F377814

General Info

Members Datasets Scaffolds Average Seq Length
271 200 542 155

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0035750|Ga0436361_0035750_398_928
Length 176
Sequence MSPYEVHGFQSGMTHEHNHKSHTRRSVLIGAGCVAGGLGLPTLLTIRQAEATPATMASAIRLVVGEAAVKPGKVKLEMPPLVENGNTVQYTVSVESPMTAKDYVKAIHVFNEKNPQPNVISVRLGPHAGRASFTSRARLADSEKVVAIAEMSDGSFWSDTIEVVVTIAACVEDGIP

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
131 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
132 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
133 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
195 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
196 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.71
Nodule 0
Rhizoplane 8.12
Rhizosphere 73.43
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0035750 3300039447 Bacteria 1906
2 JGI25153J46596_10004814 3300003215 Bacteria 7190
3 Ga0065712_10439639 3300005290 Bacteria 695
4 Ga0065715_10205744 3300005293 Bacteria 1338
5 Ga0065707_10278910 3300005295 Bacteria 1052
6 Ga0070658_10498155 3300005327 Bacteria 1052
7 Ga0070676_10447151 3300005328 Bacteria 908
8 Ga0070690_100008471 3300005330 Bacteria 5924
9 Ga0070670_100304694 3300005331 Bacteria 1394
10 Ga0070680_100053807 3300005336 Bacteria 3285
11 Ga0068868_100393961 3300005338 Bacteria 1194
12 Ga0068868_100945123 3300005338 Bacteria 786
13 Ga0070689_100002127 3300005340 Bacteria 12872
14 Ga0070689_101715472 3300005340 Bacteria 572
15 Ga0070687_100412355 3300005343 Bacteria 889
16 Ga0070668_100705676 3300005347 Bacteria 890
17 Ga0070669_100135312 3300005353 Bacteria 1895
18 Ga0070669_100196023 3300005353 Bacteria 1587
19 Ga0070675_100089263 3300005354 Bacteria 2581
20 Ga0070675_100324657 3300005354 Bacteria 1360
21 Ga0070675_101406149 3300005354 Bacteria 643
22 Ga0070671_100079734 3300005355 Bacteria 2737
23 Ga0070671_100098657 3300005355 Bacteria 2451
24 Ga0070671_100827421 3300005355 Bacteria 807
25 Ga0070674_101290670 3300005356 Bacteria 651
26 Ga0070673_100189789 3300005364 Bacteria 1764
27 Ga0070673_102068099 3300005364 Bacteria 541
28 Ga0070667_100034277 3300005367 Bacteria 4247
29 Ga0070711_100797053 3300005439 Unclassified 801
30 Ga0070700_100175266 3300005441 Bacteria 1488
31 Ga0070700_101121589 3300005441 Bacteria 653
32 Ga0070663_100728965 3300005455 Bacteria 845
33 Ga0070662_101059213 3300005457 Bacteria 695
34 Ga0070662_101443797 3300005457 Bacteria 593
35 Ga0070681_10758673 3300005458 Bacteria 887
36 Ga0068867_100226403 3300005459 Bacteria 1509
37 Ga0070679_100004998 3300005530 Bacteria 12236
38 Ga0070672_100043125 3300005543 Bacteria 3476
39 Ga0070672_100242644 3300005543 Bacteria 1516
40 Ga0070672_100328118 3300005543 Bacteria 1302
41 Ga0070672_101618067 3300005543 Bacteria 581
42 Ga0070686_100445029 3300005544 Bacteria 995
43 Ga0070665_100015938 3300005548 Bacteria 7543
44 Ga0070665_100021601 3300005548 Bacteria 6471
45 Ga0068855_100432804 3300005563 Bacteria 1438
46 Ga0070702_101773464 3300005615 Bacteria 515
47 Ga0068859_100174029 3300005617 Bacteria 2234
48 Ga0068863_101090749 3300005841 Bacteria 803
