F377431

General Info

Members Datasets Scaffolds Average Seq Length
271 181 542 191

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100228284|Ga0070683_1002282842
Length 210
Sequence MSRPILQIVIGSTRPGRVGLPVAEWFDEAAVSHGGFDVEVVDLADVGLPFFDEPRHPRLGQYEHEHTRRWSAIVDRADAFVFVVPEYNHGFNAEIKNALDFLHSEWKYKPIGFVSYGGVSAGTRAVQMLKQVVVALKMVPVPESVNIPMVTQFLDAEERLHPNPIMEGAATAMLDELAVWTESLRSARSGSLAAGTEPQVAEPQHEHAAA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
80 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2643221679 Angustibacter sp. Root456 Isolate Unclassified
180 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
181 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 3.32
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 5.9
Rhizosphere 81.92
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100228284 3300005329 Bacteria 1770
2 Ga0068869_100151929 3300005334 Bacteria 1796
3 Ga0070666_10406933 3300005335 Bacteria 979
4 Ga0070680_100688023 3300005336 Bacteria 880
5 Ga0068868_100118197 3300005338 Bacteria 2160
6 Ga0070671_100426806 3300005355 Bacteria 1136
7 Ga0070688_100179983 3300005365 Bacteria 1466
8 Ga0070659_100103080 3300005366 Bacteria 2297
9 Ga0070709_10003449 3300005434 Bacteria 8482
10 Ga0070714_100027976 3300005435 Bacteria 4672
11 Ga0070714_100028443 3300005435 Bacteria 4638
12 Ga0070714_100050802 3300005435 Bacteria 3534
13 Ga0070710_10003904 3300005437 Bacteria 7061
14 Ga0070701_10138440 3300005438 Bacteria 1389
15 Ga0070700_100559883 3300005441 Bacteria 889
16 Ga0070684_100239347 3300005535 Bacteria 1658
17 Ga0070672_100125657 3300005543 Bacteria 2103
18 Ga0070693_100226992 3300005547 Bacteria 1226
19 Ga0070704_100664734 3300005549 Bacteria 921
20 Ga0068857_100497415 3300005577 Bacteria 1144
21 Ga0068856_100391499 3300005614 Bacteria 1409
22 Ga0070702_100030312 3300005615 Bacteria 2948
23 Ga0070702_100127784 3300005615 Bacteria 1601
24 Ga0068859_100725699 3300005617 Bacteria 1083
25 Ga0068864_100590424 3300005618 Bacteria 1077
26 Ga0068860_100078825 3300005843 Bacteria 3132
27 Ga0070717_10006159 3300006028 Bacteria 8808
28 Ga0070717_10065864 3300006028 Bacteria 3012
29 Ga0070717_10101474 3300006028 Bacteria 2444
30 Ga0075365_10001838 3300006038 Bacteria 9948
31 Ga0075432_10048898 3300006058 Bacteria 1489
32 Ga0070715_10045205 3300006163 Bacteria 1866
33 Ga0070715_10203317 3300006163 Bacteria 1008
34 Ga0070716_100026134 3300006173 Bacteria 3123
35 Ga0070712_100023726 3300006175 Bacteria 4056
36 Ga0070712_100241746 3300006175 Bacteria 1438
37 Ga0068871_100747301 3300006358 Bacteria 899
38 Ga0075434_100525441 3300006871 Bacteria 1204
39 Ga0075434_100561593 3300006871 Bacteria 1161
40 Ga0075436_100290240 3300006914 Bacteria 1171
41 Ga0097620_100725719 3300006931 Bacteria 1083
42 Ga0075435_100306390 3300007076 Bacteria 1359
43 Ga0105245_10033832 3300009098 Bacteria 4530
44 Ga0105243_10064521 3300009148 Bacteria 2939
45 Ga0105241_10222779 3300009174 Bacteria 1586
46 Ga0105241_10740234 3300009174 Bacteria 901
47 Ga0163163_10379851 3300014325 Bacteria 1470
