051 Bacteria 3870
250 Ga0451576_0084802 3300045051 Unclassified 3296
251 Ga0451576_0114506 3300045051 Bacteria 2807
252 Ga0451576_0139303 3300045051 Bacteria 2531
253 Ga0451576_0139553 3300045051 Unclassified 2528
254 Ga0451576_0280803 3300045051 Bacteria 1741
255 Ga0501033_0263964 3300049570 Bacteria 1218
256 Ga0501034_0209981 3300049571 Bacteria 1902
257 Ga0501034_0595207 3300049571 Bacteria 1012
258 Ga0501037_0162478 3300049573 Bacteria 1592
259 Ga0501206_008995 3300049653 Unclassified 1325
260 Ga0501217_001000 3300049661 Bacteria 5112
261 Ga0501236_000212 3300049670 Bacteria 6093
262 Ga0501259_002704 3300049688 Unclassified 2853
263 Ga0501225_0009091 3300049705 Bacteria 2839
264 Ga0501265_018965 3300049762 Unclassified 914
265 Ga0501035_0013675 3300049822 Bacteria 7488
266 Ga0501226_001761 3300049853 Bacteria 2726
267 Ga0500604_0000261 3300053151 Bacteria 14872
268 Ga0500622_0000031 3300053156 Bacteria 207165
269 Ga0500622_0000039 3300053156 Bacteria 170859
270 Ga0500627_0035559 3300053158 Bacteria 2117
271 2839992268 2839989709 Bacteria 3773432
272 Ga0451577_0000010
273 JGI24740J21852_10000667
274 rootH2_10012104
275 Ga0070658_10020598
276 Ga0070658_10056690
277 Ga0070658_10169489
278 Ga0068869_100240241
279 Ga0070680_100008098
280 Ga0070680_100015888
281 Ga0070680_100047434
282 Ga0070680_100122582
283 Ga0070680_100241355
284 Ga0070660_100010310
285 Ga0070660_100014040
286 Ga0070660_100037391
287 Ga0070660_100061118
288 Ga0070660_100300267
289 Ga0070659_100010717
290 Ga0070659_100148459
291 Ga0070659_100246727
292 Ga0070667_100112385
293 Ga0070711_100392731
294 Ga0070663_100017969
295 Ga0070663_100319946
296 Ga0070663_100529067
297 Ga0070681_10027266
298 Ga0070681_10240478
299 Ga0070681_10285452
300 Ga0068867_100358408
301 Ga0070679_100000801
302 Ga0070679_100006211
303 Ga0070679_100017968
304 Ga0070679_100057508
305 Ga0070679_100073738
306 Ga0070679_100200009
307 Ga0070684_100457518
308 Ga0068853_100062098
309 Ga0068855_100002605
310 Ga0068855_100009660
311 Ga0068855_100041312
312 Ga0068855_100103157
313 Ga0068855_100185312
314 Ga0068855_100258202
315 Ga0068856_100040266
316 Ga0068856_100081627
317 Ga0068852_100009127
318 Ga0068859_100009307
319 Ga0068864_100172634
320 Ga0068860_100014269
321 Ga0068862_100005283
322 Ga0097620_100009307
323 Ga0105249_10712597
324 Ga0157373_10000518
325 Ga0157373_10002859
326 Ga0157373_10037415
327 Ga0157373_10172943
328 Ga0157373_10180150
329 Ga0157371_10001204
330 Ga0157371_10001543
331 Ga0157371_10001838
332 Ga0157371_10003294
333 Ga0157371_10006770
334 Ga0157371_10009128
335 Ga0157371_10026708
336 Ga0157371_10057883
337 Ga0157371_10070927
338 Ga0157371_10301572
339 Ga0157370_10001635
340 Ga0157370_10006077
341 Ga0157370_10012352
342 Ga0157370_10209707
343 Ga0157370_10293477
344 Ga0157370_10352157
345 Ga0157369_10001688
346 Ga0157369_10006342
347 Ga0157369_10084447
348 Ga0157369_10085206
349 Ga0157378_10126074
350 Ga0157378_10757128
351 Ga0163162_10628795
352 Ga0157372_10012239
353 Ga0157372_10015721
354 Ga0157372_10019305
355 Ga0157372_10062652
356 Ga0157372_10085485
357 Ga0157372_10137392
358 Ga0157372_10195224
359 Ga0157372_10212087
360 Ga0157372_10237934
361 Ga0157372_10265330
362 Ga0157380_10000992
363 Ga0157380_10052469
364 Ga0157380_10272670
365 Ga0207647_10081148
366 Ga0207647_10156190
367 Ga0207705_10002369
368 Ga0207705_10012153
369 Ga0207705_10037333
370 Ga0207705_10301064
371 Ga0207707_10012873
372 Ga0207660_10012315
373 Ga0207660_10035780
374 Ga0207660_10204530
375 Ga0207657_10031431
376 Ga0207657_10067322
377 Ga0207657_10198486
378 Ga0207657_10564656
379 Ga0207652_10000600
380 Ga0207652_10000887
381 Ga0207652_10002352