49 Ga0068858_101606473 3300005842 Bacteria 642
50 Ga0068858_101848167 3300005842 Bacteria 597
51 Ga0068860_100841920 3300005843 Bacteria 932
52 Ga0068862_100148121 3300005844 Bacteria 2088
53 Ga0081540_1000102 3300005983 Bacteria 91311
54 Ga0081540_1039121 3300005983 Bacteria 2489
55 Ga0075365_10740974 3300006038 Bacteria 694
56 Ga0075368_10038174 3300006042 Bacteria 1880
57 Ga0075368_10057854 3300006042 Bacteria 1548
58 Ga0075368_10084168 3300006042 Bacteria 1296
59 Ga0075368_10136358 3300006042 Bacteria 1021
60 Ga0075363_100067110 3300006048 Bacteria 1943
61 Ga0075363_100090634 3300006048 Bacteria 1682
62 Ga0075364_10038318 3300006051 Bacteria 3105
63 Ga0075364_10329092 3300006051 Bacteria 1040
64 Ga0070715_10427329 3300006163 Bacteria 743
65 Ga0075362_10131929 3300006177 Bacteria 1189
66 Ga0075362_10163254 3300006177 Unclassified 1073
67 Ga0075367_10280253 3300006178 Bacteria 1048
68 Ga0075369_10067783 3300006186 Bacteria 1567
69 Ga0075366_10066567 3300006195 Bacteria 2143
70 Ga0075366_10130015 3300006195 Bacteria 1519
71 Ga0075366_10360070 3300006195 Bacteria 893
72 Ga0097621_100179290 3300006237 Bacteria 1830
73 Ga0097621_100548678 3300006237 Bacteria 1052
74 Ga0097621_100911987 3300006237 Bacteria 819
75 Ga0075370_10372880 3300006353 Bacteria 854
76 Ga0075428_101001381 3300006844 Bacteria 885
77 Ga0075433_10131534 3300006852 Bacteria 2223
78 Ga0068865_100443541 3300006881 Bacteria 1072
79 Ga0075436_100247577 3300006914 Bacteria 1269
80 Ga0097620_100174015 3300006931 Bacteria 2234
81 Ga0097620_101956711 3300006931 Bacteria 647
82 Ga0075435_101148612 3300007076 Bacteria 679
83 Ga0111539_10076876 3300009094 Bacteria 3930
84 Ga0111539_10206141 3300009094 Bacteria 2292
85 Ga0105245_10686324 3300009098 Bacteria 1056
86 Ga0114129_10073085 3300009147 Bacteria 4778
87 Ga0114129_10310102 3300009147 Bacteria 2101
88 Ga0105241_10591989 3300009174 Bacteria 1001
89 Ga0105242_10453050 3300009176 Bacteria 1210
90 Ga0105248_10016799 3300009177 Bacteria 8058
91 Ga0105248_10175881 3300009177 Bacteria 2412
92 Ga0105238_11070061 3300009551 Bacteria 829
93 Ga0105249_10674059 3300009553 Bacteria 1093
94 Ga0105249_11376464 3300009553 Bacteria 777
95 Ga0105249_12908862 3300009553 Bacteria 550
96 Ga0099796_10268175 3300010159 Bacteria 714
97 Ga0105239_11662572 3300010375 Bacteria 739
98 Ga0105246_10395286 3300011119 Bacteria 1146
99 Ga0157374_11408600 3300013296 Bacteria 720
100 Ga0157378_11678008 3300013297 Bacteria 682
101 Ga0157378_11955839 3300013297 Bacteria 636
102 Ga0163162_13172080 3300013306 Bacteria 528
103 Ga0157375_10295603 3300013308 Bacteria 1783
104 Ga0157375_10536877 3300013308 Bacteria 1332
105 Ga0157380_10487805 3300014326 Bacteria 1193
106 Ga0157380_11227066 3300014326 Bacteria 794
107 Ga0157379_10139091 3300014968 Bacteria 2188
108 Ga0157376_11093870 3300014969 Bacteria 823
109 Ga0157376_11151545 3300014969 Bacteria 803
110 Ga0209758_1000435 3300025297 Bacteria 70539
111 Ga0207688_10653548 3300025901 Bacteria 664
112 Ga0207680_11209173 3300025903 Bacteria 539
113 Ga0207685_10327583 3300025905 Bacteria 766