48 Ga0163163_11061757 3300014325 Bacteria 873
49 Ga0157377_10113609 3300014745 Bacteria 1631
50 Ga0163161_10936900 3300017792 Bacteria 736
51 Ga0197907_10255528 3300020069 Bacteria 1662
52 Ga0206351_10025852 3300020077 Bacteria 717
53 Ga0206352_11115586 3300020078 Bacteria 626
54 Ga0206354_11065542 3300020081 Bacteria 1152
55 Ga0206354_11449944 3300020081 Bacteria 677
56 Ga0206353_10540370 3300020082 Bacteria 2406
57 Ga0213873_10144781 3300021358 Bacteria 712
58 Ga0213874_10000486 3300021377 Bacteria 7971
59 Ga0213874_10040124 3300021377 Bacteria 1396
60 Ga0213876_10007433 3300021384 Bacteria 5958
61 Ga0213876_10010957 3300021384 Bacteria 4857
62 Ga0213876_10011180 3300021384 Bacteria 4798
63 Ga0213875_10002611 3300021388 Bacteria 10695
64 Ga0213875_10006507 3300021388 Bacteria 6119
65 Ga0224712_10076226 3300022467 Bacteria 1373
66 Ga0224712_10286920 3300022467 Bacteria 767
67 Ga0224712_10358201 3300022467 Bacteria 690
68 Ga0207692_10080230 3300025898 Bacteria 1743
69 Ga0207692_10095215 3300025898 Bacteria 1623
70 Ga0207692_10200753 3300025898 Bacteria 1172
71 Ga0207685_10214515 3300025905 Bacteria 912
72 Ga0207699_10004808 3300025906 Bacteria 6465
73 Ga0207643_10014248 3300025908 Bacteria 4317
74 Ga0207707_10579553 3300025912 Bacteria 951
75 Ga0207693_10003477 3300025915 Bacteria 13437
76 Ga0207693_10042313 3300025915 Bacteria 3586
77 Ga0207663_10097606 3300025916 Bacteria 1965
78 Ga0207663_10234586 3300025916 Bacteria 1342
79 Ga0207662_10071105 3300025918 Bacteria 2106
80 Ga0207687_10093231 3300025927 Bacteria 2201
81 Ga0207700_10092415 3300025928 Bacteria 2392
82 Ga0207700_10118435 3300025928 Bacteria 2143
83 Ga0207664_10001774 3300025929 Bacteria 14205
84 Ga0207664_10048972 3300025929 Bacteria 3325
85 Ga0207664_10067582 3300025929 Bacteria 2869
86 Ga0207664_10162099 3300025929 Bacteria 1908
87 Ga0207664_10174217 3300025929 Bacteria 1843
88 Ga0207664_10643525 3300025929 Bacteria 953
89 Ga0207664_10709421 3300025929 Bacteria 904
90 Ga0207670_10044255 3300025936 Bacteria 2945
91 Ga0207669_10118866 3300025937 Bacteria 1789
92 Ga0207665_10008446 3300025939 Bacteria 6788
93 Ga0207691_10127004 3300025940 Bacteria 2256
94 Ga0207711_10601943 3300025941 Bacteria 1025
95 Ga0207689_10024505 3300025942 Bacteria 5063
96 Ga0207661_10264301 3300025944 Bacteria 1534
97 Ga0207661_10305973 3300025944 Bacteria 1426
98 Ga0207679_11338375 3300025945 Bacteria 657
99 Ga0207677_10130765 3300026023 Bacteria 1905
100 Ga0207703_10021184 3300026035 Bacteria 5088
101 Ga0207678_10115978 3300026067 Bacteria 2285
102 Ga0207676_10121628 3300026095 Bacteria 2203
103 Ga0207674_10096246 3300026116 Bacteria 2945
104 Ga0207675_100869905 3300026118 Bacteria 917
105 Ga0268264_10954696 3300028381 Bacteria 863
106 Ga0265339_10153053 3300031249 Bacteria 1165
107 Ga0307513_10000327 3300031456 Bacteria 68563
108 Ga0316575_10267855 3300031665 Unclassified 719
109 Ga0307507_10352853 3300033179 Bacteria 863
110 Ga0373926_0000542 3300035083 Bacteria 10118
111 Ga0373934_0035670 3300035086 Bacteria 1957