382 Ga0207652_10004000
383 Ga0207652_10105515
384 Ga0207652_10110168
385 Ga0207650_10110576
386 Ga0207690_10008101
387 Ga0207690_10193473
388 Ga0207690_10490861
389 Ga0207689_10321455
390 Ga0207661_10175963
391 Ga0207667_10005073
392 Ga0207667_10011470
393 Ga0207667_10015715
394 Ga0207667_10076934
395 Ga0207667_10131408
396 Ga0207640_10123179
397 Ga0207658_10087818
398 Ga0207639_10164892
399 Ga0207678_10033101
400 Ga0207678_10091820
401 Ga0207678_10347837
402 Ga0207702_10009280
403 Ga0207648_10385071
404 Ga0207676_10194582
405 Ga0207674_10093777
406 Ga0207698_10232360
407 Ga0268265_10112060
408 Ga0268264_10026855
409 Ga0265323_10000254
410 Ga0265336_10012606
411 Ga0265338_10000658
412 Ga0265324_10101081
413 Ga0265330_10067888
414 Ga0265320_10122519
415 Ga0265327_10000819
416 Ga0265327_10087752
417 Ga0265316_10003908
418 Ga0265316_10007790
419 Ga0265316_10021740
420 Ga0307408_100247708
421 Ga0316579_10092661
422 Ga0316579_10099587
423 Ga0316578_10004829
424 Ga0316578_10017833
425 Ga0316578_10021592
426 Ga0316578_10092465
427 Ga0316577_10072898
428 Ga0316580_10067816
429 Ga0316574_0026736
430 Ga0316574_0081379
431 Ga0316574_0257040
432 Ga0316584_0020791
433 Ga0316584_0080323
434 Ga0316584_0304419
435 Ga0395899_0003391
436 Ga0395899_0004023
437 Ga0395899_0030777
438 Ga0395899_0055503
439 Ga0395900_0018481
440 Ga0395900_0024537
441 Ga0395900_0067597
442 Ga0395900_0128270
443 Ga0395900_0343965
444 Ga0395900_0434517
445 Ga0395898_0003899
446 Ga0395898_0005541
447 Ga0395898_0029512
448 Ga0395898_0037931
449 Ga0395898_0039549
450 Ga0395898_0045346
451 Ga0395905_0066477
452 Ga0395905_0667538
453 Ga0316581_0041959
454 Ga0395901_0023441
455 Ga0395901_0023984
456 Ga0395901_0132640
457 Ga0395901_0174261
458 Ga0395901_0223787
459 Ga0400489_17777
460 Ga0451795_0960193
461 Ga0451795_1286730
462 Ga0451577_0018082
463 Ga0451577_0028688
464 Ga0451577_0032190
465 Ga0451577_0033973
466 Ga0451577_0060949
467 Ga0451577_0095393
468 Ga0451577_0168477
469 Ga0451577_0225777
470 Ga0451577_0388115
471 Ga0451577_0548775
472 Ga0453683_0000032
473 Ga0453683_0000084
474 Ga0453683_0000111
475 Ga0453683_0000205
476 Ga0453683_0006944
477 Ga0453683_0014307
478 Ga0453683_0050865
479 Ga0453683_0147203
480 Ga0453683_0248935
481 Ga0453683_0346823
482 Ga0453684_0000130
483 Ga0453684_0000148
484 Ga0453684_0000574
485 Ga0453684_0000636
486 Ga0453684_0003469
487 Ga0453684_0012437
488 Ga0453684_0013365
489 Ga0453684_0018217
490 Ga0453684_0032039
491 Ga0453684_0048368
492 Ga0453684_0049506
493 Ga0453684_0050174
494 Ga0453684_0054060
495 Ga0453684_0061904
496 Ga0453684_0077206
497 Ga0453684_0093196
498 Ga0453684_0093860
499 Ga0453684_0113874
500 Ga0453684_0165972
501 Ga0453684_0176745
502 Ga0453684_0186945
503 Ga0453684_0197146
504 Ga0453684_0212412
505 Ga0453684_0232658
506 Ga0453684_0349363
507 Ga0453684_0441345
508 Ga0453684_1430037
509 Ga0451576_0000112
510 Ga0451576_0000353
511 Ga0451576_0000387
512 Ga0451576_0000411
513 Ga0451576_0002226
514 Ga0451576_0003284
515 Ga0451576_0005026
516 Ga0451576_0005715
517 Ga0451576_0006721
518 Ga0451576_0027647
519 Ga0451576_0049731
520 Ga0451576_0062848
521 Ga0451576_0084802
522 Ga0451576_0114506
523 Ga0451576_0139303
524 Ga0451576_0139553
525 Ga0451576_0280803
526 Ga0501033_0263964
527 Ga0501034_0209981
528 Ga0501034_0595207
529 Ga0501037_0162478
530 Ga0501206_008995
531 Ga0501217_001000
532 Ga0501236_000212
533 Ga0501259_002704
534 Ga0501225_0009091
535 Ga0501265_018965
536 Ga0501035_0013675
537 Ga0501226_001761
538 Ga0500604_0000261
539 Ga0500622_0000031
540 Ga0500622_0000039
541 Ga0500627_0035559
542 2839992268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20600