114 Ga0207645_10248647 3300025907 Bacteria 1176
115 Ga0207643_10299270 3300025908 Bacteria 1001
116 Ga0207707_10452709 3300025912 Bacteria 1098
117 Ga0207707_10545098 3300025912 Bacteria 986
118 Ga0207660_10265659 3300025917 Bacteria 1358
119 Ga0207652_11359976 3300025921 Bacteria 613
120 Ga0207646_10726657 3300025922 Bacteria 887
121 Ga0207681_10415402 3300025923 Bacteria 1089
122 Ga0207694_10770569 3300025924 Bacteria 812
123 Ga0207659_10044446 3300025926 Bacteria 3125
124 Ga0207659_10082845 3300025926 Bacteria 2376
125 Ga0207687_10891721 3300025927 Bacteria 761
126 Ga0207644_10079191 3300025931 Bacteria 2424
127 Ga0207669_10669675 3300025937 Bacteria 850
128 Ga0207704_10034152 3300025938 Bacteria 2900
129 Ga0207704_11502220 3300025938 Bacteria 578
130 Ga0207691_10311959 3300025940 Bacteria 1350
131 Ga0207691_10437487 3300025940 Bacteria 1114
132 Ga0207711_10018144 3300025941 Bacteria 5851
133 Ga0207712_10163309 3300025961 Bacteria 1733
134 Ga0207668_10683489 3300025972 Bacteria 901
135 Ga0207703_11512880 3300026035 Bacteria 646
136 Ga0207703_11645508 3300026035 Bacteria 618
137 Ga0207678_10170912 3300026067 Bacteria 1856
138 Ga0207678_10815897 3300026067 Bacteria 824
139 Ga0207708_10080947 3300026075 Bacteria 2495
140 Ga0207648_11608175 3300026089 Bacteria 611
141 Ga0207675_100471931 3300026118 Bacteria 1246
142 Ga0207675_101951922 3300026118 Bacteria 605
143 Ga0209813_10005730 3300027866 Bacteria 3031
144 Ga0209813_10021284 3300027866 Bacteria 1821
145 Ga0207428_10265689 3300027907 Bacteria 1277
146 Ga0268266_10013446 3300028379 Bacteria 7047
147 Ga0268266_10032614 3300028379 Bacteria 4425
148 Ga0268265_11179199 3300028380 Bacteria 763
149 Ga0265332_10012882 3300031238 Bacteria 3708
150 Ga0265329_10015479 3300031242 Bacteria 2664
151 Ga0265340_10012921 3300031247 Bacteria 4398
152 Ga0265340_10058374 3300031247 Bacteria 1853
153 Ga0265339_10036002 3300031249 Bacteria 2771
154 Ga0265339_10179779 3300031249 Bacteria 1054
155 Ga0265331_10009031 3300031250 Bacteria 5633
156 Ga0265316_10337849 3300031344 Bacteria 1092
157 Ga0265314_10013319 3300031711 Bacteria 6649
158 Ga0265342_10001182 3300031712 Bacteria 24782
159 Ga0307416_101366627 3300032002 Bacteria 814
160 Ga0373930_0024254 3300034816 Bacteria 1212
161 Ga0373959_0017218 3300034820 Bacteria 1348
162 Ga0373928_0037234 3300035084 Bacteria 1103
163 Ga0373929_0005651 3300035085 Bacteria 2255
164 Ga0373929_0045038 3300035085 Bacteria 992
165 Ga0373940_0025663 3300035088 Bacteria 1536
166 Ga0373951_0003648 3300035091 Bacteria 3712
167 Ga0373952_0030827 3300035092 Bacteria 1189
168 Ga0373939_0139274 3300035114 Bacteria 874
169 Ga0373941_0164366 3300035115 Bacteria 823
170 Ga0373941_0256880 3300035115 Bacteria 684
171 Ga0373946_0075641 3300035171 Bacteria 1464
172 Ga0373961_0128031 3300035241 Bacteria 848
173 Ga0373962_0067722 3300035242 Bacteria 1061
174 Ga0373931_0005632 3300035691 Bacteria 5811
175 Ga0373931_0006081 3300035691 Bacteria 5624
176 Ga0373931_0298558 3300035691 Bacteria 994
177 Ga0373935_0108923 3300035692 Bacteria 1836
