F377587

General Info

Members Datasets Scaffolds Average Seq Length
271 179 542 238

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10070158|Ga0075433_100701582
Length 258
Sequence VRSTLQPQASWLVIVRSVVVTGGSRGLGLGIVRRLTDEGYRAVAVARQMNDQLASTIDKAEQLHPGSLSFVPFDLGNIEEIPELVKKLRKDFGPVYGLVNNAALGFDGALAIMHNSQIERLIRVNTLSPIVLTKYVVRHMMADGGGRVVNVASILGATGYSGLSVYGATKASMIGFTRSLAREVGRAGVNVNAIAPGFIDTDMTQSLTGERREQVVRRTALRRLPEVDDIAAAVAFLLGDGARNITGTVLTVDAGTTA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 2.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 0.37
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 5.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10070158 3300006852 Bacteria 3079
2 rootH2_10242313 3300003320 Bacteria 1942
3 Ga0058861_12062091 3300004800 Bacteria 1386
4 Ga0058862_12766757 3300004803 Unclassified 1157
5 Ga0058862_12843817 3300004803 Unclassified 1957
6 Ga0070658_10075814 3300005327 Bacteria 2759
7 Ga0070658_10154958 3300005327 Bacteria 1920
8 Ga0070676_10385438 3300005328 Bacteria 972
9 Ga0070683_100006584 3300005329 Bacteria 9757
10 Ga0070666_10101735 3300005335 Bacteria 1981
11 Ga0070680_100222246 3300005336 Bacteria 1594
12 Ga0070661_100099100 3300005344 Unclassified 2165
13 Ga0070669_100145427 3300005353 Bacteria 1831
14 Ga0070675_100194831 3300005354 Bacteria 1757
15 Ga0070675_100520581 3300005354 Bacteria 1073
16 Ga0070673_100010551 3300005364 Bacteria 6256
17 Ga0070659_100060812 3300005366 Bacteria 2984
18 Ga0070714_100133912 3300005435 Bacteria 2217
19 Ga0070710_10277862 3300005437 Bacteria 1085
20 Ga0070701_10023993 3300005438 Bacteria 2946
21 Ga0070711_100152645 3300005439 Bacteria 1743
22 Ga0070711_100752518 3300005439 Bacteria 824
23 Ga0070705_100220514 3300005440 Bacteria 1313
24 Ga0070694_100532718 3300005444 Bacteria 938
25 Ga0070708_100075001 3300005445 Bacteria 3052
26 Ga0070708_100624637 3300005445 Bacteria 1016
27 Ga0070681_10081994 3300005458 Bacteria 3181
28 Ga0070681_10105152 3300005458 Bacteria 2765
29 Ga0068867_100141042 3300005459 Bacteria 1884
30 Ga0070706_100142394 3300005467 Bacteria 2238
31 Ga0070707_100165894 3300005468 Bacteria 2152
32 Ga0070707_100241532 3300005468 Bacteria 1758
33 Ga0070698_100130554 3300005471 Bacteria 2468
34 Ga0070698_100173457 3300005471 Bacteria 2096
35 Ga0070699_100141140 3300005518 Bacteria 2127
36 Ga0070699_100517413 3300005518 Bacteria 1085
37 Ga0070699_100587784 3300005518 Bacteria 1015
38 Ga0070684_100019151 3300005535 Bacteria 5659
39 Ga0070697_100050521 3300005536 Bacteria 3375
40 Ga0070697_100168432 3300005536 Bacteria 1853
41 Ga0070697_100358089 3300005536 Unclassified 1261
42 Ga0068853_100233604 3300005539 Unclassified 1683
43 Ga0070695_100116410 3300005545 Bacteria 1822
44 Ga0070695_100216111 3300005545 Bacteria 1379
45 Ga0070695_100244294 3300005545 Bacteria 1304
46 Ga0070695_100322754 3300005545 Bacteria 1148
47 Ga0070696_100045617 3300005546 Bacteria 3037
48 Ga0070696_100080125 3300005546 Bacteria 2311
49 Ga0070704_100049682 3300005549 Bacteria 2944
50 Ga0068855_100057627 3300005563 Bacteria 4553