112 Ga0373944_0002732 3300035089 Bacteria 4507
113 Ga0373923_0131041 3300035111 Bacteria 1127
114 Ga0373954_0015062 3300035118 Bacteria 3454
115 Ga0373957_0041256 3300035120 Bacteria 1737
116 Ga0373943_0003812 3300035170 Bacteria 6849
117 Ga0373946_0000499 3300035171 Bacteria 13027
118 Ga0373955_0010223 3300035172 Bacteria 4425
119 Ga0373955_0035642 3300035172 Bacteria 2636
120 Ga0373935_0004094 3300035692 Bacteria 8527
121 Ga0373927_0003623 3300035695 Bacteria 11017
122 Ga0373933_0039759 3300035724 Bacteria 2768
123 Ga0373933_0158469 3300035724 Bacteria 1436
124 Ga0373947_0002850 3300035725 Bacteria 10323
125 Ga0373947_0187024 3300035725 Bacteria 1350
126 Ga0373947_0605699 3300035725 Bacteria 747
127 Ga0373937_0008860 3300036401 Bacteria 8732
128 Ga0316584_0006823 3300036712 Bacteria 7753
129 Ga0373925_0002212 3300037068 Bacteria 15792
130 Ga0395899_0267857 3300037312 Bacteria 1166
131 Ga0395900_0098025 3300037418 Bacteria 3012
132 Ga0395898_0022070 3300037466 Bacteria 6449
133 Ga0436364_0018060 3300037853 Bacteria 23017
134 Ga0436364_0382656 3300037853 Bacteria 2539
135 Ga0436364_0874499 3300037853 Bacteria 22688
136 Ga0436364_0941438 3300037853 Bacteria 2363
137 Ga0436364_1121669 3300037853 Bacteria 7477
138 Ga0395901_0138056 3300038443 Bacteria 2562
139 Ga0436365_0070968 3300039437 Bacteria 9248
140 Ga0436365_0716016 3300039437 Bacteria 2839
141 Ga0436365_0952433 3300039437 Bacteria 8540
142 Ga0436365_1771274 3300039437 Bacteria 19200
143 Ga0436363_0347483 3300039450 Bacteria 907
144 Ga0436363_0776095 3300039450 Bacteria 1749
145 Ga0436363_1377217 3300039450 Bacteria 23253
146 Ga0436363_1648862 3300039450 Bacteria 11656
147 Ga0436362_0372985 3300039453 Bacteria 742
148 Ga0451797_1197572 3300041453 Bacteria 1063
149 Ga0451853_2116992 3300041512 Bacteria 1038
150 Ga0451853_3396868 3300041512 Bacteria 1543
151 Ga0466961_0034347 3300044693 Bacteria 3255
152 Ga0466961_0131759 3300044693 Bacteria 1567
153 Ga0466961_0381132 3300044693 Bacteria 857
154 Ga0466961_0548313 3300044693 Bacteria 696
155 Ga0466963_0080346 3300044694 Bacteria 2207
156 Ga0466971_0050833 3300044719 Bacteria 1865
157 Ga0466959_0323567 3300045049 Bacteria 1054
158 Ga0466959_0330978 3300045049 Bacteria 1040
159 Ga0466967_0027594 3300045976 Bacteria 4725
160 Ga0466967_0090046 3300045976 Bacteria 2787
161 Ga0466967_0265716 3300045976 Bacteria 1642
162 Ga0466967_1558458 3300045976 Bacteria 658
163 Ga0495629_0167247 3300046459 Bacteria 1527
164 Ga0495638_0397316 3300046460 Bacteria 716
165 Ga0495641_0007635 3300046461 Bacteria 6722
166 Ga0495641_0217318 3300046461 Bacteria 857
167 Ga0495651_0003534 3300046462 Bacteria 11980
168 Ga0495651_0124669 3300046462 Bacteria 1887
169 Ga0495653_0012761 3300046463 Bacteria 6861
170 Ga0495653_0160618 3300046463 Bacteria 1560
171 Ga0495582_0036520 3300046473 Bacteria 2703
172 Ga0495582_0187927 3300046473 Bacteria 1178
173 Ga0495639_0486006 3300046475 Bacteria 629
174 Ga0495662_0013473 3300046476 Bacteria 3980
175 Ga0495664_0000347 3300046477 Bacteria 22480
176 Ga0495608_0005454 3300046511 Bacteria 9096