178 Ga0373927_0127145 3300035695 Bacteria 1664
179 Ga0373937_0797994 3300036401 Bacteria 892
180 Ga0373925_0027047 3300037068 Bacteria 4200
181 Ga0439453_0018873 3300041408 Bacteria 1223
182 Ga0451787_740779 3300041441 Bacteria 819
183 Ga0451855_1948668 3300041511 Bacteria 567
184 Ga0439440_0020266 3300042993 Bacteria 1490
185 Ga0495592_0118121 3300046454 Bacteria 1869
186 Ga0495584_0073045 3300046491 Bacteria 1724
187 Ga0495640_0208323 3300046533 Bacteria 1237
188 Ga0495635_0182138 3300046663 Bacteria 1428
189 Ga0495674_0058436 3300047319 Bacteria 3372
190 Ga0495672_0038562 3300047320 Bacteria 2914
191 Ga0496100_0209044 3300048903 Bacteria 1426
192 Ga0496101_0146308 3300048904 Bacteria 1804
193 Ga0496103_0069364 3300048906 Bacteria 2204
194 Ga0496104_0043996 3300048907 Bacteria 4195
195 Ga0496105_0172359 3300048908 Bacteria 1773
196 Ga0496106_0042564 3300048909 Bacteria 3406
197 Ga0496107_0406255 3300048910 Bacteria 1013
198 Ga0496107_0778035 3300048910 Bacteria 701
199 Ga0496108_0265383 3300048911 Bacteria 1494
200 Ga0496109_0168490 3300048912 Bacteria 2054
201 Ga0496110_0153104 3300048913 Bacteria 2088
202 Ga0496110_0814559 3300048913 Bacteria 838
203 Ga0496111_0053539 3300048914 Bacteria 2916
204 Ga0496112_0312516 3300048915 Bacteria 1516
205 Ga0496112_0375306 3300048915 Bacteria 1363
206 Ga0496113_0615308 3300048916 Bacteria 869
207 Ga0496114_0017839 3300048917 Bacteria 5736
208 Ga0496114_0046185 3300048917 Bacteria 3619
209 Ga0496114_0470793 3300048917 Bacteria 1112
210 Ga0496114_0556283 3300048917 Bacteria 1013
211 Ga0496115_0188228 3300048918 Bacteria 1705
212 Ga0496124_0300173 3300048927 Bacteria 1161
213 Ga0501036_0005911 3300049572 Bacteria 9917
214 Ga0501037_0065576 3300049573 Bacteria 2645
215 Ga0501038_0020172 3300049574 Bacteria 5996
216 Ga0501039_0009067 3300049575 Bacteria 7583
217 Ga0501042_0194116 3300049578 Bacteria 1464
218 Ga0501043_0232265 3300049579 Bacteria 1424
219 Ga0501046_0008999 3300049580 Bacteria 8663
220 Ga0501048_0013379 3300049582 Bacteria 6089
221 Ga0501067_0479023 3300049583 Bacteria 696
222 Ga0501068_0002216 3300049584 Bacteria 10336
223 Ga0501069_0001752 3300049585 Bacteria 10825
224 Ga0501071_0816396 3300049587 Bacteria 719
225 Ga0501072_0153516 3300049588 Bacteria 1836
226 Ga0501073_0099195 3300049589 Bacteria 2022
227 Ga0501073_0291674 3300049589 Bacteria 1126
228 Ga0501221_153484 3300049704 Bacteria 612
229 Ga0501079_0737472 3300049741 Unclassified 775
230 Ga0501080_0106713 3300049742 Bacteria 2595
231 Ga0501083_0092853 3300049744 Bacteria 1992
232 Ga0501035_0423744 3300049822 Bacteria 1104
233 Ga0501044_0061643 3300049823 Bacteria 3836
234 Ga0501045_0035677 3300049824 Bacteria 3611
235 Ga0501045_0946719 3300049824 Bacteria 632
236 nmdc:mga03683_167254_c1 3300050489 Bacteria 998
237 nmdc:mga03n38_30319_c1 3300050490 Bacteria 2273
238 nmdc:mga03n38_399074_c1 3300050490 Bacteria 757
239 nmdc:mga03n38_564839_c1 3300050490 Bacteria 645
240 nmdc:mga00v17_267859_c1 3300050491 Bacteria 1109
241 nmdc:mga0yw44_191436_c1 3300050492 Bacteria 1349
242 nmdc:mga0yw44_700990_c1 3300050492 Bacteria 688