51 Ga0068857_100004506 3300005577 Bacteria 11778
52 Ga0068852_100504038 3300005616 Unclassified 1206
53 Ga0068859_100173265 3300005617 Bacteria 2239
54 Ga0068859_100427943 3300005617 Bacteria 1420
55 Ga0068859_101001327 3300005617 Bacteria 918
56 Ga0068864_100098114 3300005618 Bacteria 2594
57 Ga0068866_10019695 3300005718 Bacteria 3078
58 Ga0068861_100127968 3300005719 Bacteria 2058
59 Ga0068861_100245036 3300005719 Bacteria 1526
60 Ga0068858_100211207 3300005842 Bacteria 1837
61 Ga0068862_100230952 3300005844 Bacteria 1678
62 Ga0081455_10001735 3300005937 Bacteria 26344
63 Ga0070717_10559693 3300006028 Bacteria 1036
64 Ga0070715_10099000 3300006163 Bacteria 1356
65 Ga0070716_100022785 3300006173 Bacteria 3314
66 Ga0070716_100494465 3300006173 Bacteria 901
67 Ga0097621_100048314 3300006237 Bacteria 3452
68 Ga0068871_100410942 3300006358 Bacteria 1207
69 Ga0068871_100516431 3300006358 Bacteria 1078
70 Ga0075431_100031590 3300006847 Bacteria 5454
71 Ga0075431_100152421 3300006847 Bacteria 2380
72 Ga0075431_100742712 3300006847 Bacteria 957
73 Ga0075433_10061374 3300006852 Bacteria 3293
74 Ga0075433_10318894 3300006852 Bacteria 1375
75 Ga0075434_100017642 3300006871 Bacteria 6881
76 Ga0075434_100115102 3300006871 Bacteria 2702
77 Ga0075434_100124968 3300006871 Bacteria 2590
78 Ga0075434_100273620 3300006871 Bacteria 1708
79 Ga0075434_100277972 3300006871 Bacteria 1694
80 Ga0075434_100888624 3300006871 Bacteria 906
81 Ga0097620_100173250 3300006931 Bacteria 2239
82 Ga0097620_100427996 3300006931 Bacteria 1420
83 Ga0097620_101001312 3300006931 Bacteria 918
84 Ga0075435_100097669 3300007076 Bacteria 2431
85 Ga0099794_10050031 3300007265 Bacteria 2010
86 Ga0105245_10009818 3300009098 Bacteria 8341
87 Ga0114129_10002871 3300009147 Bacteria 24116
88 Ga0114129_10157055 3300009147 Bacteria 3109
89 Ga0114129_10255656 3300009147 Bacteria 2350
90 Ga0114129_10355521 3300009147 Bacteria 1939
91 Ga0105243_10001689 3300009148 Bacteria 19021
92 Ga0105242_10048160 3300009176 Bacteria 3463
93 Ga0105248_10037920 3300009177 Bacteria 5392
94 Ga0105248_10065148 3300009177 Bacteria 4091
95 Ga0105238_10006898 3300009551 Bacteria 11341
96 Ga0157372_10013947 3300013307 Bacteria 8587
97 Ga0157380_10050105 3300014326 Bacteria 3297
98 Ga0163161_10334544 3300017792 Bacteria 1200
99 Ga0197907_11255742 3300020069 Unclassified 1078
100 Ga0213876_10033356 3300021384 Bacteria 2715
101 Ga0213876_10043804 3300021384 Bacteria 2365
102 Ga0213876_10118711 3300021384 Bacteria 1404
103 Ga0213875_10000009 3300021388 Bacteria 451129
104 Ga0207692_10142593 3300025898 Bacteria 1364
105 Ga0207642_10018717 3300025899 Bacteria 2664
106 Ga0207699_10513707 3300025906 Bacteria 866
107 Ga0207705_10208318 3300025909 Bacteria 1483
108 Ga0207684_10051257 3300025910 Bacteria 3501
109 Ga0207684_10347214 3300025910 Bacteria 1277
110 Ga0207654_10135709 3300025911 Unclassified 1563
111 Ga0207707_10125289 3300025912 Bacteria 2247
112 Ga0207707_10271518 3300025912 Unclassified 1470
113 Ga0207707_10377763 3300025912 Bacteria 1218
114 Ga0207663_10399147 3300025916 Unclassified 1051