177 Ga0495608_0015665 3300046511 Bacteria 5250
178 Ga0495608_0063919 3300046511 Bacteria 2413
179 Ga0495618_0005855 3300046514 Bacteria 7472
180 Ga0495618_0007002 3300046514 Bacteria 6833
181 Ga0495628_0002403 3300046516 Bacteria 16879
182 Ga0495628_0046672 3300046516 Bacteria 3440
183 Ga0495628_0389075 3300046516 Bacteria 1020
184 Ga0495630_0172609 3300046517 Bacteria 1647
185 Ga0495652_0008487 3300046529 Bacteria 9371
186 Ga0495652_0010122 3300046529 Bacteria 8552
187 Ga0495665_0001070 3300046531 Bacteria 14523
188 Ga0495640_0023270 3300046533 Bacteria 4518
189 Ga0495587_0016871 3300046536 Bacteria 4541
190 Ga0495587_0129496 3300046536 Bacteria 1443
191 Ga0495645_0178236 3300046543 Bacteria 1458
192 Ga0495667_0001557 3300046559 Bacteria 15226
193 Ga0495667_0026872 3300046559 Bacteria 3878
194 Ga0495667_0188433 3300046559 Bacteria 1322
195 Ga0495634_0017403 3300046642 Bacteria 5127
196 Ga0495634_0338782 3300046642 Bacteria 902
197 Ga0495635_0000164 3300046663 Bacteria 41167
198 Ga0495635_0031380 3300046663 Bacteria 3689
199 Ga0495635_0092743 3300046663 Bacteria 2065
200 Ga0495657_0003872 3300046675 Bacteria 12058
201 Ga0495657_0022376 3300046675 Bacteria 4529
202 Ga0495657_0023659 3300046675 Bacteria 4387
203 Ga0495599_0026489 3300046678 Bacteria 3634
204 Ga0495646_0010948 3300046680 Bacteria 5760
205 Ga0495646_0081526 3300046680 Bacteria 1885
206 Ga0495647_0006742 3300046681 Bacteria 3823
207 Ga0495624_0005027 3300046690 Bacteria 9572
208 Ga0495600_0061324 3300046809 Bacteria 2456
209 Ga0495600_0112133 3300046809 Bacteria 1776
210 Ga0495600_0152722 3300046809 Bacteria 1494
211 Ga0495600_0311733 3300046809 Bacteria 991
212 Ga0495581_0217354 3300047315 Bacteria 1117
213 Ga0495604_0009388 3300047317 Bacteria 7738
214 Ga0495604_0127266 3300047317 Bacteria 1835
215 Ga0495604_0199809 3300047317 Unclassified 1388
216 Ga0495674_0002239 3300047319 Bacteria 19014
217 Ga0495674_0117460 3300047319 Bacteria 2250
218 Ga0495674_1039468 3300047319 Bacteria 626
219 Ga0495676_0018317 3300047321 Bacteria 6174
220 Ga0495680_0004831 3300047322 Bacteria 12790
221 Ga0495680_0048456 3300047322 Bacteria 3336
222 Ga0495675_0010649 3300047444 Bacteria 5751
223 Ga0495684_0012271 3300047471 Bacteria 6610
224 Ga0495684_0012609 3300047471 Bacteria 6521
225 Ga0495684_0036673 3300047471 Bacteria 3758
226 Ga0495686_0125686 3300047472 Bacteria 1525
227 Ga0495593_0192377 3300047673 Bacteria 1026
228 Ga0495602_0010808 3300048088 Bacteria 9459
229 Ga0495602_0012977 3300048088 Bacteria 8527
230 Ga0495602_0161807 3300048088 Bacteria 1747
231 Ga0495614_0112750 3300048089 Bacteria 1195
232 Ga0496100_0109092 3300048903 Bacteria 1920
233 Ga0496100_0605842 3300048903 Bacteria 851
234 Ga0496101_0345260 3300048904 Bacteria 1169
235 Ga0496102_0409218 3300048905 Bacteria 1274
236 Ga0496104_0048226 3300048907 Bacteria 4016
237 Ga0496104_1195859 3300048907 Bacteria 663
238 Ga0496105_0040537 3300048908 Bacteria 3840
239 Ga0496105_0349989 3300048908 Bacteria 1180
240 Ga0496108_0493717 3300048911 Bacteria 1069
