F377639

General Info

Members Datasets Scaffolds Average Seq Length
271 175 271 186

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10802880|Ga0105249_108028801
Length 198
Sequence METGFIHTMRRTMGSDPRDVLLAELREHALVIGEVTLSSGRTAQYYVDAKRALLRPPAFRAAGELIAAEAAERGAGAVGGMTIGADPLACAAIAGEAGDDLVAFFVRKERKEHGLQRWIEGPVLEAGTRCLVVEDVVTTGGSTVRAIERILEEGLEVAGVTAVVDRLAGGAEAIERAAGAPYRPLLTIDELYPDRPDR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
70 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
71 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 14.76
Rhizosphere 80.07
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10054604 3300003203 Bacteria 1320
2 JGI25407J50210_10006157 3300003373 Bacteria 2978
3 JGI25407J50210_10010819 3300003373 Bacteria 2326
4 JGI25407J50210_10014126 3300003373 Bacteria 2057
5 JGI25407J50210_10053735 3300003373 Bacteria 1018
6 Ga0070658_10431746 3300005327 Bacteria 1134
7 Ga0070683_100411002 3300005329 Bacteria 1291
8 Ga0070683_101083349 3300005329 Bacteria 770
9 Ga0070661_100548371 3300005344 Bacteria 930
10 Ga0070709_10194789 3300005434 Bacteria 1432
11 Ga0070713_100204114 3300005436 Bacteria 1786
12 Ga0070713_100251932 3300005436 Bacteria 1611
13 Ga0070710_10081906 3300005437 Bacteria 1886
14 Ga0070711_100053443 3300005439 Bacteria 2784
15 Ga0068867_101360049 3300005459 Bacteria 657
16 Ga0070679_100387196 3300005530 Bacteria 1345
17 Ga0070665_100001876 3300005548 Bacteria 23876
18 Ga0070704_100395431 3300005549 Unclassified 1178
19 Ga0070664_100192156 3300005564 Bacteria 1819
20 Ga0070664_100976770 3300005564 Bacteria 795
21 Ga0068857_100610097 3300005577 Bacteria 1032
22 Ga0081455_10007584 3300005937 Bacteria 11406
23 Ga0081455_10101742 3300005937 Bacteria 2305
24 Ga0081538_10000021 3300005981 Bacteria 138488
25 Ga0081538_10000801 3300005981 Bacteria 34106
26 Ga0081538_10001966 3300005981 Bacteria 20583
27 Ga0081538_10002620 3300005981 Bacteria 17387
28 Ga0081538_10006329 3300005981 Bacteria 10451
29 Ga0081538_10006464 3300005981 Bacteria 10315
30 Ga0081538_10006708 3300005981 Bacteria 10077
31 Ga0081538_10014657 3300005981 Bacteria 6126
32 Ga0081538_10127408 3300005981 Bacteria 1206
33 Ga0081539_10002309 3300005985 Bacteria 27505
34 Ga0070717_10093397 3300006028 Bacteria 2543
35 Ga0075364_10036308 3300006051 Bacteria 3185
36 Ga0075432_10015398 3300006058 Bacteria 2608
37 Ga0070716_100165470 3300006173 Bacteria 1438
38 Ga0070712_100001831 3300006175 Bacteria 12941
39 Ga0070712_100030585 3300006175 Bacteria 3620
40 Ga0075428_100071903 3300006844 Bacteria 3781
41 Ga0075428_100133018 3300006844 Bacteria 2705
42 Ga0075430_100003409 3300006846 Bacteria 13280
43 Ga0075430_100059953 3300006846 Bacteria 3198
44 Ga0075431_100031563 3300006847 Bacteria 5456
45 Ga0075431_100593612 3300006847 Bacteria 1092
46 Ga0075433_10212235 3300006852 Bacteria 1720
47 Ga0075429_100429740 3300006880 Bacteria 1157
48 Ga0111539_10022393 3300009094 Bacteria 7765
49 Ga0114129_10191047 3300009147 Bacteria 2780
50 Ga0114129_10353525 3300009147 Bacteria 1946
51 Ga0105242_11065373 3300009176 Bacteria 820
52 Ga0105249_10802880 3300009553 Bacteria 1005
53 Ga0105239_10087496 3300010375 Bacteria 3435
54 Ga0157369_10401549 3300013105 Bacteria 1422
55 Ga0157372_10218706 3300013307 Bacteria 2208
56 Ga0157372_12238026 3300013307 Bacteria 628
57 Ga0163163_10179282 3300014325 Bacteria 2166
58 Ga0163163_10527341 3300014325 Bacteria 1243
59 Ga0157377_10173942 3300014745 Bacteria 1349
60 Ga0163161_10295802 3300017792 Bacteria 1274
61 Ga0206353_10373461 3300020082 Bacteria 737
62 Ga0206353_11269961 3300020082 Bacteria 1006
63 Ga0207692_10082206 3300025898 Bacteria 1725
64 Ga0207692_10605918 3300025898 Bacteria 704
65 Ga0207705_10371655 3300025909 Bacteria 1104
66 Ga0207671_10000491 3300025914 Bacteria 53763
67 Ga0207693_10026297 3300025915 Bacteria 4606
68 Ga0207693_10223797 3300025915 Bacteria 1478
69 Ga0207693_10249402 3300025915 Bacteria 1393
70 Ga0207663_10287474 3300025916 Bacteria 1223
71 Ga0207663_10663477 3300025916 Bacteria 824