ExoX-like_C

Exodeoxyribonuclease X-like C-terminal

239

267

0.95

PF00929

RNase_T

Exonuclease

29

184

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p1j-assembly1.cif.gz_A crystal structure of a polc-type dna polymerase iii exonuclease domain from thermotoga maritima 0.9083 27 152
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.8877 26 186
4js4-assembly3.cif.gz_A crystal structure of e. coli exonuclease i in complex with a da16 oligonucleotide 0.8795 24 181
7tqn-assembly1.cif.gz_A-2 structure of human trex1 0.878 25 189
7tqq-assembly2.cif.gz_F structure of human trex1-dna complex 0.8752 25 189
ID Description Score Start End Superfamily
af_Q2FYH5_2_169_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9008 25 190 3.30.420.10
2p1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.896 27 153 3.30.420.10
1j54A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8913 27 185 3.30.420.10
af_Q2FYH5_2_169_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8856 25 190 3.30.420.10
af_P9WLJ1_34_216_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8807 20 189 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2D5NB61-F1-model_v4 Exonuclease domain-containing protein 0.9721 20 82 GO:0003676
GO:0004527
GO:0006259
AF-A0A3C0BIY8-F1-model_v4 3'-5' exonuclease 0.9554 25 133 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A5R2ATV5-F1-model_v4 3'-5' exonuclease 0.9471 25 206 GO:0003676
GO:0005829
GO:0008408
GO:0045004
AF-A0A382RU37-F1-model_v4 Exonuclease domain-containing protein 0.9451 26 132 GO:0003677
GO:0003887
GO:0006260
GO:0008408
AF-F3MRR4-F1-model_v4 deleted 0.9445 25 125

Map