241 Ga0496111_0101916 3300048914 Bacteria 2110
242 Ga0496112_0102470 3300048915 Bacteria 2832
243 Ga0496112_0251567 3300048915 Bacteria 1718
244 Ga0496113_0040798 3300048916 Bacteria 3422
245 Ga0496113_0692478 3300048916 Bacteria 814
246 Ga0496114_0387333 3300048917 Bacteria 1238
247 Ga0496121_0377051 3300048924 Bacteria 937
248 Ga0501033_0012339 3300049570 Bacteria 6521
249 Ga0501034_0147436 3300049571 Bacteria 2330
250 Ga0501042_0053132 3300049578 Bacteria 2890
251 Ga0501047_0142316 3300049581 Bacteria 2276
252 Ga0501048_0645650 3300049582 Unclassified 760
253 Ga0501080_0784360 3300049742 Bacteria 837
254 nmdc:mga00v17_647216_c1 3300050491 Bacteria 680
255 nmdc:mga0yw44_3727_c1 3300050492 Bacteria 6825
256 nmdc:mga08y16_271125_c1 3300050511 Bacteria 1752
257 nmdc:mga0n895_1146826_c1 3300050512 Bacteria 753
258 nmdc:mga0a205_497401_c1 3300050515 Bacteria 1076
259 Ga0495601_0000251 3300053077 Bacteria 28662
260 Ga0495601_0057852 3300053077 Bacteria 2456
261 Ga0495612_0013071 3300053078 Bacteria 3344
262 Ga0495595_0004446 3300053084 Bacteria 5642
263 Ga0495595_0213601 3300053084 Bacteria 962
264 Ga0495619_0006974 3300053085 Bacteria 7150
265 Ga0495619_0075755 3300053085 Bacteria 2258
266 Ga0500604_0038485 3300053151 Bacteria 1435
267 Ga0500616_0008106 3300053153 Bacteria 6569
268 Ga0466962_0207964 3300061719 Bacteria 957
269 2644444249 2643221679 Bacteria 3839507
270 2902843433 2902837492 Bacteria 6697721
271 8047713729 8047710418 Bacteria 11023148
272 Ga0070683_100228284
273 Ga0068869_100151929
274 Ga0070666_10406933
275 Ga0070680_100688023
276 Ga0068868_100118197
277 Ga0070671_100426806
278 Ga0070688_100179983
279 Ga0070659_100103080
280 Ga0070709_10003449
281 Ga0070714_100027976
282 Ga0070714_100028443
283 Ga0070714_100050802
284 Ga0070710_10003904
285 Ga0070701_10138440
286 Ga0070700_100559883
287 Ga0070684_100239347
288 Ga0070672_100125657
289 Ga0070693_100226992
290 Ga0070704_100664734
291 Ga0068857_100497415
292 Ga0068856_100391499
293 Ga0070702_100030312
294 Ga0070702_100127784
295 Ga0068859_100725699
296 Ga0068864_100590424
297 Ga0068860_100078825
298 Ga0070717_10006159
299 Ga0070717_10065864
300 Ga0070717_10101474
301 Ga0075365_10001838
302 Ga0075432_10048898
303 Ga0070715_10045205
304 Ga0070715_10203317
305 Ga0070716_100026134
306 Ga0070712_100023726
307 Ga0070712_100241746
308 Ga0068871_100747301
309 Ga0075434_100525441
310 Ga0075434_100561593
311 Ga0075436_100290240
312 Ga0097620_100725719
313 Ga0075435_100306390
314 Ga0105245_10033832
315 Ga0105243_10064521
316 Ga0105241_10222779
317 Ga0105241_10740234
318 Ga0163163_10379851
319 Ga0163163_11061757
320 Ga0157377_10113609
321 Ga0163161_10936900
322 Ga0197907_10255528
323 Ga0206351_10025852
324 Ga0206352_11115586
325 Ga0206354_11065542
326 Ga0206354_11449944
327 Ga0206353_10540370
328 Ga0213873_10144781
329 Ga0213874_10000486
330 Ga0213874_10040124
331 Ga0213876_10007433
332 Ga0213876_10010957
333 Ga0213876_10011180
334 Ga0213875_10002611
335 Ga0213875_10006507
336 Ga0224712_10076226
337 Ga0224712_10286920