115 Ga0207663_10661054 3300025916 Bacteria 825
116 Ga0207660_10070746 3300025917 Bacteria 2537
117 Ga0207660_10444705 3300025917 Bacteria 1048
118 Ga0207652_10565724 3300025921 Bacteria 1021
119 Ga0207681_10116028 3300025923 Bacteria 1955
120 Ga0207659_10428353 3300025926 Bacteria 1111
121 Ga0207700_10636522 3300025928 Bacteria 950
122 Ga0207664_10053106 3300025929 Bacteria 3206
123 Ga0207664_10794884 3300025929 Bacteria 851
124 Ga0207690_10107295 3300025932 Bacteria 2005
125 Ga0207690_10635354 3300025932 Unclassified 874
126 Ga0207706_10117710 3300025933 Bacteria 2337
127 Ga0207670_10083826 3300025936 Unclassified 2237
128 Ga0207669_10607935 3300025937 Bacteria 889
129 Ga0207665_10027528 3300025939 Bacteria 3755
130 Ga0207665_10062449 3300025939 Bacteria 2527
131 Ga0207665_10193413 3300025939 Bacteria 1479
132 Ga0207711_10006692 3300025941 Bacteria 9700
133 Ga0207689_10445973 3300025942 Bacteria 1081
134 Ga0207661_10016511 3300025944 Bacteria 5448
135 Ga0207679_10094465 3300025945 Bacteria 2322
136 Ga0207667_10161784 3300025949 Bacteria 2302
137 Ga0207651_10003797 3300025960 Bacteria 7482
138 Ga0207712_10452880 3300025961 Bacteria 1089
139 Ga0207640_10055605 3300025981 Bacteria 2593
140 Ga0207648_10195721 3300026089 Bacteria 1792
141 Ga0207674_10000872 3300026116 Bacteria 39452
142 Ga0207675_100006544 3300026118 Bacteria 11026
143 Ga0209588_1029925 3300027671 Bacteria 1738
144 Ga0268265_10123549 3300028380 Bacteria 2137
145 Ga0265318_10005017 3300028577 Bacteria 6295
146 Ga0265338_10000014 3300028800 Bacteria 378751
147 Ga0265338_10005109 3300028800 Bacteria 17299
148 Ga0265763_1000322 3300030763 Bacteria 2714
149 Ga0265760_10016745 3300031090 Bacteria 2105
150 Ga0265330_10050514 3300031235 Bacteria 1824
151 Ga0265328_10111130 3300031239 Bacteria 1019
152 Ga0265320_10018955 3300031240 Bacteria 3774
153 Ga0265325_10000013 3300031241 Bacteria 142935
154 Ga0265325_10044868 3300031241 Bacteria 2299
155 Ga0265325_10075967 3300031241 Bacteria 1677
156 Ga0265329_10017077 3300031242 Bacteria 2504
157 Ga0265340_10008110 3300031247 Bacteria 5684
158 Ga0265340_10111330 3300031247 Bacteria 1266
159 Ga0265339_10000128 3300031249 Bacteria 62891
160 Ga0265339_10033825 3300031249 Bacteria 2875
161 Ga0265331_10014257 3300031250 Bacteria 4240
162 Ga0265316_10134247 3300031344 Bacteria 1862
163 Ga0265313_10000246 3300031595 Bacteria 58903
164 Ga0265313_10009059 3300031595 Bacteria 6516
165 Ga0265313_10014225 3300031595 Unclassified 4717
166 Ga0265342_10019845 3300031712 Unclassified 4324
167 Ga0265342_10049582 3300031712 Bacteria 2512
168 Ga0265342_10105386 3300031712 Bacteria 1601
169 Ga0373926_0091512 3300035083 Bacteria 1131
170 Ga0373945_0062634 3300035116 Bacteria 1391
171 Ga0373943_0100326 3300035170 Bacteria 1513
172 Ga0373927_0115207 3300035695 Bacteria 1752
173 Ga0373937_0157789 3300036401 Bacteria 2127
174 Ga0373937_0595147 3300036401 Bacteria 1050
175 Ga0436364_0074297 3300037853 Bacteria 14513
176 Ga0436364_0300612 3300037853 Bacteria 7667
177 Ga0436364_0589412 3300037853 Bacteria 1037
178 Ga0436364_0735881 3300037853 Bacteria 1382