72 Ga0207660_11246304 3300025917 Unclassified 605
73 Ga0207687_10319699 3300025927 Bacteria 1256
74 Ga0207700_10292529 3300025928 Bacteria 1404
75 Ga0207664_10030818 3300025929 Bacteria 4099
76 Ga0207665_10120990 3300025939 Bacteria 1849
77 Ga0207665_10195845 3300025939 Bacteria 1470
78 Ga0207661_10476566 3300025944 Bacteria 1139
79 Ga0207679_10173385 3300025945 Bacteria 1778
80 Ga0207712_10484012 3300025961 Bacteria 1055
81 Ga0207658_10991879 3300025986 Bacteria 766
82 Ga0207678_10086698 3300026067 Bacteria 2675
83 Ga0207676_10754374 3300026095 Bacteria 947
84 Ga0207428_10055245 3300027907 Bacteria 3158
85 Ga0268266_10020471 3300028379 Bacteria 5638
86 Ga0268265_10536327 3300028380 Bacteria 1109
87 Ga0265319_1000187 3300028563 Bacteria 47107
88 Ga0265330_10247365 3300031235 Bacteria 751
89 Ga0265320_10010623 3300031240 Bacteria 5466
90 Ga0265327_10008297 3300031251 Bacteria 7776
91 Ga0307407_10668212 3300031903 Bacteria 780
92 Ga0307412_10533859 3300031911 Bacteria 982
93 Ga0307409_100053032 3300031995 Bacteria 3114
94 Ga0307416_100181977 3300032002 Bacteria 1971
95 Ga0307414_10438484 3300032004 Bacteria 1143
96 Ga0307414_10782834 3300032004 Bacteria 869
97 Ga0307415_101073172 3300032126 Bacteria 752
98 Ga0373952_0058504 3300035092 Bacteria 936
99 Ga0373932_0061955 3300035112 Bacteria 1139
100 Ga0373939_0026139 3300035114 Bacteria 1643
101 Ga0373953_0074030 3300035117 Bacteria 1408
102 Ga0373960_0008951 3300035121 Bacteria 2413
103 Ga0373946_0068254 3300035171 Bacteria 1529
104 Ga0373935_0204836 3300035692 Bacteria 1365
105 Ga0373933_0387037 3300035724 Bacteria 911
106 Ga0373947_0858982 3300035725 Bacteria 620
107 Ga0373937_0424849 3300036401 Bacteria 1261
108 Ga0395899_0049575 3300037312 Bacteria 3121
109 Ga0395899_0383296 3300037312 Bacteria 934
110 Ga0395900_0018478 3300037418 Bacteria 7109
111 Ga0395900_0059131 3300037418 Bacteria 3946
112 Ga0395900_0097899 3300037418 Bacteria 3014
113 Ga0395900_0352926 3300037418 Bacteria 1444
114 Ga0395900_0416097 3300037418 Bacteria 1306
115 Ga0395898_0010234 3300037466 Bacteria 9820
116 Ga0395898_0016855 3300037466 Bacteria 7462
117 Ga0395898_0385119 3300037466 Bacteria 1337
118 Ga0395898_0416445 3300037466 Bacteria 1281
119 Ga0395905_0288964 3300037471 Bacteria 1526
120 Ga0436364_0516503 3300037853 Unclassified 872
121 Ga0436364_1505094 3300037853 Bacteria 1706
122 Ga0395901_0038200 3300038443 Bacteria 4966
123 Ga0395901_0105564 3300038443 Bacteria 2956
124 Ga0395901_0665581 3300038443 Bacteria 1043
125 Ga0395901_1118992 3300038443 Bacteria 757
126 Ga0395901_1342028 3300038443 Unclassified 675
127 Ga0436365_0758265 3300039437 Unclassified 1634
128 Ga0436365_1303786 3300039437 Bacteria 1111
129 Ga0436365_1516866 3300039437 Bacteria 3152
130 Ga0436363_0343896 3300039450 Bacteria 656
131 Ga0436363_1296138 3300039450 Bacteria 697
132 Ga0451835_0371495 3300041492 Bacteria 766
133 Ga0466969_0393592 3300044656 Bacteria 629
134 Ga0466965_0085807 3300044683 Bacteria 1596
135 Ga0466963_0008791 3300044694 Bacteria 6067
136 Ga0466963_0110139 3300044694 Bacteria 1890
137 Ga0466963_0112893 3300044694 Bacteria 1866
138 Ga0466963_0137469 3300044694 Bacteria 1691
139 Ga0466963_0314967 3300044694 Bacteria 1101
140 Ga0466971_0007912 3300044719 Bacteria 4630
141 Ga0466968_0072303 3300044735 Bacteria 1503
142 Ga0466968_0093021 3300044735 Bacteria 1339
143 Ga0466968_0177393 3300044735 Bacteria 989
144 Ga0466968_0203956 3300044735 Bacteria 927
145 Ga0466970_0191593 3300044765 Bacteria 1136
146 Ga0466957_0007895 3300044842 Bacteria 6036
147 Ga0466958_0002789 3300045836 Bacteria 8887
148 Ga0466967_0045575 3300045976 Bacteria 3811
149 Ga0466967_0427410 3300045976 Unclassified 1292
150 Ga0495629_0022684 3300046459 Bacteria 4474
151 Ga0495641_0002107 3300046461 Bacteria 16065
152 Ga0495653_0106554 3300046463 Bacteria 2021
153 Ga0495582_0132104 3300046473 Bacteria 1411
154 Ga0495662_0201333 3300046476 Bacteria 981
155 Ga0495596_0077123 3300046500 Bacteria 1294
156 Ga0495608_0035107 3300046511 Bacteria 3383