338 Ga0224712_10358201
339 Ga0207692_10080230
340 Ga0207692_10095215
341 Ga0207692_10200753
342 Ga0207685_10214515
343 Ga0207699_10004808
344 Ga0207643_10014248
345 Ga0207707_10579553
346 Ga0207693_10003477
347 Ga0207693_10042313
348 Ga0207663_10097606
349 Ga0207663_10234586
350 Ga0207662_10071105
351 Ga0207687_10093231
352 Ga0207700_10092415
353 Ga0207700_10118435
354 Ga0207664_10001774
355 Ga0207664_10048972
356 Ga0207664_10067582
357 Ga0207664_10162099
358 Ga0207664_10174217
359 Ga0207664_10643525
360 Ga0207664_10709421
361 Ga0207670_10044255
362 Ga0207669_10118866
363 Ga0207665_10008446
364 Ga0207691_10127004
365 Ga0207711_10601943
366 Ga0207689_10024505
367 Ga0207661_10264301
368 Ga0207661_10305973
369 Ga0207679_11338375
370 Ga0207677_10130765
371 Ga0207703_10021184
372 Ga0207678_10115978
373 Ga0207676_10121628
374 Ga0207674_10096246
375 Ga0207675_100869905
376 Ga0268264_10954696
377 Ga0265339_10153053
378 Ga0307513_10000327
379 Ga0316575_10267855
380 Ga0307507_10352853
381 Ga0373926_0000542
382 Ga0373934_0035670
383 Ga0373944_0002732
384 Ga0373923_0131041
385 Ga0373954_0015062
386 Ga0373957_0041256
387 Ga0373943_0003812
388 Ga0373946_0000499
389 Ga0373955_0010223
390 Ga0373955_0035642
391 Ga0373935_0004094
392 Ga0373927_0003623
393 Ga0373933_0039759
394 Ga0373933_0158469
395 Ga0373947_0002850
396 Ga0373947_0187024
397 Ga0373947_0605699
398 Ga0373937_0008860
399 Ga0316584_0006823
400 Ga0373925_0002212
401 Ga0395899_0267857
402 Ga0395900_0098025
403 Ga0395898_0022070
404 Ga0436364_0018060
405 Ga0436364_0382656
406 Ga0436364_0874499
407 Ga0436364_0941438
408 Ga0436364_1121669
409 Ga0395901_0138056
410 Ga0436365_0070968
411 Ga0436365_0716016
412 Ga0436365_0952433
413 Ga0436365_1771274
414 Ga0436363_0347483
415 Ga0436363_0776095
416 Ga0436363_1377217
417 Ga0436363_1648862
418 Ga0436362_0372985
419 Ga0451797_1197572
420 Ga0451853_2116992
421 Ga0451853_3396868
422 Ga0466961_0034347
423 Ga0466961_0131759
424 Ga0466961_0381132
425 Ga0466961_0548313
426 Ga0466963_0080346
427 Ga0466971_0050833
428 Ga0466959_0323567
429 Ga0466959_0330978
430 Ga0466967_0027594
431 Ga0466967_0090046
432 Ga0466967_0265716
433 Ga0466967_1558458
434 Ga0495629_0167247
435 Ga0495638_0397316
436 Ga0495641_0007635
437 Ga0495641_0217318
438 Ga0495651_0003534
439 Ga0495651_0124669
440 Ga0495653_0012761
441 Ga0495653_0160618
442 Ga0495582_0036520
443 Ga0495582_0187927
444 Ga0495639_0486006
445 Ga0495662_0013473
446 Ga0495664_0000347
447 Ga0495608_0005454
448 Ga0495608_0015665
449 Ga0495608_0063919
450 Ga0495618_0005855
451 Ga0495618_0007002
452 Ga0495628_0002403
453 Ga0495628_0046672
454 Ga0495628_0389075
455 Ga0495630_0172609
456 Ga0495652_0008487
457 Ga0495652_0010122
458 Ga0495665_0001070
459 Ga0495640_0023270
460 Ga0495587_0016871
461 Ga0495587_0129496
462 Ga0495645_0178236
463 Ga0495667_0001557
464 Ga0495667_0026872
465 Ga0495667_0188433
466 Ga0495634_0017403
467 Ga0495634_0338782
468 Ga0495635_0000164
469 Ga0495635_0031380
470 Ga0495635_0092743
471 Ga0495657_0003872
472 Ga0495657_0022376
