F377639
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 271 | 175 | 271 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10802880|Ga0105249_108028801 |
| Length | 198 |
| Sequence | METGFIHTMRRTMGSDPRDVLLAELREHALVIGEVTLSSGRTAQYYVDAKRALLRPPAFRAAGELIAAEAAERGAGAVGGMTIGADPLACAAIAGEAGDDLVAFFVRKERKEHGLQRWIEGPVLEAGTRCLVVEDVVTTGGSTVRAIERILEEGLEVAGVTAVVDRLAGGAEAIERAAGAPYRPLLTIDELYPDRPDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 11 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 16 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 21 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 22 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 25 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 26 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 27 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 28 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 40 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 57 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 60 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 61 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 62 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 63 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 64 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 65 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 66 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 67 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 68 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 69 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 70 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 71 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 72 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 73 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 74 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 75 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 76 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 77 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 78 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 79 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 80 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 81 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 82 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 83 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 84 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 85 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 86 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 87 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 88 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 89 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 90 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 91 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 92 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 93 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 94 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 95 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 96 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 97 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 134 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 144 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 145 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 146 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 147 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 161 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 170 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 171 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 172 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 175 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.26 |
| Metatranscriptomes | 0.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 0 |
| Rhizoplane | 14.76 |
| Rhizosphere | 80.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10054604 | 3300003203 | Bacteria | 1320 |
| 2 | JGI25407J50210_10006157 | 3300003373 | Bacteria | 2978 |
| 3 | JGI25407J50210_10010819 | 3300003373 | Bacteria | 2326 |
| 4 | JGI25407J50210_10014126 | 3300003373 | Bacteria | 2057 |
| 5 | JGI25407J50210_10053735 | 3300003373 | Bacteria | 1018 |
| 6 | Ga0070658_10431746 | 3300005327 | Bacteria | 1134 |
| 7 | Ga0070683_100411002 | 3300005329 | Bacteria | 1291 |
| 8 | Ga0070683_101083349 | 3300005329 | Bacteria | 770 |
| 9 | Ga0070661_100548371 | 3300005344 | Bacteria | 930 |
| 10 | Ga0070709_10194789 | 3300005434 | Bacteria | 1432 |
| 11 | Ga0070713_100204114 | 3300005436 | Bacteria | 1786 |
| 12 | Ga0070713_100251932 | 3300005436 | Bacteria | 1611 |
| 13 | Ga0070710_10081906 | 3300005437 | Bacteria | 1886 |
| 14 | Ga0070711_100053443 | 3300005439 | Bacteria | 2784 |
| 15 | Ga0068867_101360049 | 3300005459 | Bacteria | 657 |
| 16 | Ga0070679_100387196 | 3300005530 | Bacteria | 1345 |
| 17 | Ga0070665_100001876 | 3300005548 | Bacteria | 23876 |
| 18 | Ga0070704_100395431 | 3300005549 | Unclassified | 1178 |
| 19 | Ga0070664_100192156 | 3300005564 | Bacteria | 1819 |
| 20 | Ga0070664_100976770 | 3300005564 | Bacteria | 795 |
| 21 | Ga0068857_100610097 | 3300005577 | Bacteria | 1032 |
| 22 | Ga0081455_10007584 | 3300005937 | Bacteria | 11406 |