157 Ga0495608_0129590 3300046511 Bacteria 1615
158 Ga0495618_0113710 3300046514 Bacteria 1733
159 Ga0495628_0224347 3300046516 Bacteria 1410
160 Ga0495630_0435249 3300046517 Bacteria 1005
161 Ga0495631_0276119 3300046518 Bacteria 716
162 Ga0495644_0004469 3300046523 Bacteria 5496
163 Ga0495652_0017072 3300046529 Bacteria 6482
164 Ga0495654_0277732 3300046530 Bacteria 690
165 Ga0495640_0027874 3300046533 Bacteria 4069
166 Ga0495667_0011779 3300046559 Bacteria 5924
167 Ga0495667_0139109 3300046559 Bacteria 1565
168 Ga0495635_0085024 3300046663 Bacteria 2164
169 Ga0495588_0274651 3300046674 Bacteria 888
170 Ga0495657_0001401 3300046675 Bacteria 20878
171 Ga0495599_0152147 3300046678 Bacteria 1432
172 Ga0495623_0026469 3300046679 Bacteria 3733
173 Ga0495658_0130573 3300046683 Bacteria 1529
174 Ga0495671_0179396 3300046692 Bacteria 1029
175 Ga0495589_0115615 3300046794 Bacteria 1293
176 Ga0495589_0141685 3300046794 Bacteria 1151
177 Ga0495581_0185279 3300047315 Bacteria 1218
178 Ga0495604_0103671 3300047317 Bacteria 2086
179 Ga0495674_0462288 3300047319 Bacteria 1018
180 Ga0495672_0025749 3300047320 Bacteria 3760
181 Ga0495680_0248117 3300047322 Bacteria 1262
182 Ga0495675_0324783 3300047444 Bacteria 910
183 Ga0495673_0006682 3300047469 Bacteria 6752
184 Ga0495684_0201378 3300047471 Bacteria 1467
185 Ga0495686_0009438 3300047472 Bacteria 7028
186 Ga0495686_0012336 3300047472 Bacteria 5982
187 Ga0495686_0282615 3300047472 Bacteria 922
188 Ga0495686_0290555 3300047472 Bacteria 905
189 Ga0495602_0113005 3300048088 Bacteria 2202
190 Ga0495615_0001999 3300048090 Bacteria 3169
191 Ga0496101_0259084 3300048904 Unclassified 1356
192 Ga0496102_0089097 3300048905 Bacteria 2854
193 Ga0496102_0326335 3300048905 Bacteria 1446
194 Ga0496102_1071645 3300048905 Bacteria 726
195 Ga0496103_0005963 3300048906 Bacteria 7287
196 Ga0496104_0056521 3300048907 Bacteria 3711
197 Ga0496104_0063189 3300048907 Bacteria 3511
198 Ga0496104_0230228 3300048907 Bacteria 1765
199 Ga0496105_0077523 3300048908 Bacteria 2745
200 Ga0496107_0043415 3300048910 Bacteria 3230
201 Ga0496108_0000897 3300048911 Bacteria 23179
202 Ga0496108_0104885 3300048911 Bacteria 2413
203 Ga0496108_0249195 3300048911 Bacteria 1545
204 Ga0496108_0340794 3300048911 Bacteria 1308
205 Ga0496109_0000889 3300048912 Bacteria 24973
206 Ga0496109_0029602 3300048912 Bacteria 4905
207 Ga0496109_0089470 3300048912 Bacteria 2846
208 Ga0496109_0104407 3300048912 Bacteria 2631
209 Ga0496109_0227769 3300048912 Bacteria 1753
210 Ga0496109_0330483 3300048912 Bacteria 1439
211 Ga0496109_0420984 3300048912 Bacteria 1262
212 Ga0496110_0006665 3300048913 Bacteria 9175
213 Ga0496110_0065235 3300048913 Bacteria 3219
214 Ga0496110_1061280 3300048913 Bacteria 718
215 Ga0496111_0050883 3300048914 Bacteria 2990
216 Ga0496111_0464765 3300048914 Bacteria 933
217 Ga0496112_0000621 3300048915 Bacteria 24571
218 Ga0496112_0155625 3300048915 Bacteria 2252
219 Ga0496112_0253971 3300048915 Bacteria 1708
220 Ga0496112_0454204 3300048915 Unclassified 1219
221 Ga0496112_0999673 3300048915 Bacteria 756
222 Ga0496113_0061983 3300048916 Bacteria 2823
223 Ga0496113_0123452 3300048916 Bacteria 2026
224 Ga0496113_0131404 3300048916 Bacteria 1965
225 Ga0496113_0536728 3300048916 Bacteria 939
226 Ga0496114_0151495 3300048917 Bacteria 2012
227 Ga0496114_0787722 3300048917 Bacteria 829
228 Ga0496115_0000302 3300048918 Bacteria 42002
229 Ga0496115_0042268 3300048918 Bacteria 3631
230 Ga0496115_0360949 3300048918 Bacteria 1184
231 Ga0496124_0130544 3300048927 Bacteria 1997
232 Ga0501033_0144772 3300049570 Bacteria 1717
233 Ga0501036_0054393 3300049572 Bacteria 3391
234 Ga0501036_0226639 3300049572 Bacteria 1569
235 Ga0501039_0348575 3300049575 Bacteria 1164
236 Ga0501039_0709163 3300049575 Bacteria 787
237 Ga0501041_0506908 3300049577 Bacteria 768
238 Ga0501041_0524221 3300049577 Unclassified 754
239 Ga0501046_0471231 3300049580 Bacteria 902
240 Ga0501067_0388377 3300049583 Bacteria 778
241 Ga0501071_0039467 3300049587 Bacteria 3378
242 Ga0501072_0119610 3300049588 Bacteria 2098