473 Ga0495657_0023659
474 Ga0495599_0026489
475 Ga0495646_0010948
476 Ga0495646_0081526
477 Ga0495647_0006742
478 Ga0495624_0005027
479 Ga0495600_0061324
480 Ga0495600_0112133
481 Ga0495600_0152722
482 Ga0495600_0311733
483 Ga0495581_0217354
484 Ga0495604_0009388
485 Ga0495604_0127266
486 Ga0495604_0199809
487 Ga0495674_0002239
488 Ga0495674_0117460
489 Ga0495674_1039468
490 Ga0495676_0018317
491 Ga0495680_0004831
492 Ga0495680_0048456
493 Ga0495675_0010649
494 Ga0495684_0012271
495 Ga0495684_0012609
496 Ga0495684_0036673
497 Ga0495686_0125686
498 Ga0495593_0192377
499 Ga0495602_0010808
500 Ga0495602_0012977
501 Ga0495602_0161807
502 Ga0495614_0112750
503 Ga0496100_0109092
504 Ga0496100_0605842
505 Ga0496101_0345260
506 Ga0496102_0409218
507 Ga0496104_0048226
508 Ga0496104_1195859
509 Ga0496105_0040537
510 Ga0496105_0349989
511 Ga0496108_0493717
512 Ga0496111_0101916
513 Ga0496112_0102470
514 Ga0496112_0251567
515 Ga0496113_0040798
516 Ga0496113_0692478
517 Ga0496114_0387333
518 Ga0496121_0377051
519 Ga0501033_0012339
520 Ga0501034_0147436
521 Ga0501042_0053132
522 Ga0501047_0142316
523 Ga0501048_0645650
524 Ga0501080_0784360
525 nmdc:mga00v17_647216_c1
526 nmdc:mga0yw44_3727_c1
527 nmdc:mga08y16_271125_c1
528 nmdc:mga0n895_1146826_c1
529 nmdc:mga0a205_497401_c1
530 Ga0495601_0000251
531 Ga0495601_0057852
532 Ga0495612_0013071
533 Ga0495595_0004446
534 Ga0495595_0213601
535 Ga0495619_0006974
536 Ga0495619_0075755
537 Ga0500604_0038485
538 Ga0500616_0008106
539 Ga0466962_0207964
540 2644444249
541 2902843433
542 8047713729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

5

152

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bx9-assembly1.cif.gz_A purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis 0.8609 6 180
2q62-assembly1.cif.gz_D crystal structure of arsh from sinorhizobium meliloti 0.8597 1 190
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.857 7 183
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8528 7 183
3gfs-assembly1.cif.gz_A structure of yhda, k109d/d137k variant 0.851 7 182
ID Description Score Start End Superfamily
af_Q54QT4_9_187_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8402 6 178 3.40.50.360
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8384 6 168 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8372 5 185 3.40.50.360
af_Q2G0L7_1_184_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8367 5 182 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8361 8 183 3.40.50.360
ID Description Score Start End GO Terms
AF-T1C2U2-F1-model_v4 Glycerol-3-phosphate dehydrogenase (NAD(P)(+)) 0.9956 7 150 GO:0005829
GO:0010181
GO:0016491
AF-A0A4Q3VYL5-F1-model_v4 NADPH-dependent oxidoreductase 0.9944 41 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A5N6C5U6-F1-model_v4 NADPH-dependent FMN reductase 0.9943 1 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A1L7FAK4-F1-model_v4 deleted 0.9908 3 189
AF-J2J4H9-F1-model_v4 NADPH-dependent FMN reductase family protein 0.9906 39 188 GO:0005829
GO:0010181
GO:0016491

Map