179 Ga0436365_0349729 3300039437 Bacteria 6802
180 Ga0436365_1269982 3300039437 Bacteria 1332
181 Ga0436365_1604986 3300039437 Bacteria 13828
182 Ga0436365_1618573 3300039437 Bacteria 5295
183 Ga0436360_1308363 3300039438 Unclassified 1301
184 Ga0436361_0547486 3300039447 Bacteria 1739
185 Ga0436361_0878683 3300039447 Bacteria 2185
186 Ga0436363_0301743 3300039450 Bacteria 973
187 Ga0436362_1246314 3300039453 Bacteria 1383
188 Ga0466961_0068124 3300044693 Bacteria 2260
189 Ga0466957_0178728 3300044842 Bacteria 1385
190 Ga0451576_0672921 3300045051 Bacteria 1088
191 Ga0451576_1177215 3300045051 Bacteria 801
192 Ga0466958_0054379 3300045836 Bacteria 2428
193 Ga0495592_0112395 3300046454 Bacteria 1926
194 Ga0495629_0037828 3300046459 Bacteria 3401
195 Ga0495584_0058913 3300046491 Bacteria 1932
196 Ga0495608_0118139 3300046511 Bacteria 1701
197 Ga0495630_0463287 3300046517 Bacteria 971
198 Ga0495652_0337448 3300046529 Bacteria 1084
199 Ga0495634_0402576 3300046642 Bacteria 813
200 Ga0495659_0163852 3300046664 Bacteria 899
201 Ga0495647_0053166 3300046681 Bacteria 1579
202 Ga0495669_0028441 3300046684 Bacteria 2449
203 Ga0495684_0202501 3300047471 Bacteria 1463
204 Ga0496115_0028772 3300048918 Bacteria 4358
205 Ga0501031_0085332 3300049568 Bacteria 2058
206 Ga0501032_0065079 3300049569 Bacteria 2439
207 Ga0501034_0013937 3300049571 Bacteria 8276
208 Ga0501036_0097766 3300049572 Bacteria 2481
209 Ga0501036_0123519 3300049572 Bacteria 2186
210 Ga0501037_0107414 3300049573 Bacteria 2011
211 Ga0501038_0033900 3300049574 Bacteria 4492
212 Ga0501039_0008125 3300049575 Bacteria 7995
213 Ga0501039_0128238 3300049575 Bacteria 1990
214 Ga0501040_0035630 3300049576 Unclassified 3376
215 Ga0501041_0009954 3300049577 Bacteria 5601
216 Ga0501041_0138867 3300049577 Bacteria 1515
217 Ga0501042_0413776 3300049578 Bacteria 977
218 Ga0501043_0012261 3300049579 Bacteria 6701
219 Ga0501046_0013209 3300049580 Bacteria 7001
220 Ga0501046_0332985 3300049580 Bacteria 1104
221 Ga0501048_0012296 3300049582 Bacteria 6370
222 Ga0501048_0142304 3300049582 Bacteria 1696
223 Ga0501067_0021881 3300049583 Bacteria 3537
224 Ga0501068_0020280 3300049584 Bacteria 3870
225 Ga0501068_0037487 3300049584 Bacteria 2902
226 Ga0501069_0000562 3300049585 Bacteria 17112
227 Ga0501069_0158649 3300049585 Bacteria 1302
228 Ga0501070_0016868 3300049586 Bacteria 6128
229 Ga0501071_0337977 3300049587 Bacteria 1145
230 Ga0501072_0041830 3300049588 Bacteria 3599
231 Ga0501072_0054635 3300049588 Bacteria 3147
232 Ga0501072_0104059 3300049588 Bacteria 2257
233 Ga0501073_0002535 3300049589 Bacteria 13651
234 Ga0501074_0047025 3300049590 Bacteria 3119
235 Ga0501074_0259290 3300049590 Bacteria 1236
236 Ga0501074_0261062 3300049590 Bacteria 1231
237 Ga0501075_0043244 3300049591 Bacteria 3379
238 Ga0501075_0043910 3300049591 Bacteria 3352
239 Ga0501076_0062505 3300049592 Bacteria 2965
240 Ga0501076_0091064 3300049592 Bacteria 2453
241 Ga0501077_0012600 3300049593 Bacteria 5295
242 Ga0501077_0035585 3300049593 Bacteria 3170
243 Ga0501079_0012945 3300049741 Bacteria 6363