| 23 | Ga0081455_10101742 | 3300005937 | Bacteria | 2305 |
| 24 | Ga0081538_10000021 | 3300005981 | Bacteria | 138488 |
| 25 | Ga0081538_10000801 | 3300005981 | Bacteria | 34106 |
| 26 | Ga0081538_10001966 | 3300005981 | Bacteria | 20583 |
| 27 | Ga0081538_10002620 | 3300005981 | Bacteria | 17387 |
| 28 | Ga0081538_10006329 | 3300005981 | Bacteria | 10451 |
| 29 | Ga0081538_10006464 | 3300005981 | Bacteria | 10315 |
| 30 | Ga0081538_10006708 | 3300005981 | Bacteria | 10077 |
| 31 | Ga0081538_10014657 | 3300005981 | Bacteria | 6126 |
| 32 | Ga0081538_10127408 | 3300005981 | Bacteria | 1206 |
| 33 | Ga0081539_10002309 | 3300005985 | Bacteria | 27505 |
| 34 | Ga0070717_10093397 | 3300006028 | Bacteria | 2543 |
| 35 | Ga0075364_10036308 | 3300006051 | Bacteria | 3185 |
| 36 | Ga0075432_10015398 | 3300006058 | Bacteria | 2608 |
| 37 | Ga0070716_100165470 | 3300006173 | Bacteria | 1438 |
| 38 | Ga0070712_100001831 | 3300006175 | Bacteria | 12941 |
| 39 | Ga0070712_100030585 | 3300006175 | Bacteria | 3620 |
| 40 | Ga0075428_100071903 | 3300006844 | Bacteria | 3781 |
| 41 | Ga0075428_100133018 | 3300006844 | Bacteria | 2705 |
| 42 | Ga0075430_100003409 | 3300006846 | Bacteria | 13280 |
| 43 | Ga0075430_100059953 | 3300006846 | Bacteria | 3198 |
| 44 | Ga0075431_100031563 | 3300006847 | Bacteria | 5456 |
| 45 | Ga0075431_100593612 | 3300006847 | Bacteria | 1092 |
| 46 | Ga0075433_10212235 | 3300006852 | Bacteria | 1720 |
| 47 | Ga0075429_100429740 | 3300006880 | Bacteria | 1157 |
| 48 | Ga0111539_10022393 | 3300009094 | Bacteria | 7765 |
| 49 | Ga0114129_10191047 | 3300009147 | Bacteria | 2780 |
| 50 | Ga0114129_10353525 | 3300009147 | Bacteria | 1946 |
| 51 | Ga0105242_11065373 | 3300009176 | Bacteria | 820 |
| 52 | Ga0105249_10802880 | 3300009553 | Bacteria | 1005 |
| 53 | Ga0105239_10087496 | 3300010375 | Bacteria | 3435 |
| 54 | Ga0157369_10401549 | 3300013105 | Bacteria | 1422 |
| 55 | Ga0157372_10218706 | 3300013307 | Bacteria | 2208 |
| 56 | Ga0157372_12238026 | 3300013307 | Bacteria | 628 |
| 57 | Ga0163163_10179282 | 3300014325 | Bacteria | 2166 |
| 58 | Ga0163163_10527341 | 3300014325 | Bacteria | 1243 |
| 59 | Ga0157377_10173942 | 3300014745 | Bacteria | 1349 |
| 60 | Ga0163161_10295802 | 3300017792 | Bacteria | 1274 |
| 61 | Ga0206353_10373461 | 3300020082 | Bacteria | 737 |
| 62 | Ga0206353_11269961 | 3300020082 | Bacteria | 1006 |
| 63 | Ga0207692_10082206 | 3300025898 | Bacteria | 1725 |
| 64 | Ga0207692_10605918 | 3300025898 | Bacteria | 704 |
| 65 | Ga0207705_10371655 | 3300025909 | Bacteria | 1104 |
| 66 | Ga0207671_10000491 | 3300025914 | Bacteria | 53763 |
| 67 | Ga0207693_10026297 | 3300025915 | Bacteria | 4606 |
| 68 | Ga0207693_10223797 | 3300025915 | Bacteria | 1478 |
| 69 | Ga0207693_10249402 | 3300025915 | Bacteria | 1393 |
| 70 | Ga0207663_10287474 | 3300025916 | Bacteria | 1223 |
| 71 | Ga0207663_10663477 | 3300025916 | Bacteria | 824 |
| 72 | Ga0207660_11246304 | 3300025917 | Unclassified | 605 |
| 73 | Ga0207687_10319699 | 3300025927 | Bacteria | 1256 |
| 74 | Ga0207700_10292529 | 3300025928 | Bacteria | 1404 |
| 75 | Ga0207664_10030818 | 3300025929 | Bacteria | 4099 |
| 76 | Ga0207665_10120990 | 3300025939 | Bacteria | 1849 |
| 77 | Ga0207665_10195845 | 3300025939 | Bacteria | 1470 |
| 78 | Ga0207661_10476566 | 3300025944 | Bacteria | 1139 |
| 79 | Ga0207679_10173385 | 3300025945 | Bacteria | 1778 |
| 80 | Ga0207712_10484012 | 3300025961 | Bacteria | 1055 |
| 81 | Ga0207658_10991879 | 3300025986 | Bacteria | 766 |
| 82 | Ga0207678_10086698 | 3300026067 | Bacteria | 2675 |
| 83 | Ga0207676_10754374 | 3300026095 | Bacteria | 947 |
| 84 | Ga0207428_10055245 | 3300027907 | Bacteria | 3158 |
| 85 | Ga0268266_10020471 | 3300028379 | Bacteria | 5638 |
| 86 | Ga0268265_10536327 | 3300028380 | Bacteria | 1109 |
| 87 | Ga0265319_1000187 | 3300028563 | Bacteria | 47107 |
| 88 | Ga0265330_10247365 | 3300031235 | Bacteria | 751 |
| 89 | Ga0265320_10010623 | 3300031240 | Bacteria | 5466 |
| 90 | Ga0265327_10008297 | 3300031251 | Bacteria | 7776 |
| 91 | Ga0307407_10668212 | 3300031903 | Bacteria | 780 |
| 92 | Ga0307412_10533859 | 3300031911 | Bacteria | 982 |
| 93 | Ga0307409_100053032 | 3300031995 | Bacteria | 3114 |
| 94 | Ga0307416_100181977 | 3300032002 | Bacteria | 1971 |
| 95 | Ga0307414_10438484 | 3300032004 | Bacteria | 1143 |
| 96 | Ga0307414_10782834 | 3300032004 | Bacteria | 869 |
| 97 | Ga0307415_101073172 | 3300032126 | Bacteria | 752 |
| 98 | Ga0373952_0058504 | 3300035092 | Bacteria | 936 |
| 99 | Ga0373932_0061955 | 3300035112 | Bacteria | 1139 |
| 100 | Ga0373939_0026139 | 3300035114 | Bacteria | 1643 |
| 101 | Ga0373953_0074030 | 3300035117 | Bacteria | 1408 |
| 102 | Ga0373960_0008951 | 3300035121 | Bacteria | 2413 |
| 103 | Ga0373946_0068254 | 3300035171 | Bacteria | 1529 |
| 104 | Ga0373935_0204836 | 3300035692 | Bacteria | 1365 |
| 105 | Ga0373933_0387037 | 3300035724 | Bacteria | 911 |
| 106 | Ga0373947_0858982 | 3300035725 | Bacteria | 620 |
| 107 | Ga0373937_0424849 | 3300036401 | Bacteria | 1261 |
| 108 | Ga0395899_0049575 | 3300037312 | Bacteria | 3121 |
| 109 | Ga0395899_0383296 | 3300037312 | Bacteria | 934 |
| 110 | Ga0395900_0018478 | 3300037418 | Bacteria | 7109 |