243 Ga0501072_0992525 3300049588 Bacteria 655
244 Ga0501074_0062606 3300049590 Bacteria 2680
245 Ga0501074_0485836 3300049590 Bacteria 875
246 Ga0501076_0357838 3300049592 Bacteria 1199
247 Ga0501079_0193207 3300049741 Bacteria 1589
248 Ga0501079_0307507 3300049741 Bacteria 1240
249 Ga0501080_0030689 3300049742 Bacteria 5008
250 Ga0501045_0105710 3300049824 Bacteria 2086
251 Ga0501045_0337992 3300049824 Unclassified 1121
252 nmdc:mga00v17_166311_c1 3300050491 Bacteria 1421
253 nmdc:mga05p37_142742_c1 3300050507 Bacteria 2933
254 nmdc:mga0qj67_1921_c1 3300050509 Bacteria 14754
255 nmdc:mga0qj67_410527_c1 3300050509 Bacteria 1092
256 nmdc:mga0qj67_41528_c1 3300050509 Bacteria 3618
257 nmdc:mga06r32_265536_c1 3300050510 Bacteria 1704
258 nmdc:mga06r32_346933_c1 3300050510 Bacteria 1469
259 nmdc:mga08y16_124324_c1 3300050511 Bacteria 2684
260 nmdc:mga0n895_285158_c1 3300050512 Bacteria 1674
261 nmdc:mga0a205_227847_c1 3300050515 Bacteria 1748
262 Ga0495655_0012642 3300053083 Bacteria 1726
263 Ga0495655_0085616 3300053083 Bacteria 909
264 Ga0495595_0000951 3300053084 Bacteria 11143
265 Ga0500556_0001583 3300053104 Bacteria 9132
266 Ga0500628_002338 3300053129 Bacteria 3139
267 Ga0500616_0013536 3300053153 Bacteria 4731
268 Ga0501084_0081290 3300054114 Bacteria 2718
269 Ga0501082_0011784 3300060353 Bacteria 7518
270 Ga0466962_0021813 3300061719 Bacteria 3075
271 Ga0530510_0154539 3300061734 Unclassified 1695

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0005963 Ga0496103_0005963_3283_3849 156
2 3300048911 Ga0496108_0000897 Ga0496108_0000897_14255_14857 157
3 3300048912 Ga0496109_0000889 Ga0496109_0000889_16608_17210 157
4 3300025898 Ga0207692_10605918 Ga0207692_106059182 163
5 3300025961 Ga0207712_10484012 Ga0207712_104840122 166
6 3300048927 Ga0496124_0130544 Ga0496124_0130544_1094_1660 170
7 3300047472 Ga0495686_0282615 Ga0495686_0282615_169_735 171
8 3300046518 Ga0495631_0276119 Ga0495631_0276119_182_706 172
9 3300006844 Ga0075428_100071903 Ga0075428_1000719033 176
10 3300006846 Ga0075430_100003409 Ga0075430_10000340912 176
11 3300006847 Ga0075431_100031563 Ga0075431_1000315634 176
12 3300046692 Ga0495671_0179396 Ga0495671_0179396_161_691 176
13 3300046794 Ga0495589_0115615 Ga0495589_0115615_210_740 176
14 3300048905 Ga0496102_1071645 Ga0496102_1071645_49_615 176
15 3300005434 Ga0070709_10194789 Ga0070709_101947893 180
16 3300005436 Ga0070713_100204114 Ga0070713_1002041142 180
17 3300005436 Ga0070713_100251932 Ga0070713_1002519321 180
18 3300005437 Ga0070710_10081906 Ga0070710_100819063 180
19 3300006028 Ga0070717_10093397 Ga0070717_100933972 180
20 3300006175 Ga0070712_100001831 Ga0070712_10000183111 180
21 3300009553 Ga0105249_10802880 Ga0105249_108028801 180
22 3300025898 Ga0207692_10082206 Ga0207692_100822061 180
23 3300025915 Ga0207693_10026297 Ga0207693_100262973 180
24 3300025928 Ga0207700_10292529 Ga0207700_102925292 180
25 3300025929 Ga0207664_10030818 Ga0207664_100308184 180
26 3300025939 Ga0207665_10120990 Ga0207665_101209903 180
27 3300035117 Ga0373953_0074030 Ga0373953_0074030_63_629 180
28 3300035724 Ga0373933_0387037 Ga0373933_0387037_127_693 180
29 3300035725 Ga0373947_0858982 Ga0373947_0858982_44_610 180
30 3300036401 Ga0373937_0424849 Ga0373937_0424849_209_775 180
31 3300037853 Ga0436364_0516503 Ga0436364_0516503_188_754 180
32 3300037853 Ga0436364_1505094 Ga0436364_1505094_176_727 180
33 3300039450 Ga0436363_0343896 Ga0436363_0343896_93_644 180
34 3300044656 Ga0466969_0393592 Ga0466969_0393592_57_611 180
35 3300044694 Ga0466963_0110139 Ga0466963_0110139_1299_1865 180
36 3300044735 Ga0466968_0093021 Ga0466968_0093021_653_1219 180
37 3300046459 Ga0495629_0022684 Ga0495629_0022684_3633_4199 180
38 3300046463 Ga0495653_0106554 Ga0495653_0106554_127_693 180
39 3300046473 Ga0495582_0132104 Ga0495582_0132104_88_654 180
40 3300046511 Ga0495608_0035107 Ga0495608_0035107_281_847 180
41 3300046511 Ga0495608_0129590 Ga0495608_0129590_350_916 180
42 3300046514 Ga0495618_0113710 Ga0495618_0113710_832_1398 180