243 nmdc:mga0k408_102518_c1 3300050493 Bacteria 1688
244 nmdc:mga0k408_22090_c2 3300050493 Bacteria 2760
245 nmdc:mga0k408_228477_c1 3300050493 Bacteria 1111
246 nmdc:mga06z11_541272_c1 3300050494 Bacteria 707
247 nmdc:mga06z11_550114_c1 3300050494 Bacteria 701
248 nmdc:mga06z11_80700_c1 3300050494 Bacteria 1745
249 nmdc:mga04h51_25464_c1 3300050495 Bacteria 1821
250 nmdc:mga07m45_133146_c1 3300050496 Bacteria 1439
251 nmdc:mga07m45_60944_c1 3300050496 Bacteria 2137
252 nmdc:mga05p37_66268_c1 3300050507 Bacteria 4442
253 nmdc:mga08y16_166161_c1 3300050511 Bacteria 2292
254 nmdc:mga08x19_261026_c1 3300050514 Bacteria 1197
255 nmdc:mga0a205_49050_c1 3300050515 Bacteria 4074
256 nmdc:mga0sz30_17551_c1 3300050516 Bacteria 2855
257 Ga0495601_0024177 3300053077 Bacteria 3740
258 Ga0495619_0027152 3300053085 Bacteria 3688
259 Ga0500644_0029259 3300053088 Bacteria 1731
260 Ga0500644_0167315 3300053088 Bacteria 892
261 Ga0500641_0142037 3300053096 Bacteria 1037
262 Ga0500556_0153921 3300053104 Bacteria 907
263 Ga0500642_0006146 3300053130 Bacteria 3932
264 Ga0500652_040054 3300053131 Bacteria 1881
265 Ga0500568_0252731 3300053139 Bacteria 642
266 Ga0500616_0002075 3300053153 Bacteria 17550
267 Ga0500616_0029688 3300053153 Bacteria 3008
268 Ga0500616_0087462 3300053153 Bacteria 1551
269 Ga0501084_0032968 3300054114 Bacteria 4333
270 Ga0501084_0114264 3300054114 Bacteria 2270
271 Ga0501082_0002831 3300060353 Bacteria 15119
272 Ga0436361_0035750
273 JGI25153J46596_10004814
274 Ga0065712_10439639
275 Ga0065715_10205744
276 Ga0065707_10278910
277 Ga0070658_10498155
278 Ga0070676_10447151
279 Ga0070690_100008471
280 Ga0070670_100304694
281 Ga0070680_100053807
282 Ga0068868_100393961
283 Ga0068868_100945123
284 Ga0070689_100002127
285 Ga0070689_101715472
286 Ga0070687_100412355
287 Ga0070668_100705676
288 Ga0070669_100135312
289 Ga0070669_100196023
290 Ga0070675_100089263
291 Ga0070675_100324657
292 Ga0070675_101406149
293 Ga0070671_100079734
294 Ga0070671_100098657
295 Ga0070671_100827421
296 Ga0070674_101290670
297 Ga0070673_100189789
298 Ga0070673_102068099
299 Ga0070667_100034277
300 Ga0070711_100797053
301 Ga0070700_100175266
302 Ga0070700_101121589
303 Ga0070663_100728965
304 Ga0070662_101059213
305 Ga0070662_101443797
306 Ga0070681_10758673
307 Ga0068867_100226403
308 Ga0070679_100004998
309 Ga0070672_100043125
310 Ga0070672_100242644
311 Ga0070672_100328118
312 Ga0070672_101618067
313 Ga0070686_100445029
314 Ga0070665_100015938
315 Ga0070665_100021601
316 Ga0068855_100432804
317 Ga0070702_101773464
318 Ga0068859_100174029
319 Ga0068863_101090749
320 Ga0068858_101606473
321 Ga0068858_101848167
322 Ga0068860_100841920
323 Ga0068862_100148121
324 Ga0081540_1000102
325 Ga0081540_1039121
326 Ga0075365_10740974
327 Ga0075368_10038174
328 Ga0075368_10057854
329 Ga0075368_10084168
330 Ga0075368_10136358
331 Ga0075363_100067110
332 Ga0075363_100090634
333 Ga0075364_10038318
334 Ga0075364_10329092
335 Ga0070715_10427329
336 Ga0075362_10131929
337 Ga0075362_10163254
338 Ga0075367_10280253
339 Ga0075369_10067783