| 111 | Ga0395900_0059131 | 3300037418 | Bacteria | 3946 |
| 112 | Ga0395900_0097899 | 3300037418 | Bacteria | 3014 |
| 113 | Ga0395900_0352926 | 3300037418 | Bacteria | 1444 |
| 114 | Ga0395900_0416097 | 3300037418 | Bacteria | 1306 |
| 115 | Ga0395898_0010234 | 3300037466 | Bacteria | 9820 |
| 116 | Ga0395898_0016855 | 3300037466 | Bacteria | 7462 |
| 117 | Ga0395898_0385119 | 3300037466 | Bacteria | 1337 |
| 118 | Ga0395898_0416445 | 3300037466 | Bacteria | 1281 |
| 119 | Ga0395905_0288964 | 3300037471 | Bacteria | 1526 |
| 120 | Ga0436364_0516503 | 3300037853 | Unclassified | 872 |
| 121 | Ga0436364_1505094 | 3300037853 | Bacteria | 1706 |
| 122 | Ga0395901_0038200 | 3300038443 | Bacteria | 4966 |
| 123 | Ga0395901_0105564 | 3300038443 | Bacteria | 2956 |
| 124 | Ga0395901_0665581 | 3300038443 | Bacteria | 1043 |
| 125 | Ga0395901_1118992 | 3300038443 | Bacteria | 757 |
| 126 | Ga0395901_1342028 | 3300038443 | Unclassified | 675 |
| 127 | Ga0436365_0758265 | 3300039437 | Unclassified | 1634 |
| 128 | Ga0436365_1303786 | 3300039437 | Bacteria | 1111 |
| 129 | Ga0436365_1516866 | 3300039437 | Bacteria | 3152 |
| 130 | Ga0436363_0343896 | 3300039450 | Bacteria | 656 |
| 131 | Ga0436363_1296138 | 3300039450 | Bacteria | 697 |
| 132 | Ga0451835_0371495 | 3300041492 | Bacteria | 766 |
| 133 | Ga0466969_0393592 | 3300044656 | Bacteria | 629 |
| 134 | Ga0466965_0085807 | 3300044683 | Bacteria | 1596 |
| 135 | Ga0466963_0008791 | 3300044694 | Bacteria | 6067 |
| 136 | Ga0466963_0110139 | 3300044694 | Bacteria | 1890 |
| 137 | Ga0466963_0112893 | 3300044694 | Bacteria | 1866 |
| 138 | Ga0466963_0137469 | 3300044694 | Bacteria | 1691 |
| 139 | Ga0466963_0314967 | 3300044694 | Bacteria | 1101 |
| 140 | Ga0466971_0007912 | 3300044719 | Bacteria | 4630 |
| 141 | Ga0466968_0072303 | 3300044735 | Bacteria | 1503 |
| 142 | Ga0466968_0093021 | 3300044735 | Bacteria | 1339 |
| 143 | Ga0466968_0177393 | 3300044735 | Bacteria | 989 |
| 144 | Ga0466968_0203956 | 3300044735 | Bacteria | 927 |
| 145 | Ga0466970_0191593 | 3300044765 | Bacteria | 1136 |
| 146 | Ga0466957_0007895 | 3300044842 | Bacteria | 6036 |
| 147 | Ga0466958_0002789 | 3300045836 | Bacteria | 8887 |
| 148 | Ga0466967_0045575 | 3300045976 | Bacteria | 3811 |
| 149 | Ga0466967_0427410 | 3300045976 | Unclassified | 1292 |
| 150 | Ga0495629_0022684 | 3300046459 | Bacteria | 4474 |
| 151 | Ga0495641_0002107 | 3300046461 | Bacteria | 16065 |
| 152 | Ga0495653_0106554 | 3300046463 | Bacteria | 2021 |
| 153 | Ga0495582_0132104 | 3300046473 | Bacteria | 1411 |
| 154 | Ga0495662_0201333 | 3300046476 | Bacteria | 981 |
| 155 | Ga0495596_0077123 | 3300046500 | Bacteria | 1294 |
| 156 | Ga0495608_0035107 | 3300046511 | Bacteria | 3383 |
| 157 | Ga0495608_0129590 | 3300046511 | Bacteria | 1615 |
| 158 | Ga0495618_0113710 | 3300046514 | Bacteria | 1733 |
| 159 | Ga0495628_0224347 | 3300046516 | Bacteria | 1410 |
| 160 | Ga0495630_0435249 | 3300046517 | Bacteria | 1005 |
| 161 | Ga0495631_0276119 | 3300046518 | Bacteria | 716 |
| 162 | Ga0495644_0004469 | 3300046523 | Bacteria | 5496 |
| 163 | Ga0495652_0017072 | 3300046529 | Bacteria | 6482 |
| 164 | Ga0495654_0277732 | 3300046530 | Bacteria | 690 |
| 165 | Ga0495640_0027874 | 3300046533 | Bacteria | 4069 |
| 166 | Ga0495667_0011779 | 3300046559 | Bacteria | 5924 |
| 167 | Ga0495667_0139109 | 3300046559 | Bacteria | 1565 |
| 168 | Ga0495635_0085024 | 3300046663 | Bacteria | 2164 |
| 169 | Ga0495588_0274651 | 3300046674 | Bacteria | 888 |
| 170 | Ga0495657_0001401 | 3300046675 | Bacteria | 20878 |
| 171 | Ga0495599_0152147 | 3300046678 | Bacteria | 1432 |
| 172 | Ga0495623_0026469 | 3300046679 | Bacteria | 3733 |
| 173 | Ga0495658_0130573 | 3300046683 | Bacteria | 1529 |
| 174 | Ga0495671_0179396 | 3300046692 | Bacteria | 1029 |
| 175 | Ga0495589_0115615 | 3300046794 | Bacteria | 1293 |
| 176 | Ga0495589_0141685 | 3300046794 | Bacteria | 1151 |
| 177 | Ga0495581_0185279 | 3300047315 | Bacteria | 1218 |
| 178 | Ga0495604_0103671 | 3300047317 | Bacteria | 2086 |
| 179 | Ga0495674_0462288 | 3300047319 | Bacteria | 1018 |
| 180 | Ga0495672_0025749 | 3300047320 | Bacteria | 3760 |
| 181 | Ga0495680_0248117 | 3300047322 | Bacteria | 1262 |
| 182 | Ga0495675_0324783 | 3300047444 | Bacteria | 910 |
| 183 | Ga0495673_0006682 | 3300047469 | Bacteria | 6752 |
| 184 | Ga0495684_0201378 | 3300047471 | Bacteria | 1467 |
| 185 | Ga0495686_0009438 | 3300047472 | Bacteria | 7028 |
| 186 | Ga0495686_0012336 | 3300047472 | Bacteria | 5982 |
| 187 | Ga0495686_0282615 | 3300047472 | Bacteria | 922 |
| 188 | Ga0495686_0290555 | 3300047472 | Bacteria | 905 |
| 189 | Ga0495602_0113005 | 3300048088 | Bacteria | 2202 |
| 190 | Ga0495615_0001999 | 3300048090 | Bacteria | 3169 |
| 191 | Ga0496101_0259084 | 3300048904 | Unclassified | 1356 |
| 192 | Ga0496102_0089097 | 3300048905 | Bacteria | 2854 |
| 193 | Ga0496102_0326335 | 3300048905 | Bacteria | 1446 |
| 194 | Ga0496102_1071645 | 3300048905 | Bacteria | 726 |
| 195 | Ga0496103_0005963 | 3300048906 | Bacteria | 7287 |
| 196 | Ga0496104_0056521 | 3300048907 | Bacteria | 3711 |
| 197 | Ga0496104_0063189 | 3300048907 | Bacteria | 3511 |
| 198 | Ga0496104_0230228 | 3300048907 | Bacteria | 1765 |
| 199 | Ga0496105_0077523 | 3300048908 | Bacteria | 2745 |