244 Ga0501079_0035915 3300049741 Bacteria 3816
245 Ga0501080_0012578 3300049742 Bacteria 7760
246 Ga0501080_0174426 3300049742 Bacteria 1981
247 Ga0501081_0002264 3300049743 Bacteria 12110
248 Ga0501081_0017622 3300049743 Bacteria 4732
249 Ga0501083_0007577 3300049744 Bacteria 7690
250 Ga0501035_0389383 3300049822 Bacteria 1161
251 Ga0501045_0016281 3300049824 Bacteria 5280
252 Ga0501045_0054134 3300049824 Bacteria 2933
253 nmdc:mga05p37_164834_c1 3300050507 Bacteria 2705
254 nmdc:mga05p37_23683_c1 3300050507 Bacteria 7454
255 nmdc:mga05p37_426396_c1 3300050507 Bacteria 1542
256 nmdc:mga05p37_485183_c1 3300050507 Bacteria 1422
257 nmdc:mga09592_408493_c1 3300050508 Bacteria 1173
258 nmdc:mga06r32_722786_c1 3300050510 Bacteria 960
259 nmdc:mga0n895_184384_c1 3300050512 Bacteria 2118
260 nmdc:mga0n895_227960_c1 3300050512 Bacteria 1891
261 nmdc:mga0n895_621529_c1 3300050512 Bacteria 1081
262 nmdc:mga0n895_839739_c1 3300050512 Bacteria 907
263 nmdc:mga0n895_92371_c1 3300050512 Bacteria 3029
264 nmdc:mga0rr50_106378_c1 3300050513 Bacteria 2213
265 nmdc:mga08x19_56694_c1 3300050514 Bacteria 2529
266 nmdc:mga0a205_82817_c1 3300050515 Bacteria 3099
267 Ga0500576_099236 3300053725 Bacteria 1192
268 Ga0501084_0008654 3300054114 Bacteria 8410
269 Ga0501084_0047123 3300054114 Bacteria 3610
270 Ga0501082_0036871 3300060353 Bacteria 4212
271 Ga0501082_0046982 3300060353 Bacteria 3720
272 Ga0075433_10070158
273 rootH2_10242313
274 Ga0058861_12062091
275 Ga0058862_12766757
276 Ga0058862_12843817
277 Ga0070658_10075814
278 Ga0070658_10154958
279 Ga0070676_10385438
280 Ga0070683_100006584
281 Ga0070666_10101735
282 Ga0070680_100222246
283 Ga0070661_100099100
284 Ga0070669_100145427
285 Ga0070675_100194831
286 Ga0070675_100520581
287 Ga0070673_100010551
288 Ga0070659_100060812
289 Ga0070714_100133912
290 Ga0070710_10277862
291 Ga0070701_10023993
292 Ga0070711_100152645
293 Ga0070711_100752518
294 Ga0070705_100220514
295 Ga0070694_100532718
296 Ga0070708_100075001
297 Ga0070708_100624637
298 Ga0070681_10081994
299 Ga0070681_10105152
300 Ga0068867_100141042
301 Ga0070706_100142394
302 Ga0070707_100165894
303 Ga0070707_100241532
304 Ga0070698_100130554
305 Ga0070698_100173457
306 Ga0070699_100141140
307 Ga0070699_100517413
308 Ga0070699_100587784
309 Ga0070684_100019151
310 Ga0070697_100050521
311 Ga0070697_100168432
312 Ga0070697_100358089
313 Ga0068853_100233604
314 Ga0070695_100116410
315 Ga0070695_100216111
316 Ga0070695_100244294
317 Ga0070695_100322754
318 Ga0070696_100045617
319 Ga0070696_100080125
320 Ga0070704_100049682
321 Ga0068855_100057627
322 Ga0068857_100004506
323 Ga0068852_100504038
324 Ga0068859_100173265
325 Ga0068859_100427943
326 Ga0068859_101001327
327 Ga0068864_100098114
328 Ga0068866_10019695
329 Ga0068861_100127968
330 Ga0068861_100245036
331 Ga0068858_100211207
332 Ga0068862_100230952
333 Ga0081455_10001735
334 Ga0070717_10559693
335 Ga0070715_10099000
336 Ga0070716_100022785
337 Ga0070716_100494465
338 Ga0097621_100048314
339 Ga0068871_100410942
340 Ga0068871_100516431
341 Ga0075431_100031590