340 Ga0075366_10066567
341 Ga0075366_10130015
342 Ga0075366_10360070
343 Ga0097621_100179290
344 Ga0097621_100548678
345 Ga0097621_100911987
346 Ga0075370_10372880
347 Ga0075428_101001381
348 Ga0075433_10131534
349 Ga0068865_100443541
350 Ga0075436_100247577
351 Ga0097620_100174015
352 Ga0097620_101956711
353 Ga0075435_101148612
354 Ga0111539_10076876
355 Ga0111539_10206141
356 Ga0105245_10686324
357 Ga0114129_10073085
358 Ga0114129_10310102
359 Ga0105241_10591989
360 Ga0105242_10453050
361 Ga0105248_10016799
362 Ga0105248_10175881
363 Ga0105238_11070061
364 Ga0105249_10674059
365 Ga0105249_11376464
366 Ga0105249_12908862
367 Ga0099796_10268175
368 Ga0105239_11662572
369 Ga0105246_10395286
370 Ga0157374_11408600
371 Ga0157378_11678008
372 Ga0157378_11955839
373 Ga0163162_13172080
374 Ga0157375_10295603
375 Ga0157375_10536877
376 Ga0157380_10487805
377 Ga0157380_11227066
378 Ga0157379_10139091
379 Ga0157376_11093870
380 Ga0157376_11151545
381 Ga0209758_1000435
382 Ga0207688_10653548
383 Ga0207680_11209173
384 Ga0207685_10327583
385 Ga0207645_10248647
386 Ga0207643_10299270
387 Ga0207707_10452709
388 Ga0207707_10545098
389 Ga0207660_10265659
390 Ga0207652_11359976
391 Ga0207646_10726657
392 Ga0207681_10415402
393 Ga0207694_10770569
394 Ga0207659_10044446
395 Ga0207659_10082845
396 Ga0207687_10891721
397 Ga0207644_10079191
398 Ga0207669_10669675
399 Ga0207704_10034152
400 Ga0207704_11502220
401 Ga0207691_10311959
402 Ga0207691_10437487
403 Ga0207711_10018144
404 Ga0207712_10163309
405 Ga0207668_10683489
406 Ga0207703_11512880
407 Ga0207703_11645508
408 Ga0207678_10170912
409 Ga0207678_10815897
410 Ga0207708_10080947
411 Ga0207648_11608175
412 Ga0207675_100471931
413 Ga0207675_101951922
414 Ga0209813_10005730
415 Ga0209813_10021284
416 Ga0207428_10265689
417 Ga0268266_10013446
418 Ga0268266_10032614
419 Ga0268265_11179199
420 Ga0265332_10012882
421 Ga0265329_10015479
422 Ga0265340_10012921
423 Ga0265340_10058374
424 Ga0265339_10036002
425 Ga0265339_10179779
426 Ga0265331_10009031
427 Ga0265316_10337849
428 Ga0265314_10013319
429 Ga0265342_10001182
430 Ga0307416_101366627
431 Ga0373930_0024254
432 Ga0373959_0017218
433 Ga0373928_0037234
434 Ga0373929_0005651
435 Ga0373929_0045038
436 Ga0373940_0025663
437 Ga0373951_0003648
438 Ga0373952_0030827
439 Ga0373939_0139274
440 Ga0373941_0164366
441 Ga0373941_0256880
442 Ga0373946_0075641
443 Ga0373961_0128031
444 Ga0373962_0067722
445 Ga0373931_0005632
446 Ga0373931_0006081
447 Ga0373931_0298558
448 Ga0373935_0108923
449 Ga0373927_0127145
450 Ga0373937_0797994
451 Ga0373925_0027047
452 Ga0439453_0018873
453 Ga0451787_740779
454 Ga0451855_1948668
455 Ga0439440_0020266
456 Ga0495592_0118121
457 Ga0495584_0073045
458 Ga0495640_0208323
459 Ga0495635_0182138
460 Ga0495674_0058436
461 Ga0495672_0038562
462 Ga0496100_0209044
463 Ga0496101_0146308
464 Ga0496103_0069364
465 Ga0496104_0043996
466 Ga0496105_0172359
467 Ga0496106_0042564
468 Ga0496107_0406255
469 Ga0496107_0778035
470 Ga0496108_0265383
471 Ga0496109_0168490
472 Ga0496110_0153104
473 Ga0496110_0814559
474 Ga0496111_0053539