| 200 | Ga0496107_0043415 | 3300048910 | Bacteria | 3230 |
| 201 | Ga0496108_0000897 | 3300048911 | Bacteria | 23179 |
| 202 | Ga0496108_0104885 | 3300048911 | Bacteria | 2413 |
| 203 | Ga0496108_0249195 | 3300048911 | Bacteria | 1545 |
| 204 | Ga0496108_0340794 | 3300048911 | Bacteria | 1308 |
| 205 | Ga0496109_0000889 | 3300048912 | Bacteria | 24973 |
| 206 | Ga0496109_0029602 | 3300048912 | Bacteria | 4905 |
| 207 | Ga0496109_0089470 | 3300048912 | Bacteria | 2846 |
| 208 | Ga0496109_0104407 | 3300048912 | Bacteria | 2631 |
| 209 | Ga0496109_0227769 | 3300048912 | Bacteria | 1753 |
| 210 | Ga0496109_0330483 | 3300048912 | Bacteria | 1439 |
| 211 | Ga0496109_0420984 | 3300048912 | Bacteria | 1262 |
| 212 | Ga0496110_0006665 | 3300048913 | Bacteria | 9175 |
| 213 | Ga0496110_0065235 | 3300048913 | Bacteria | 3219 |
| 214 | Ga0496110_1061280 | 3300048913 | Bacteria | 718 |
| 215 | Ga0496111_0050883 | 3300048914 | Bacteria | 2990 |
| 216 | Ga0496111_0464765 | 3300048914 | Bacteria | 933 |
| 217 | Ga0496112_0000621 | 3300048915 | Bacteria | 24571 |
| 218 | Ga0496112_0155625 | 3300048915 | Bacteria | 2252 |
| 219 | Ga0496112_0253971 | 3300048915 | Bacteria | 1708 |
| 220 | Ga0496112_0454204 | 3300048915 | Unclassified | 1219 |
| 221 | Ga0496112_0999673 | 3300048915 | Bacteria | 756 |
| 222 | Ga0496113_0061983 | 3300048916 | Bacteria | 2823 |
| 223 | Ga0496113_0123452 | 3300048916 | Bacteria | 2026 |
| 224 | Ga0496113_0131404 | 3300048916 | Bacteria | 1965 |
| 225 | Ga0496113_0536728 | 3300048916 | Bacteria | 939 |
| 226 | Ga0496114_0151495 | 3300048917 | Bacteria | 2012 |
| 227 | Ga0496114_0787722 | 3300048917 | Bacteria | 829 |
| 228 | Ga0496115_0000302 | 3300048918 | Bacteria | 42002 |
| 229 | Ga0496115_0042268 | 3300048918 | Bacteria | 3631 |
| 230 | Ga0496115_0360949 | 3300048918 | Bacteria | 1184 |
| 231 | Ga0496124_0130544 | 3300048927 | Bacteria | 1997 |
| 232 | Ga0501033_0144772 | 3300049570 | Bacteria | 1717 |
| 233 | Ga0501036_0054393 | 3300049572 | Bacteria | 3391 |
| 234 | Ga0501036_0226639 | 3300049572 | Bacteria | 1569 |
| 235 | Ga0501039_0348575 | 3300049575 | Bacteria | 1164 |
| 236 | Ga0501039_0709163 | 3300049575 | Bacteria | 787 |
| 237 | Ga0501041_0506908 | 3300049577 | Bacteria | 768 |
| 238 | Ga0501041_0524221 | 3300049577 | Unclassified | 754 |
| 239 | Ga0501046_0471231 | 3300049580 | Bacteria | 902 |
| 240 | Ga0501067_0388377 | 3300049583 | Bacteria | 778 |
| 241 | Ga0501071_0039467 | 3300049587 | Bacteria | 3378 |
| 242 | Ga0501072_0119610 | 3300049588 | Bacteria | 2098 |
| 243 | Ga0501072_0992525 | 3300049588 | Bacteria | 655 |
| 244 | Ga0501074_0062606 | 3300049590 | Bacteria | 2680 |
| 245 | Ga0501074_0485836 | 3300049590 | Bacteria | 875 |
| 246 | Ga0501076_0357838 | 3300049592 | Bacteria | 1199 |
| 247 | Ga0501079_0193207 | 3300049741 | Bacteria | 1589 |
| 248 | Ga0501079_0307507 | 3300049741 | Bacteria | 1240 |
| 249 | Ga0501080_0030689 | 3300049742 | Bacteria | 5008 |
| 250 | Ga0501045_0105710 | 3300049824 | Bacteria | 2086 |
| 251 | Ga0501045_0337992 | 3300049824 | Unclassified | 1121 |
| 252 | nmdc:mga00v17_166311_c1 | 3300050491 | Bacteria | 1421 |
| 253 | nmdc:mga05p37_142742_c1 | 3300050507 | Bacteria | 2933 |
| 254 | nmdc:mga0qj67_1921_c1 | 3300050509 | Bacteria | 14754 |
| 255 | nmdc:mga0qj67_410527_c1 | 3300050509 | Bacteria | 1092 |
| 256 | nmdc:mga0qj67_41528_c1 | 3300050509 | Bacteria | 3618 |
| 257 | nmdc:mga06r32_265536_c1 | 3300050510 | Bacteria | 1704 |
| 258 | nmdc:mga06r32_346933_c1 | 3300050510 | Bacteria | 1469 |
| 259 | nmdc:mga08y16_124324_c1 | 3300050511 | Bacteria | 2684 |
| 260 | nmdc:mga0n895_285158_c1 | 3300050512 | Bacteria | 1674 |
| 261 | nmdc:mga0a205_227847_c1 | 3300050515 | Bacteria | 1748 |
| 262 | Ga0495655_0012642 | 3300053083 | Bacteria | 1726 |
| 263 | Ga0495655_0085616 | 3300053083 | Bacteria | 909 |
| 264 | Ga0495595_0000951 | 3300053084 | Bacteria | 11143 |
| 265 | Ga0500556_0001583 | 3300053104 | Bacteria | 9132 |
| 266 | Ga0500628_002338 | 3300053129 | Bacteria | 3139 |
| 267 | Ga0500616_0013536 | 3300053153 | Bacteria | 4731 |
| 268 | Ga0501084_0081290 | 3300054114 | Bacteria | 2718 |
| 269 | Ga0501082_0011784 | 3300060353 | Bacteria | 7518 |
| 270 | Ga0466962_0021813 | 3300061719 | Bacteria | 3075 |
| 271 | Ga0530510_0154539 | 3300061734 | Unclassified | 1695 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048906 | Ga0496103_0005963 | Ga0496103_0005963_3283_3849 | 156 |
| 2 | 3300048911 | Ga0496108_0000897 | Ga0496108_0000897_14255_14857 | 157 |
| 3 | 3300048912 | Ga0496109_0000889 | Ga0496109_0000889_16608_17210 | 157 |
| 4 | 3300025898 | Ga0207692_10605918 | Ga0207692_106059182 | 163 |
| 5 | 3300025961 | Ga0207712_10484012 | Ga0207712_104840122 | 166 |
| 6 | 3300048927 | Ga0496124_0130544 | Ga0496124_0130544_1094_1660 | 170 |
| 7 | 3300047472 | Ga0495686_0282615 | Ga0495686_0282615_169_735 | 171 |
| 8 | 3300046518 | Ga0495631_0276119 | Ga0495631_0276119_182_706 | 172 |
| 9 | 3300006844 | Ga0075428_100071903 | Ga0075428_1000719033 | 176 |
| 10 | 3300006846 | Ga0075430_100003409 | Ga0075430_10000340912 | 176 |
| 11 | 3300006847 | Ga0075431_100031563 | Ga0075431_1000315634 | 176 |
| 12 | 3300046692 | Ga0495671_0179396 | Ga0495671_0179396_161_691 | 176 |