342 Ga0075431_100152421
343 Ga0075431_100742712
344 Ga0075433_10061374
345 Ga0075433_10318894
346 Ga0075434_100017642
347 Ga0075434_100115102
348 Ga0075434_100124968
349 Ga0075434_100273620
350 Ga0075434_100277972
351 Ga0075434_100888624
352 Ga0097620_100173250
353 Ga0097620_100427996
354 Ga0097620_101001312
355 Ga0075435_100097669
356 Ga0099794_10050031
357 Ga0105245_10009818
358 Ga0114129_10002871
359 Ga0114129_10157055
360 Ga0114129_10255656
361 Ga0114129_10355521
362 Ga0105243_10001689
363 Ga0105242_10048160
364 Ga0105248_10037920
365 Ga0105248_10065148
366 Ga0105238_10006898
367 Ga0157372_10013947
368 Ga0157380_10050105
369 Ga0163161_10334544
370 Ga0197907_11255742
371 Ga0213876_10033356
372 Ga0213876_10043804
373 Ga0213876_10118711
374 Ga0213875_10000009
375 Ga0207692_10142593
376 Ga0207642_10018717
377 Ga0207699_10513707
378 Ga0207705_10208318
379 Ga0207684_10051257
380 Ga0207684_10347214
381 Ga0207654_10135709
382 Ga0207707_10125289
383 Ga0207707_10271518
384 Ga0207707_10377763
385 Ga0207663_10399147
386 Ga0207663_10661054
387 Ga0207660_10070746
388 Ga0207660_10444705
389 Ga0207652_10565724
390 Ga0207681_10116028
391 Ga0207659_10428353
392 Ga0207700_10636522
393 Ga0207664_10053106
394 Ga0207664_10794884
395 Ga0207690_10107295
396 Ga0207690_10635354
397 Ga0207706_10117710
398 Ga0207670_10083826
399 Ga0207669_10607935
400 Ga0207665_10027528
401 Ga0207665_10062449
402 Ga0207665_10193413
403 Ga0207711_10006692
404 Ga0207689_10445973
405 Ga0207661_10016511
406 Ga0207679_10094465
407 Ga0207667_10161784
408 Ga0207651_10003797
409 Ga0207712_10452880
410 Ga0207640_10055605
411 Ga0207648_10195721
412 Ga0207674_10000872
413 Ga0207675_100006544
414 Ga0209588_1029925
415 Ga0268265_10123549
416 Ga0265318_10005017
417 Ga0265338_10000014
418 Ga0265338_10005109
419 Ga0265763_1000322
420 Ga0265760_10016745
421 Ga0265330_10050514
422 Ga0265328_10111130
423 Ga0265320_10018955
424 Ga0265325_10000013
425 Ga0265325_10044868
426 Ga0265325_10075967
427 Ga0265329_10017077
428 Ga0265340_10008110
429 Ga0265340_10111330
430 Ga0265339_10000128
431 Ga0265339_10033825
432 Ga0265331_10014257
433 Ga0265316_10134247
434 Ga0265313_10000246
435 Ga0265313_10009059
436 Ga0265313_10014225
437 Ga0265342_10019845
438 Ga0265342_10049582
439 Ga0265342_10105386
440 Ga0373926_0091512
441 Ga0373945_0062634
442 Ga0373943_0100326
443 Ga0373927_0115207
444 Ga0373937_0157789
445 Ga0373937_0595147
446 Ga0436364_0074297
447 Ga0436364_0300612
448 Ga0436364_0589412
449 Ga0436364_0735881
450 Ga0436365_0349729
451 Ga0436365_1269982
452 Ga0436365_1604986
453 Ga0436365_1618573
454 Ga0436360_1308363
455 Ga0436361_0547486
456 Ga0436361_0878683
457 Ga0436363_0301743
458 Ga0436362_1246314
459 Ga0466961_0068124
460 Ga0466957_0178728
461 Ga0451576_0672921
462 Ga0451576_1177215
463 Ga0466958_0054379
464 Ga0495592_0112395
465 Ga0495629_0037828
466 Ga0495584_0058913
467 Ga0495608_0118139
468 Ga0495630_0463287
469 Ga0495652_0337448
470 Ga0495634_0402576
471 Ga0495659_0163852
472 Ga0495647_0053166
473 Ga0495669_0028441
474 Ga0495684_0202501
475 Ga0496115_0028772