475 Ga0496112_0312516
476 Ga0496112_0375306
477 Ga0496113_0615308
478 Ga0496114_0017839
479 Ga0496114_0046185
480 Ga0496114_0470793
481 Ga0496114_0556283
482 Ga0496115_0188228
483 Ga0496124_0300173
484 Ga0501036_0005911
485 Ga0501037_0065576
486 Ga0501038_0020172
487 Ga0501039_0009067
488 Ga0501042_0194116
489 Ga0501043_0232265
490 Ga0501046_0008999
491 Ga0501048_0013379
492 Ga0501067_0479023
493 Ga0501068_0002216
494 Ga0501069_0001752
495 Ga0501071_0816396
496 Ga0501072_0153516
497 Ga0501073_0099195
498 Ga0501073_0291674
499 Ga0501221_153484
500 Ga0501079_0737472
501 Ga0501080_0106713
502 Ga0501083_0092853
503 Ga0501035_0423744
504 Ga0501044_0061643
505 Ga0501045_0035677
506 Ga0501045_0946719
507 nmdc:mga03683_167254_c1
508 nmdc:mga03n38_30319_c1
509 nmdc:mga03n38_399074_c1
510 nmdc:mga03n38_564839_c1
511 nmdc:mga00v17_267859_c1
512 nmdc:mga0yw44_191436_c1
513 nmdc:mga0yw44_700990_c1
514 nmdc:mga0k408_102518_c1
515 nmdc:mga0k408_22090_c2
516 nmdc:mga0k408_228477_c1
517 nmdc:mga06z11_541272_c1
518 nmdc:mga06z11_550114_c1
519 nmdc:mga06z11_80700_c1
520 nmdc:mga04h51_25464_c1
521 nmdc:mga07m45_133146_c1
522 nmdc:mga07m45_60944_c1
523 nmdc:mga05p37_66268_c1
524 nmdc:mga08y16_166161_c1
525 nmdc:mga08x19_261026_c1
526 nmdc:mga0a205_49050_c1
527 nmdc:mga0sz30_17551_c1
528 Ga0495601_0024177
529 Ga0495619_0027152
530 Ga0500644_0029259
531 Ga0500644_0167315
532 Ga0500641_0142037
533 Ga0500556_0153921
534 Ga0500642_0006146
535 Ga0500652_040054
536 Ga0500568_0252731
537 Ga0500616_0002075
538 Ga0500616_0029688
539 Ga0500616_0087462
540 Ga0501084_0032968
541 Ga0501084_0114264
542 Ga0501082_0002831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13501

SoxY

Sulfur oxidation protein SoxY

60

170

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxh-assembly3.cif.gz_D the soxyz complex of paracoccus pantotrophus 0.8985 34 146
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8844 52 145
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8807 52 143
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8804 52 145
2nnc-assembly1.cif.gz_A structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8773 35 146
ID Description Score Start End Superfamily
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.9112 34 146 2.60.40.2470
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8844 52 145 2.60.40.10
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8773 35 146 2.60.40.2470
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8745 46 145 2.60.40.730
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.872 34 146 2.60.40.2470
ID Description Score Start End GO Terms
AF-A0A364NYZ9-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.9594 36 145
AF-A0A526YJA9-F1-model_v4 Sulfur oxidation protein SoxY 0.9475 40 129
AF-A0A7V8ZNC9-F1-model_v4 Quinoprotein dehydrogenase-associated SoxYZ-like carrier 0.9303 56 145
AF-A0A2E0F779-F1-model_v4 Quinoprotein dehydrogenase-associated SoxYZ-like carrier 0.9291 45 143
AF-A0A6I7W8P8-F1-model_v4 Quinoprotein dehydrogenase-associated SoxYZ-like carrier 0.9266 53 145

Map