| 13 | 3300046794 | Ga0495589_0115615 | Ga0495589_0115615_210_740 | 176 |
| 14 | 3300048905 | Ga0496102_1071645 | Ga0496102_1071645_49_615 | 176 |
| 15 | 3300005434 | Ga0070709_10194789 | Ga0070709_101947893 | 180 |
| 16 | 3300005436 | Ga0070713_100204114 | Ga0070713_1002041142 | 180 |
| 17 | 3300005436 | Ga0070713_100251932 | Ga0070713_1002519321 | 180 |
| 18 | 3300005437 | Ga0070710_10081906 | Ga0070710_100819063 | 180 |
| 19 | 3300006028 | Ga0070717_10093397 | Ga0070717_100933972 | 180 |
| 20 | 3300006175 | Ga0070712_100001831 | Ga0070712_10000183111 | 180 |
| 21 | 3300009553 | Ga0105249_10802880 | Ga0105249_108028801 | 180 |
| 22 | 3300025898 | Ga0207692_10082206 | Ga0207692_100822061 | 180 |
| 23 | 3300025915 | Ga0207693_10026297 | Ga0207693_100262973 | 180 |
| 24 | 3300025928 | Ga0207700_10292529 | Ga0207700_102925292 | 180 |
| 25 | 3300025929 | Ga0207664_10030818 | Ga0207664_100308184 | 180 |
| 26 | 3300025939 | Ga0207665_10120990 | Ga0207665_101209903 | 180 |
| 27 | 3300035117 | Ga0373953_0074030 | Ga0373953_0074030_63_629 | 180 |
| 28 | 3300035724 | Ga0373933_0387037 | Ga0373933_0387037_127_693 | 180 |
| 29 | 3300035725 | Ga0373947_0858982 | Ga0373947_0858982_44_610 | 180 |
| 30 | 3300036401 | Ga0373937_0424849 | Ga0373937_0424849_209_775 | 180 |
| 31 | 3300037853 | Ga0436364_0516503 | Ga0436364_0516503_188_754 | 180 |
| 32 | 3300037853 | Ga0436364_1505094 | Ga0436364_1505094_176_727 | 180 |
| 33 | 3300039450 | Ga0436363_0343896 | Ga0436363_0343896_93_644 | 180 |
| 34 | 3300044656 | Ga0466969_0393592 | Ga0466969_0393592_57_611 | 180 |
| 35 | 3300044694 | Ga0466963_0110139 | Ga0466963_0110139_1299_1865 | 180 |
| 36 | 3300044735 | Ga0466968_0093021 | Ga0466968_0093021_653_1219 | 180 |
| 37 | 3300046459 | Ga0495629_0022684 | Ga0495629_0022684_3633_4199 | 180 |
| 38 | 3300046463 | Ga0495653_0106554 | Ga0495653_0106554_127_693 | 180 |
| 39 | 3300046473 | Ga0495582_0132104 | Ga0495582_0132104_88_654 | 180 |
| 40 | 3300046511 | Ga0495608_0035107 | Ga0495608_0035107_281_847 | 180 |
| 41 | 3300046511 | Ga0495608_0129590 | Ga0495608_0129590_350_916 | 180 |
| 42 | 3300046514 | Ga0495618_0113710 | Ga0495618_0113710_832_1398 | 180 |
| 43 | 3300046516 | Ga0495628_0224347 | Ga0495628_0224347_28_594 | 180 |
| 44 | 3300046529 | Ga0495652_0017072 | Ga0495652_0017072_866_1432 | 180 |
| 45 | 3300046533 | Ga0495640_0027874 | Ga0495640_0027874_2085_2651 | 180 |
| 46 | 3300046559 | Ga0495667_0011779 | Ga0495667_0011779_4245_4811 | 180 |
| 47 | 3300046559 | Ga0495667_0139109 | Ga0495667_0139109_50_616 | 180 |
| 48 | 3300046663 | Ga0495635_0085024 | Ga0495635_0085024_1281_1847 | 180 |
| 49 | 3300046675 | Ga0495657_0001401 | Ga0495657_0001401_17695_18261 | 180 |
| 50 | 3300046678 | Ga0495599_0152147 | Ga0495599_0152147_135_701 | 180 |
| 51 | 3300046679 | Ga0495623_0026469 | Ga0495623_0026469_1261_1827 | 180 |
| 52 | 3300047317 | Ga0495604_0103671 | Ga0495604_0103671_752_1318 | 180 |
| 53 | 3300047319 | Ga0495674_0462288 | Ga0495674_0462288_264_830 | 180 |
| 54 | 3300047322 | Ga0495680_0248117 | Ga0495680_0248117_488_1054 | 180 |
| 55 | 3300047444 | Ga0495675_0324783 | Ga0495675_0324783_76_642 | 180 |
| 56 | 3300047471 | Ga0495684_0201378 | Ga0495684_0201378_836_1402 | 180 |
| 57 | 3300048088 | Ga0495602_0113005 | Ga0495602_0113005_799_1365 | 180 |
| 58 | 3300048904 | Ga0496101_0259084 | Ga0496101_0259084_487_1047 | 180 |
| 59 | 3300048907 | Ga0496104_0056521 | Ga0496104_0056521_485_1051 | 180 |
| 60 | 3300048907 | Ga0496104_0063189 | Ga0496104_0063189_2920_3489 | 180 |
| 61 | 3300048911 | Ga0496108_0249195 | Ga0496108_0249195_106_672 | 180 |
| 62 | 3300048911 | Ga0496108_0340794 | Ga0496108_0340794_136_705 | 180 |
| 63 | 3300048912 | Ga0496109_0089470 | Ga0496109_0089470_1871_2431 | 180 |
| 64 | 3300048912 | Ga0496109_0330483 | Ga0496109_0330483_68_637 | 180 |
| 65 | 3300048913 | Ga0496110_0006665 | Ga0496110_0006665_435_995 | 180 |
| 66 | 3300048915 | Ga0496112_0000621 | Ga0496112_0000621_9132_9701 | 180 |
| 67 | 3300048916 | Ga0496113_0123452 | Ga0496113_0123452_1286_1855 | 180 |
| 68 | 3300048916 | Ga0496113_0131404 | Ga0496113_0131404_193_759 | 180 |
| 69 | 3300048918 | Ga0496115_0042268 | Ga0496115_0042268_860_1426 | 180 |
| 70 | 3300049588 | Ga0501072_0119610 | Ga0501072_0119610_880_1425 | 180 |
| 71 | 3300053084 | Ga0495595_0000951 | Ga0495595_0000951_8330_8896 | 180 |
| 72 | 3300005329 | Ga0070683_100411002 | Ga0070683_1004110023 | 181 |
| 73 | 3300005329 | Ga0070683_101083349 | Ga0070683_1010833491 | 181 |
| 74 | 3300005344 | Ga0070661_100548371 | Ga0070661_1005483711 | 181 |
| 75 | 3300005981 | Ga0081538_10127408 | Ga0081538_101274082 | 181 |
| 76 | 3300009176 | Ga0105242_11065373 | Ga0105242_110653731 | 181 |
| 77 | 3300010375 | Ga0105239_10087496 | Ga0105239_100874964 | 181 |
| 78 | 3300013105 | Ga0157369_10401549 | Ga0157369_104015492 | 181 |
| 79 | 3300013307 | Ga0157372_10218706 | Ga0157372_102187063 | 181 |
| 80 | 3300013307 | Ga0157372_12238026 | Ga0157372_122380261 | 181 |
| 81 | 3300014325 | Ga0163163_10179282 | Ga0163163_101792823 | 181 |
| 82 | 3300014745 | Ga0157377_10173942 | Ga0157377_101739422 | 181 |
| 83 | 3300017792 | Ga0163161_10295802 | Ga0163161_102958022 | 181 |
| 84 | 3300025927 | Ga0207687_10319699 | Ga0207687_103196992 | 181 |