476 Ga0501031_0085332
477 Ga0501032_0065079
478 Ga0501034_0013937
479 Ga0501036_0097766
480 Ga0501036_0123519
481 Ga0501037_0107414
482 Ga0501038_0033900
483 Ga0501039_0008125
484 Ga0501039_0128238
485 Ga0501040_0035630
486 Ga0501041_0009954
487 Ga0501041_0138867
488 Ga0501042_0413776
489 Ga0501043_0012261
490 Ga0501046_0013209
491 Ga0501046_0332985
492 Ga0501048_0012296
493 Ga0501048_0142304
494 Ga0501067_0021881
495 Ga0501068_0020280
496 Ga0501068_0037487
497 Ga0501069_0000562
498 Ga0501069_0158649
499 Ga0501070_0016868
500 Ga0501071_0337977
501 Ga0501072_0041830
502 Ga0501072_0054635
503 Ga0501072_0104059
504 Ga0501073_0002535
505 Ga0501074_0047025
506 Ga0501074_0259290
507 Ga0501074_0261062
508 Ga0501075_0043244
509 Ga0501075_0043910
510 Ga0501076_0062505
511 Ga0501076_0091064
512 Ga0501077_0012600
513 Ga0501077_0035585
514 Ga0501079_0012945
515 Ga0501079_0035915
516 Ga0501080_0012578
517 Ga0501080_0174426
518 Ga0501081_0002264
519 Ga0501081_0017622
520 Ga0501083_0007577
521 Ga0501035_0389383
522 Ga0501045_0016281
523 Ga0501045_0054134
524 nmdc:mga05p37_164834_c1
525 nmdc:mga05p37_23683_c1
526 nmdc:mga05p37_426396_c1
527 nmdc:mga05p37_485183_c1
528 nmdc:mga09592_408493_c1
529 nmdc:mga06r32_722786_c1
530 nmdc:mga0n895_184384_c1
531 nmdc:mga0n895_227960_c1
532 nmdc:mga0n895_621529_c1
533 nmdc:mga0n895_839739_c1
534 nmdc:mga0n895_92371_c1
535 nmdc:mga0rr50_106378_c1
536 nmdc:mga08x19_56694_c1
537 nmdc:mga0a205_82817_c1
538 Ga0500576_099236
539 Ga0501084_0008654
540 Ga0501084_0047123
541 Ga0501082_0036871
542 Ga0501082_0046982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

16

212

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

22

257

0.93

PF08659

KR

KR domain

17

201

0.82

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

18

252

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tii-assembly1.cif.gz_A comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis 0.9456 2 241
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9436 2 241
4ni5-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from brucella suis 0.9436 2 239
8jfg-assembly1.cif.gz_A crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori 0.9415 2 241
4jro-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.941 2 241
ID Description Score Start End Superfamily
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9374 2 239 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9372 78 241 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9364 1 241 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9319 2 244 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 2 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D5ZT66-F1-model_v4 3-oxoacyl-ACP reductase 0.9471 1 241 GO:0008202
GO:0016491
AF-X1DT56-F1-model_v4 Uncharacterized protein 0.9426 88 212 GO:0016491
AF-A0A1F9BHA4-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9424 1 244 GO:0016491
AF-A0A3S8V3A3-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9415 96 244 GO:0016491
AF-A0A2M7FZY1-F1-model_v4 3-oxoacyl-ACP reductase 0.9401 1 238 GO:0016491

Map