43 3300046516 Ga0495628_0224347 Ga0495628_0224347_28_594 180
44 3300046529 Ga0495652_0017072 Ga0495652_0017072_866_1432 180
45 3300046533 Ga0495640_0027874 Ga0495640_0027874_2085_2651 180
46 3300046559 Ga0495667_0011779 Ga0495667_0011779_4245_4811 180
47 3300046559 Ga0495667_0139109 Ga0495667_0139109_50_616 180
48 3300046663 Ga0495635_0085024 Ga0495635_0085024_1281_1847 180
49 3300046675 Ga0495657_0001401 Ga0495657_0001401_17695_18261 180
50 3300046678 Ga0495599_0152147 Ga0495599_0152147_135_701 180
51 3300046679 Ga0495623_0026469 Ga0495623_0026469_1261_1827 180
52 3300047317 Ga0495604_0103671 Ga0495604_0103671_752_1318 180
53 3300047319 Ga0495674_0462288 Ga0495674_0462288_264_830 180
54 3300047322 Ga0495680_0248117 Ga0495680_0248117_488_1054 180
55 3300047444 Ga0495675_0324783 Ga0495675_0324783_76_642 180
56 3300047471 Ga0495684_0201378 Ga0495684_0201378_836_1402 180
57 3300048088 Ga0495602_0113005 Ga0495602_0113005_799_1365 180
58 3300048904 Ga0496101_0259084 Ga0496101_0259084_487_1047 180
59 3300048907 Ga0496104_0056521 Ga0496104_0056521_485_1051 180
60 3300048907 Ga0496104_0063189 Ga0496104_0063189_2920_3489 180
61 3300048911 Ga0496108_0249195 Ga0496108_0249195_106_672 180
62 3300048911 Ga0496108_0340794 Ga0496108_0340794_136_705 180
63 3300048912 Ga0496109_0089470 Ga0496109_0089470_1871_2431 180
64 3300048912 Ga0496109_0330483 Ga0496109_0330483_68_637 180
65 3300048913 Ga0496110_0006665 Ga0496110_0006665_435_995 180
66 3300048915 Ga0496112_0000621 Ga0496112_0000621_9132_9701 180
67 3300048916 Ga0496113_0123452 Ga0496113_0123452_1286_1855 180
68 3300048916 Ga0496113_0131404 Ga0496113_0131404_193_759 180
69 3300048918 Ga0496115_0042268 Ga0496115_0042268_860_1426 180
70 3300049588 Ga0501072_0119610 Ga0501072_0119610_880_1425 180
71 3300053084 Ga0495595_0000951 Ga0495595_0000951_8330_8896 180
72 3300005329 Ga0070683_100411002 Ga0070683_1004110023 181
73 3300005329 Ga0070683_101083349 Ga0070683_1010833491 181
74 3300005344 Ga0070661_100548371 Ga0070661_1005483711 181
75 3300005981 Ga0081538_10127408 Ga0081538_101274082 181
76 3300009176 Ga0105242_11065373 Ga0105242_110653731 181
77 3300010375 Ga0105239_10087496 Ga0105239_100874964 181
78 3300013105 Ga0157369_10401549 Ga0157369_104015492 181
79 3300013307 Ga0157372_10218706 Ga0157372_102187063 181
80 3300013307 Ga0157372_12238026 Ga0157372_122380261 181
81 3300014325 Ga0163163_10179282 Ga0163163_101792823 181
82 3300014745 Ga0157377_10173942 Ga0157377_101739422 181
83 3300017792 Ga0163161_10295802 Ga0163161_102958022 181
84 3300025927 Ga0207687_10319699 Ga0207687_103196992 181
85 3300025944 Ga0207661_10476566 Ga0207661_104765662 181
86 3300025986 Ga0207658_10991879 Ga0207658_109918791 181
87 3300028380 Ga0268265_10536327 Ga0268265_105363272 181
88 3300032004 Ga0307414_10782834 Ga0307414_107828342 181
89 3300037312 Ga0395899_0383296 Ga0395899_0383296_188_733 181
90 3300037418 Ga0395900_0059131 Ga0395900_0059131_928_1473 181
91 3300037418 Ga0395900_0416097 Ga0395900_0416097_136_681 181
92 3300037466 Ga0395898_0016855 Ga0395898_0016855_3671_4216 181
93 3300037466 Ga0395898_0416445 Ga0395898_0416445_207_752 181
94 3300038443 Ga0395901_0038200 Ga0395901_0038200_3239_3784 181
95 3300039437 Ga0436365_0758265 Ga0436365_0758265_818_1396 181
96 3300039437 Ga0436365_1516866 Ga0436365_1516866_1615_2181 181
97 3300041492 Ga0451835_0371495 Ga0451835_0371495_188_733 181
98 3300044683 Ga0466965_0085807 Ga0466965_0085807_826_1383 181
99 3300044694 Ga0466963_0314967 Ga0466963_0314967_99_668 181
100 3300044719 Ga0466971_0007912 Ga0466971_0007912_470_1039 181
101 3300044735 Ga0466968_0177393 Ga0466968_0177393_254_811 181
102 3300044735 Ga0466968_0203956 Ga0466968_0203956_321_872 181
103 3300044765 Ga0466970_0191593 Ga0466970_0191593_369_926 181
104 3300044842 Ga0466957_0007895 Ga0466957_0007895_3702_4271 181
105 3300045836 Ga0466958_0002789 Ga0466958_0002789_6184_6753 181
106 3300045976 Ga0466967_0427410 Ga0466967_0427410_734_1279 181
107 3300048905 Ga0496102_0089097 Ga0496102_0089097_506_1051 181
108 3300048907 Ga0496104_0230228 Ga0496104_0230228_159_704 181
109 3300048908 Ga0496105_0077523 Ga0496105_0077523_205_750 181
110 3300048910 Ga0496107_0043415 Ga0496107_0043415_813_1358 181
111 3300048911 Ga0496108_0104885 Ga0496108_0104885_676_1221 181
112 3300048912 Ga0496109_0029602 Ga0496109_0029602_3605_4150 181
113 3300048912 Ga0496109_0104407 Ga0496109_0104407_1600_2145 181
114 3300048914 Ga0496111_0050883 Ga0496111_0050883_835_1380 181
115 3300048915 Ga0496112_0155625 Ga0496112_0155625_834_1379 181
116 3300048915 Ga0496112_0253971 Ga0496112_0253971_463_1008 181
117 3300048915 Ga0496112_0999673 Ga0496112_0999673_71_616 181
118 3300048916 Ga0496113_0061983 Ga0496113_0061983_651_1196 181
119 3300048917 Ga0496114_0151495 Ga0496114_0151495_769_1314 181
120 3300048917 Ga0496114_0787722 Ga0496114_0787722_73_618 181
121 3300048918 Ga0496115_0360949 Ga0496115_0360949_211_756 181
122 3300053083 Ga0495655_0012642 Ga0495655_0012642_1081_1653 181
123 3300061719 Ga0466962_0021813 Ga0466962_0021813_1855_2424 181
124 3300003373 JGI25407J50210_10006157 JGI25407J50210_100061573 182
125 3300003373 JGI25407J50210_10010819 JGI25407J50210_100108192 182
126 3300003373 JGI25407J50210_10014126 JGI25407J50210_100141262 182
127 3300003373 JGI25407J50210_10053735 JGI25407J50210_100537351 182
128 3300005327 Ga0070658_10431746 Ga0070658_104317462 182
129 3300005459 Ga0068867_101360049 Ga0068867_1013600491 182
130 3300005530 Ga0070679_100387196 Ga0070679_1003871963 182
131 3300005548 Ga0070665_100001876 Ga0070665_1000018766 182
132 3300005549 Ga0070704_100395431 Ga0070704_1003954312 182
133 3300005937 Ga0081455_10007584 Ga0081455_100075848 182
134 3300005937 Ga0081455_10101742 Ga0081455_101017423 182
135 3300005981 Ga0081538_10000021 Ga0081538_10000021128 182
136 3300005981 Ga0081538_10000801 Ga0081538_100008013 182
137 3300005981 Ga0081538_10001966 Ga0081538_100019663 182
138 3300005981 Ga0081538_10002620 Ga0081538_100026203 182
139 3300005981 Ga0081538_10006464 Ga0081538_100064643 182
140 3300005981 Ga0081538_10006708 Ga0081538_100067082 182
141 3300005981 Ga0081538_10014657 Ga0081538_100146576 182
142 3300006051 Ga0075364_10036308 Ga0075364_100363083 182
143 3300006058 Ga0075432_10015398 Ga0075432_100153983 182
144 3300006844 Ga0075428_100133018 Ga0075428_1001330183 182
145 3300006846 Ga0075430_100059953 Ga0075430_1000599532 182
146 3300006847 Ga0075431_100593612 Ga0075431_1005936121 182
147 3300006852 Ga0075433_10212235 Ga0075433_102122352 182
148 3300006880 Ga0075429_100429740 Ga0075429_1004297402 182
149 3300009094 Ga0111539_10022393 Ga0111539_100223933 182
150 3300009147 Ga0114129_10191047 Ga0114129_101910473 182
151 3300009147 Ga0114129_10353525 Ga0114129_103535252 182
152 3300025909 Ga0207705_10371655 Ga0207705_103716552 182
153 3300025914 Ga0207671_10000491 Ga0207671_1000049142 182
154 3300026067 Ga0207678_10086698 Ga0207678_100866983 182
155 3300027907 Ga0207428_10055245 Ga0207428_100552452 182
156 3300028379 Ga0268266_10020471 Ga0268266_100204716 182
157 3300028563 Ga0265319_1000187 Ga0265319_100018725 182
158 3300031235 Ga0265330_10247365 Ga0265330_102473651 182
159 3300031240 Ga0265320_10010623 Ga0265320_100106236 182
160 3300031903 Ga0307407_10668212 Ga0307407_106682121 182
161 3300031911 Ga0307412_10533859 Ga0307412_105338592 182
162 3300031995 Ga0307409_100053032 Ga0307409_1000530323 182
163 3300032002 Ga0307416_100181977 Ga0307416_1001819773 182
164 3300032004 Ga0307414_10438484 Ga0307414_104384842 182
165 3300032126 Ga0307415_101073172 Ga0307415_1010731721 182
166 3300035092 Ga0373952_0058504 Ga0373952_0058504_43_600 182
167 3300035112 Ga0373932_0061955 Ga0373932_0061955_405_962 182
168 3300035114 Ga0373939_0026139 Ga0373939_0026139_804_1361 182
169 3300035121 Ga0373960_0008951 Ga0373960_0008951_826_1383 182
170 3300037312 Ga0395899_0049575 Ga0395899_0049575_625_1179 182
171 3300037418 Ga0395900_0018478 Ga0395900_0018478_6032_6586 182
172 3300037418 Ga0395900_0097899 Ga0395900_0097899_1975_2529 182
173 3300037466 Ga0395898_0010234 Ga0395898_0010234_3097_3651 182