| 85 | 3300025944 | Ga0207661_10476566 | Ga0207661_104765662 | 181 |
| 86 | 3300025986 | Ga0207658_10991879 | Ga0207658_109918791 | 181 |
| 87 | 3300028380 | Ga0268265_10536327 | Ga0268265_105363272 | 181 |
| 88 | 3300032004 | Ga0307414_10782834 | Ga0307414_107828342 | 181 |
| 89 | 3300037312 | Ga0395899_0383296 | Ga0395899_0383296_188_733 | 181 |
| 90 | 3300037418 | Ga0395900_0059131 | Ga0395900_0059131_928_1473 | 181 |
| 91 | 3300037418 | Ga0395900_0416097 | Ga0395900_0416097_136_681 | 181 |
| 92 | 3300037466 | Ga0395898_0016855 | Ga0395898_0016855_3671_4216 | 181 |
| 93 | 3300037466 | Ga0395898_0416445 | Ga0395898_0416445_207_752 | 181 |
| 94 | 3300038443 | Ga0395901_0038200 | Ga0395901_0038200_3239_3784 | 181 |
| 95 | 3300039437 | Ga0436365_0758265 | Ga0436365_0758265_818_1396 | 181 |
| 96 | 3300039437 | Ga0436365_1516866 | Ga0436365_1516866_1615_2181 | 181 |
| 97 | 3300041492 | Ga0451835_0371495 | Ga0451835_0371495_188_733 | 181 |
| 98 | 3300044683 | Ga0466965_0085807 | Ga0466965_0085807_826_1383 | 181 |
| 99 | 3300044694 | Ga0466963_0314967 | Ga0466963_0314967_99_668 | 181 |
| 100 | 3300044719 | Ga0466971_0007912 | Ga0466971_0007912_470_1039 | 181 |
| 101 | 3300044735 | Ga0466968_0177393 | Ga0466968_0177393_254_811 | 181 |
| 102 | 3300044735 | Ga0466968_0203956 | Ga0466968_0203956_321_872 | 181 |
| 103 | 3300044765 | Ga0466970_0191593 | Ga0466970_0191593_369_926 | 181 |
| 104 | 3300044842 | Ga0466957_0007895 | Ga0466957_0007895_3702_4271 | 181 |
| 105 | 3300045836 | Ga0466958_0002789 | Ga0466958_0002789_6184_6753 | 181 |
| 106 | 3300045976 | Ga0466967_0427410 | Ga0466967_0427410_734_1279 | 181 |
| 107 | 3300048905 | Ga0496102_0089097 | Ga0496102_0089097_506_1051 | 181 |
| 108 | 3300048907 | Ga0496104_0230228 | Ga0496104_0230228_159_704 | 181 |
| 109 | 3300048908 | Ga0496105_0077523 | Ga0496105_0077523_205_750 | 181 |
| 110 | 3300048910 | Ga0496107_0043415 | Ga0496107_0043415_813_1358 | 181 |
| 111 | 3300048911 | Ga0496108_0104885 | Ga0496108_0104885_676_1221 | 181 |
| 112 | 3300048912 | Ga0496109_0029602 | Ga0496109_0029602_3605_4150 | 181 |
| 113 | 3300048912 | Ga0496109_0104407 | Ga0496109_0104407_1600_2145 | 181 |
| 114 | 3300048914 | Ga0496111_0050883 | Ga0496111_0050883_835_1380 | 181 |
| 115 | 3300048915 | Ga0496112_0155625 | Ga0496112_0155625_834_1379 | 181 |
| 116 | 3300048915 | Ga0496112_0253971 | Ga0496112_0253971_463_1008 | 181 |
| 117 | 3300048915 | Ga0496112_0999673 | Ga0496112_0999673_71_616 | 181 |
| 118 | 3300048916 | Ga0496113_0061983 | Ga0496113_0061983_651_1196 | 181 |
| 119 | 3300048917 | Ga0496114_0151495 | Ga0496114_0151495_769_1314 | 181 |
| 120 | 3300048917 | Ga0496114_0787722 | Ga0496114_0787722_73_618 | 181 |
| 121 | 3300048918 | Ga0496115_0360949 | Ga0496115_0360949_211_756 | 181 |
| 122 | 3300053083 | Ga0495655_0012642 | Ga0495655_0012642_1081_1653 | 181 |
| 123 | 3300061719 | Ga0466962_0021813 | Ga0466962_0021813_1855_2424 | 181 |
| 124 | 3300003373 | JGI25407J50210_10006157 | JGI25407J50210_100061573 | 182 |
| 125 | 3300003373 | JGI25407J50210_10010819 | JGI25407J50210_100108192 | 182 |
| 126 | 3300003373 | JGI25407J50210_10014126 | JGI25407J50210_100141262 | 182 |
| 127 | 3300003373 | JGI25407J50210_10053735 | JGI25407J50210_100537351 | 182 |
| 128 | 3300005327 | Ga0070658_10431746 | Ga0070658_104317462 | 182 |
| 129 | 3300005459 | Ga0068867_101360049 | Ga0068867_1013600491 | 182 |
| 130 | 3300005530 | Ga0070679_100387196 | Ga0070679_1003871963 | 182 |
| 131 | 3300005548 | Ga0070665_100001876 | Ga0070665_1000018766 | 182 |
| 132 | 3300005549 | Ga0070704_100395431 | Ga0070704_1003954312 | 182 |
| 133 | 3300005937 | Ga0081455_10007584 | Ga0081455_100075848 | 182 |
| 134 | 3300005937 | Ga0081455_10101742 | Ga0081455_101017423 | 182 |
| 135 | 3300005981 | Ga0081538_10000021 | Ga0081538_10000021128 | 182 |
| 136 | 3300005981 | Ga0081538_10000801 | Ga0081538_100008013 | 182 |
| 137 | 3300005981 | Ga0081538_10001966 | Ga0081538_100019663 | 182 |
| 138 | 3300005981 | Ga0081538_10002620 | Ga0081538_100026203 | 182 |
| 139 | 3300005981 | Ga0081538_10006464 | Ga0081538_100064643 | 182 |
| 140 | 3300005981 | Ga0081538_10006708 | Ga0081538_100067082 | 182 |
| 141 | 3300005981 | Ga0081538_10014657 | Ga0081538_100146576 | 182 |
| 142 | 3300006051 | Ga0075364_10036308 | Ga0075364_100363083 | 182 |
| 143 | 3300006058 | Ga0075432_10015398 | Ga0075432_100153983 | 182 |
| 144 | 3300006844 | Ga0075428_100133018 | Ga0075428_1001330183 | 182 |
| 145 | 3300006846 | Ga0075430_100059953 | Ga0075430_1000599532 | 182 |
| 146 | 3300006847 | Ga0075431_100593612 | Ga0075431_1005936121 | 182 |
| 147 | 3300006852 | Ga0075433_10212235 | Ga0075433_102122352 | 182 |
| 148 | 3300006880 | Ga0075429_100429740 | Ga0075429_1004297402 | 182 |
| 149 | 3300009094 | Ga0111539_10022393 | Ga0111539_100223933 | 182 |
| 150 | 3300009147 | Ga0114129_10191047 | Ga0114129_101910473 | 182 |
| 151 | 3300009147 | Ga0114129_10353525 | Ga0114129_103535252 | 182 |
| 152 | 3300025909 | Ga0207705_10371655 | Ga0207705_103716552 | 182 |
| 153 | 3300025914 | Ga0207671_10000491 | Ga0207671_1000049142 | 182 |
| 154 | 3300026067 | Ga0207678_10086698 | Ga0207678_100866983 | 182 |
| 155 | 3300027907 | Ga0207428_10055245 | Ga0207428_100552452 | 182 |
| 156 | 3300028379 | Ga0268266_10020471 | Ga0268266_100204716 | 182 |
| 157 | 3300028563 | Ga0265319_1000187 | Ga0265319_100018725 | 182 |
| 158 | 3300031235 | Ga0265330_10247365 | Ga0265330_102473651 | 182 |
| 159 | 3300031240 | Ga0265320_10010623 | Ga0265320_100106236 | 182 |
| 160 | 3300031903 | Ga0307407_10668212 | Ga0307407_106682121 | 182 |
| 161 | 3300031911 | Ga0307412_10533859 | Ga0307412_105338592 | 182 |
| 162 | 3300031995 | Ga0307409_100053032 | Ga0307409_1000530323 | 182 |
| 163 | 3300032002 | Ga0307416_100181977 | Ga0307416_1001819773 | 182 |
| 164 | 3300032004 | Ga0307414_10438484 | Ga0307414_104384842 | 182 |
| 165 | 3300032126 | Ga0307415_101073172 | Ga0307415_1010731721 | 182 |
| 166 | 3300035092 | Ga0373952_0058504 | Ga0373952_0058504_43_600 | 182 |
| 167 | 3300035112 | Ga0373932_0061955 | Ga0373932_0061955_405_962 | 182 |
| 168 | 3300035114 | Ga0373939_0026139 | Ga0373939_0026139_804_1361 | 182 |
| 169 | 3300035121 | Ga0373960_0008951 | Ga0373960_0008951_826_1383 | 182 |
| 170 | 3300037312 | Ga0395899_0049575 | Ga0395899_0049575_625_1179 | 182 |
| 171 | 3300037418 | Ga0395900_0018478 | Ga0395900_0018478_6032_6586 | 182 |
| 172 | 3300037418 | Ga0395900_0097899 | Ga0395900_0097899_1975_2529 | 182 |
| 173 | 3300037466 | Ga0395898_0010234 | Ga0395898_0010234_3097_3651 | 182 |
| 174 | 3300037466 | Ga0395898_0385119 | Ga0395898_0385119_112_684 | 182 |
| 175 | 3300037471 | Ga0395905_0288964 | Ga0395905_0288964_443_997 | 182 |
| 176 | 3300038443 | Ga0395901_0665581 | Ga0395901_0665581_190_765 | 182 |
| 177 | 3300038443 | Ga0395901_1342028 | Ga0395901_1342028_48_602 | 182 |
| 178 | 3300039437 | Ga0436365_1303786 | Ga0436365_1303786_394_993 | 182 |
| 179 | 3300039450 | Ga0436363_1296138 | Ga0436363_1296138_58_654 | 182 |
| 180 | 3300044694 | Ga0466963_0008791 | Ga0466963_0008791_348_935 | 182 |
| 181 | 3300044694 | Ga0466963_0137469 | Ga0466963_0137469_144_710 | 182 |
| 182 | 3300046461 | Ga0495641_0002107 | Ga0495641_0002107_15284_15835 | 182 |
| 183 | 3300046476 | Ga0495662_0201333 | Ga0495662_0201333_255_806 | 182 |
| 184 | 3300046500 | Ga0495596_0077123 | Ga0495596_0077123_320_871 | 182 |
| 185 | 3300046517 | Ga0495630_0435249 | Ga0495630_0435249_22_591 | 182 |
| 186 | 3300046523 | Ga0495644_0004469 | Ga0495644_0004469_3853_4404 | 182 |
| 187 | 3300046674 | Ga0495588_0274651 | Ga0495588_0274651_165_716 | 182 |
| 188 | 3300046683 | Ga0495658_0130573 | Ga0495658_0130573_565_1134 | 182 |
| 189 | 3300046794 | Ga0495589_0141685 | Ga0495589_0141685_194_745 | 182 |
| 190 | 3300047315 | Ga0495581_0185279 | Ga0495581_0185279_562_1119 | 182 |
| 191 | 3300047320 | Ga0495672_0025749 | Ga0495672_0025749_2567_3121 | 182 |
| 192 | 3300047469 | Ga0495673_0006682 | Ga0495673_0006682_2505_3056 | 182 |
| 193 | 3300047472 | Ga0495686_0009438 | Ga0495686_0009438_1998_2549 | 182 |
| 194 | 3300047472 | Ga0495686_0012336 | Ga0495686_0012336_4139_4699 | 182 |
| 195 | 3300047472 | Ga0495686_0290555 | Ga0495686_0290555_21_572 | 182 |
| 196 | 3300048090 | Ga0495615_0001999 | Ga0495615_0001999_1416_1967 | 182 |
| 197 | 3300048905 | Ga0496102_0326335 | Ga0496102_0326335_73_624 | 182 |
| 198 | 3300049570 | Ga0501033_0144772 | Ga0501033_0144772_672_1223 | 182 |
| 199 | 3300049572 | Ga0501036_0054393 | Ga0501036_0054393_2056_2607 | 182 |
| 200 | 3300049572 | Ga0501036_0226639 | Ga0501036_0226639_139_696 | 182 |
| 201 | 3300049575 | Ga0501039_0348575 | Ga0501039_0348575_302_853 | 182 |
| 202 | 3300049575 | Ga0501039_0709163 | Ga0501039_0709163_122_676 | 182 |
| 203 | 3300049577 | Ga0501041_0524221 | Ga0501041_0524221_111_662 | 182 |
| 204 | 3300049580 | Ga0501046_0471231 | Ga0501046_0471231_179_733 | 182 |
| 205 | 3300049587 | Ga0501071_0039467 | Ga0501071_0039467_233_784 | 182 |
| 206 | 3300049588 | Ga0501072_0992525 | Ga0501072_0992525_26_580 | 182 |
| 207 | 3300049590 | Ga0501074_0485836 | Ga0501074_0485836_67_618 | 182 |
| 208 | 3300049592 | Ga0501076_0357838 | Ga0501076_0357838_320_877 | 182 |
| 209 | 3300049741 | Ga0501079_0193207 | Ga0501079_0193207_366_917 | 182 |
| 210 | 3300049824 | Ga0501045_0105710 | Ga0501045_0105710_291_842 | 182 |
| 211 | 3300049824 | Ga0501045_0337992 | Ga0501045_0337992_54_608 | 182 |
| 212 | 3300050491 | nmdc:mga00v17_166311_c1 | nmdc:mga00v17_166311_c1_457_1023 | 182 |
| 213 | 3300050507 | nmdc:mga05p37_142742_c1 | nmdc:mga05p37_142742_c1_913_1470 | 182 |
| 214 | 3300050509 | nmdc:mga0qj67_410527_c1 | nmdc:mga0qj67_410527_c1_512_1072 | 182 |
| 215 | 3300050509 | nmdc:mga0qj67_41528_c1 | nmdc:mga0qj67_41528_c1_1794_2351 | 182 |
| 216 | 3300050510 | nmdc:mga06r32_346933_c1 | nmdc:mga06r32_346933_c1_831_1388 | 182 |
| 217 | 3300050511 | nmdc:mga08y16_124324_c1 | nmdc:mga08y16_124324_c1_1514_2071 | 182 |
| 218 | 3300050512 | nmdc:mga0n895_285158_c1 | nmdc:mga0n895_285158_c1_698_1255 | 182 |
| 219 | 3300050515 | nmdc:mga0a205_227847_c1 | nmdc:mga0a205_227847_c1_763_1320 | 182 |
| 220 | 3300053083 | Ga0495655_0085616 | Ga0495655_0085616_83_631 | 182 |
| 221 | 3300053129 | Ga0500628_002338 | Ga0500628_002338_852_1403 | 182 |
| 222 | 3300054114 | Ga0501084_0081290 | Ga0501084_0081290_664_1215 | 182 |
| 223 | 3300060353 | Ga0501082_0011784 | Ga0501082_0011784_4276_4827 | 182 |
| 224 | 3300061734 | Ga0530510_0154539 | Ga0530510_0154539_651_1205 | 182 |