174 3300037466 Ga0395898_0385119 Ga0395898_0385119_112_684 182
175 3300037471 Ga0395905_0288964 Ga0395905_0288964_443_997 182
176 3300038443 Ga0395901_0665581 Ga0395901_0665581_190_765 182
177 3300038443 Ga0395901_1342028 Ga0395901_1342028_48_602 182
178 3300039437 Ga0436365_1303786 Ga0436365_1303786_394_993 182
179 3300039450 Ga0436363_1296138 Ga0436363_1296138_58_654 182
180 3300044694 Ga0466963_0008791 Ga0466963_0008791_348_935 182
181 3300044694 Ga0466963_0137469 Ga0466963_0137469_144_710 182
182 3300046461 Ga0495641_0002107 Ga0495641_0002107_15284_15835 182
183 3300046476 Ga0495662_0201333 Ga0495662_0201333_255_806 182
184 3300046500 Ga0495596_0077123 Ga0495596_0077123_320_871 182
185 3300046517 Ga0495630_0435249 Ga0495630_0435249_22_591 182
186 3300046523 Ga0495644_0004469 Ga0495644_0004469_3853_4404 182
187 3300046674 Ga0495588_0274651 Ga0495588_0274651_165_716 182
188 3300046683 Ga0495658_0130573 Ga0495658_0130573_565_1134 182
189 3300046794 Ga0495589_0141685 Ga0495589_0141685_194_745 182
190 3300047315 Ga0495581_0185279 Ga0495581_0185279_562_1119 182
191 3300047320 Ga0495672_0025749 Ga0495672_0025749_2567_3121 182
192 3300047469 Ga0495673_0006682 Ga0495673_0006682_2505_3056 182
193 3300047472 Ga0495686_0009438 Ga0495686_0009438_1998_2549 182
194 3300047472 Ga0495686_0012336 Ga0495686_0012336_4139_4699 182
195 3300047472 Ga0495686_0290555 Ga0495686_0290555_21_572 182
196 3300048090 Ga0495615_0001999 Ga0495615_0001999_1416_1967 182
197 3300048905 Ga0496102_0326335 Ga0496102_0326335_73_624 182
198 3300049570 Ga0501033_0144772 Ga0501033_0144772_672_1223 182
199 3300049572 Ga0501036_0054393 Ga0501036_0054393_2056_2607 182
200 3300049572 Ga0501036_0226639 Ga0501036_0226639_139_696 182
201 3300049575 Ga0501039_0348575 Ga0501039_0348575_302_853 182
202 3300049575 Ga0501039_0709163 Ga0501039_0709163_122_676 182
203 3300049577 Ga0501041_0524221 Ga0501041_0524221_111_662 182
204 3300049580 Ga0501046_0471231 Ga0501046_0471231_179_733 182
205 3300049587 Ga0501071_0039467 Ga0501071_0039467_233_784 182
206 3300049588 Ga0501072_0992525 Ga0501072_0992525_26_580 182
207 3300049590 Ga0501074_0485836 Ga0501074_0485836_67_618 182
208 3300049592 Ga0501076_0357838 Ga0501076_0357838_320_877 182
209 3300049741 Ga0501079_0193207 Ga0501079_0193207_366_917 182
210 3300049824 Ga0501045_0105710 Ga0501045_0105710_291_842 182
211 3300049824 Ga0501045_0337992 Ga0501045_0337992_54_608 182
212 3300050491 nmdc:mga00v17_166311_c1 nmdc:mga00v17_166311_c1_457_1023 182
213 3300050507 nmdc:mga05p37_142742_c1 nmdc:mga05p37_142742_c1_913_1470 182
214 3300050509 nmdc:mga0qj67_410527_c1 nmdc:mga0qj67_410527_c1_512_1072 182
215 3300050509 nmdc:mga0qj67_41528_c1 nmdc:mga0qj67_41528_c1_1794_2351 182
216 3300050510 nmdc:mga06r32_346933_c1 nmdc:mga06r32_346933_c1_831_1388 182
217 3300050511 nmdc:mga08y16_124324_c1 nmdc:mga08y16_124324_c1_1514_2071 182
218 3300050512 nmdc:mga0n895_285158_c1 nmdc:mga0n895_285158_c1_698_1255 182
219 3300050515 nmdc:mga0a205_227847_c1 nmdc:mga0a205_227847_c1_763_1320 182
220 3300053083 Ga0495655_0085616 Ga0495655_0085616_83_631 182
221 3300053129 Ga0500628_002338 Ga0500628_002338_852_1403 182
222 3300054114 Ga0501084_0081290 Ga0501084_0081290_664_1215 182
223 3300060353 Ga0501082_0011784 Ga0501082_0011784_4276_4827 182
224 3300061734 Ga0530510_0154539 Ga0530510_0154539_651_1205 182
225 3300003203 JGI25406J46586_10054604 JGI25406J46586_100546042 183
226 3300005439 Ga0070711_100053443 Ga0070711_1000534432 183
227 3300005564 Ga0070664_100192156 Ga0070664_1001921563 183
228 3300005564 Ga0070664_100976770 Ga0070664_1009767701 183
229 3300005577 Ga0068857_100610097 Ga0068857_1006100972 183
230 3300005981 Ga0081538_10006329 Ga0081538_100063292 183
231 3300005985 Ga0081539_10002309 Ga0081539_1000230921 183
232 3300006173 Ga0070716_100165470 Ga0070716_1001654702 183
233 3300006175 Ga0070712_100030585 Ga0070712_1000305853 183
234 3300014325 Ga0163163_10527341 Ga0163163_105273412 183
235 3300020082 Ga0206353_10373461 Ga0206353_103734611 183
236 3300020082 Ga0206353_11269961 Ga0206353_112699612 183
237 3300025915 Ga0207693_10223797 Ga0207693_102237972 183
238 3300025915 Ga0207693_10249402 Ga0207693_102494022 183
239 3300025916 Ga0207663_10287474 Ga0207663_102874742 183
240 3300025916 Ga0207663_10663477 Ga0207663_106634771 183
241 3300025917 Ga0207660_11246304 Ga0207660_112463041 183
242 3300025939 Ga0207665_10195845 Ga0207665_101958452 183
243 3300025945 Ga0207679_10173385 Ga0207679_101733852 183
244 3300026095 Ga0207676_10754374 Ga0207676_107543742 183
245 3300031251 Ga0265327_10008297 Ga0265327_100082973 183
246 3300035171 Ga0373946_0068254 Ga0373946_0068254_280_846 183
247 3300035692 Ga0373935_0204836 Ga0373935_0204836_209_775 183
248 3300037418 Ga0395900_0352926 Ga0395900_0352926_276_854 183
249 3300038443 Ga0395901_0105564 Ga0395901_0105564_1818_2372 183
250 3300038443 Ga0395901_1118992 Ga0395901_1118992_72_665 183
251 3300044694 Ga0466963_0112893 Ga0466963_0112893_932_1549 183
252 3300044735 Ga0466968_0072303 Ga0466968_0072303_575_1132 183
253 3300045976 Ga0466967_0045575 Ga0466967_0045575_1939_2493 183
254 3300046530 Ga0495654_0277732 Ga0495654_0277732_70_657 183
255 3300048912 Ga0496109_0227769 Ga0496109_0227769_760_1326 183
256 3300048912 Ga0496109_0420984 Ga0496109_0420984_84_635 183
257 3300048913 Ga0496110_0065235 Ga0496110_0065235_1212_1778 183
258 3300048913 Ga0496110_1061280 Ga0496110_1061280_142_693 183
259 3300048914 Ga0496111_0464765 Ga0496111_0464765_207_773 183
260 3300048915 Ga0496112_0454204 Ga0496112_0454204_106_672 183
261 3300048916 Ga0496113_0536728 Ga0496113_0536728_109_666 183
262 3300048918 Ga0496115_0000302 Ga0496115_0000302_1010_1609 183
263 3300049577 Ga0501041_0506908 Ga0501041_0506908_116_676 183
264 3300049583 Ga0501067_0388377 Ga0501067_0388377_47_607 183
265 3300049590 Ga0501074_0062606 Ga0501074_0062606_1389_1946 183
266 3300049741 Ga0501079_0307507 Ga0501079_0307507_399_956 183
267 3300049742 Ga0501080_0030689 Ga0501080_0030689_3570_4127 183
268 3300050509 nmdc:mga0qj67_1921_c1 nmdc:mga0qj67_1921_c1_2631_3191 183
269 3300050510 nmdc:mga06r32_265536_c1 nmdc:mga06r32_265536_c1_662_1222 183
270 3300053104 Ga0500556_0001583 Ga0500556_0001583_7239_7793 183
271 3300053153 Ga0500616_0013536 Ga0500616_0013536_783_1337 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

80

177

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hki-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate 0.9402 3 176
5hkl-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with inorganic phosphate 0.9314 1 175
5hki-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate 0.9242 3 176
5hkf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) 0.9239 3 175
5hkf-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) 0.9221 3 175
ID Description Score Start End Superfamily
5hkiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9402 3 176 3.40.50.2020
5hkiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9242 3 176 3.40.50.2020
af_Q58509_1_175_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9098 1 176 3.40.50.2020
af_Q58509_1_175_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8951 1 176 3.40.50.2020
af_A0A1D6N1D3_3_204_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8688 3 175 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A7W0AP62-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.995 3 182 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A7W0H853-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9929 3 183 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A7W1RC05-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9897 1 182 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-D3F3R8-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9881 3 183 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A7V9M5M0-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9864 3 183 GO:0000287
GO:0004588
GO:0019856
GO:0044205

Feature Viewer

pLDDT pTM Quality
93.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map