| 225 | 3300003203 | JGI25406J46586_10054604 | JGI25406J46586_100546042 | 183 |
| 226 | 3300005439 | Ga0070711_100053443 | Ga0070711_1000534432 | 183 |
| 227 | 3300005564 | Ga0070664_100192156 | Ga0070664_1001921563 | 183 |
| 228 | 3300005564 | Ga0070664_100976770 | Ga0070664_1009767701 | 183 |
| 229 | 3300005577 | Ga0068857_100610097 | Ga0068857_1006100972 | 183 |
| 230 | 3300005981 | Ga0081538_10006329 | Ga0081538_100063292 | 183 |
| 231 | 3300005985 | Ga0081539_10002309 | Ga0081539_1000230921 | 183 |
| 232 | 3300006173 | Ga0070716_100165470 | Ga0070716_1001654702 | 183 |
| 233 | 3300006175 | Ga0070712_100030585 | Ga0070712_1000305853 | 183 |
| 234 | 3300014325 | Ga0163163_10527341 | Ga0163163_105273412 | 183 |
| 235 | 3300020082 | Ga0206353_10373461 | Ga0206353_103734611 | 183 |
| 236 | 3300020082 | Ga0206353_11269961 | Ga0206353_112699612 | 183 |
| 237 | 3300025915 | Ga0207693_10223797 | Ga0207693_102237972 | 183 |
| 238 | 3300025915 | Ga0207693_10249402 | Ga0207693_102494022 | 183 |
| 239 | 3300025916 | Ga0207663_10287474 | Ga0207663_102874742 | 183 |
| 240 | 3300025916 | Ga0207663_10663477 | Ga0207663_106634771 | 183 |
| 241 | 3300025917 | Ga0207660_11246304 | Ga0207660_112463041 | 183 |
| 242 | 3300025939 | Ga0207665_10195845 | Ga0207665_101958452 | 183 |
| 243 | 3300025945 | Ga0207679_10173385 | Ga0207679_101733852 | 183 |
| 244 | 3300026095 | Ga0207676_10754374 | Ga0207676_107543742 | 183 |
| 245 | 3300031251 | Ga0265327_10008297 | Ga0265327_100082973 | 183 |
| 246 | 3300035171 | Ga0373946_0068254 | Ga0373946_0068254_280_846 | 183 |
| 247 | 3300035692 | Ga0373935_0204836 | Ga0373935_0204836_209_775 | 183 |
| 248 | 3300037418 | Ga0395900_0352926 | Ga0395900_0352926_276_854 | 183 |
| 249 | 3300038443 | Ga0395901_0105564 | Ga0395901_0105564_1818_2372 | 183 |
| 250 | 3300038443 | Ga0395901_1118992 | Ga0395901_1118992_72_665 | 183 |
| 251 | 3300044694 | Ga0466963_0112893 | Ga0466963_0112893_932_1549 | 183 |
| 252 | 3300044735 | Ga0466968_0072303 | Ga0466968_0072303_575_1132 | 183 |
| 253 | 3300045976 | Ga0466967_0045575 | Ga0466967_0045575_1939_2493 | 183 |
| 254 | 3300046530 | Ga0495654_0277732 | Ga0495654_0277732_70_657 | 183 |
| 255 | 3300048912 | Ga0496109_0227769 | Ga0496109_0227769_760_1326 | 183 |
| 256 | 3300048912 | Ga0496109_0420984 | Ga0496109_0420984_84_635 | 183 |
| 257 | 3300048913 | Ga0496110_0065235 | Ga0496110_0065235_1212_1778 | 183 |
| 258 | 3300048913 | Ga0496110_1061280 | Ga0496110_1061280_142_693 | 183 |
| 259 | 3300048914 | Ga0496111_0464765 | Ga0496111_0464765_207_773 | 183 |
| 260 | 3300048915 | Ga0496112_0454204 | Ga0496112_0454204_106_672 | 183 |
| 261 | 3300048916 | Ga0496113_0536728 | Ga0496113_0536728_109_666 | 183 |
| 262 | 3300048918 | Ga0496115_0000302 | Ga0496115_0000302_1010_1609 | 183 |
| 263 | 3300049577 | Ga0501041_0506908 | Ga0501041_0506908_116_676 | 183 |
| 264 | 3300049583 | Ga0501067_0388377 | Ga0501067_0388377_47_607 | 183 |
| 265 | 3300049590 | Ga0501074_0062606 | Ga0501074_0062606_1389_1946 | 183 |
| 266 | 3300049741 | Ga0501079_0307507 | Ga0501079_0307507_399_956 | 183 |
| 267 | 3300049742 | Ga0501080_0030689 | Ga0501080_0030689_3570_4127 | 183 |
| 268 | 3300050509 | nmdc:mga0qj67_1921_c1 | nmdc:mga0qj67_1921_c1_2631_3191 | 183 |
| 269 | 3300050510 | nmdc:mga06r32_265536_c1 | nmdc:mga06r32_265536_c1_662_1222 | 183 |
| 270 | 3300053104 | Ga0500556_0001583 | Ga0500556_0001583_7239_7793 | 183 |
| 271 | 3300053153 | Ga0500616_0013536 | Ga0500616_0013536_783_1337 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hki-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate | 0.9402 | 3 | 176 |
| 5hkl-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with inorganic phosphate | 0.9314 | 1 | 175 |
| 5hki-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate | 0.9242 | 3 | 176 |
| 5hkf-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) | 0.9239 | 3 | 175 |
| 5hkf-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) | 0.9221 | 3 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hkiC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9402 | 3 | 176 | 3.40.50.2020 |
| 5hkiC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9242 | 3 | 176 | 3.40.50.2020 |
| af_Q58509_1_175_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9098 | 1 | 176 | 3.40.50.2020 |
| af_Q58509_1_175_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8951 | 1 | 176 | 3.40.50.2020 |
| af_A0A1D6N1D3_3_204_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8688 | 3 | 175 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0AP62-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.995 | 3 | 182 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-A0A7W0H853-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9929 | 3 | 183 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-A0A7W1RC05-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9897 | 1 | 182 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-D3F3R8-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9881 | 3 | 183 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-A0A7V9M5M0-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9864 | 3 | 183 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar