F377132

General Info

Members Datasets Scaffolds Average Seq Length
270 171 540 126

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_1128556|Ga0453683_1128556_81_497
Length 138
Sequence LVRATRKETGRMKIKEIGFVAIPVTDIRRARMFYEGGLGLQVSAEMMGGKWIEYTVGDNTLAIANVGEEWKPSDQGTSAALEVENFDEAVSQLRNQGVRFAAEPFETPCCNMAVVQDPDGNKLIIHKLKPENEKGVCK

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
140 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 2.96
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 35.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_1128556 3300044673 Unclassified 523
2 SwRhRL2b_contig_3177080 2162886007 Bacteria 1519
3 JGI24746J21847_1060152 3300001977 Unclassified 543
4 JGI24744J21845_10029097 3300002077 Bacteria 1062
5 JGI24035J26624_1010529 3300002126 Unclassified 920
6 JGI24035J26624_1018764 3300002126 Unclassified 722
7 Ga0065714_10390771 3300005288 Unclassified 598
8 Ga0065704_10035100 3300005289 Viruses 1236
9 Ga0065704_10101808 3300005289 Bacteria 2225
10 Ga0065704_10320824 3300005289 Unclassified 853
11 Ga0065712_10009919 3300005290 Bacteria 3121
12 Ga0065715_10027319 3300005293 Bacteria 2161
13 Ga0065707_10024306 3300005295 Bacteria 1428
14 Ga0070658_10667428 3300005327 Bacteria 902
15 Ga0070676_10085780 3300005328 Bacteria 1919
16 Ga0070690_100385717 3300005330 Bacteria 1025
17 Ga0070670_100085019 3300005331 Bacteria 2718
18 Ga0068869_100160692 3300005334 Bacteria 1749
19 Ga0070666_10007841 3300005335 Bacteria 6595
20 Ga0070666_10619946 3300005335 Bacteria 790
21 Ga0068868_100132316 3300005338 Bacteria 2042
22 Ga0068868_100230743 3300005338 Unclassified 1553
23 Ga0070689_100501775 3300005340 Bacteria 1040
24 Ga0070689_101700556 3300005340 Unclassified 574
25 Ga0070687_100243816 3300005343 Unclassified 1113
26 Ga0070668_100159866 3300005347 Bacteria 1827
27 Ga0070668_100234325 3300005347 Bacteria 1519
28 Ga0070668_100464292 3300005347 Bacteria 1091
29 Ga0070668_100498503 3300005347 Bacteria 1054
30 Ga0070669_100070552 3300005353 Bacteria 2583
31 Ga0070669_100071535 3300005353 Bacteria 2566
32 Ga0070669_100097198 3300005353 Bacteria 2216
33 Ga0070675_100180201 3300005354 Bacteria 1826
34 Ga0070675_100318527 3300005354 Unclassified 1373
35 Ga0070675_100605419 3300005354 Bacteria 994
36 Ga0070671_100014619 3300005355 Bacteria 6346
37 Ga0070671_101325950 3300005355 Unclassified 635
38 Ga0070674_100012161 3300005356 Bacteria 5277
39 Ga0070673_100035044 3300005364 Bacteria 3803
40 Ga0070688_100349034 3300005365 Bacteria 1083
41 Ga0070688_101179810 3300005365 Unclassified 614
42 Ga0070659_100523348 3300005366 Bacteria 1013
43 Ga0070667_100002725 3300005367 Bacteria 15294
44 Ga0070667_100434281 3300005367 Bacteria 1198
45 Ga0070667_100543418 3300005367 Unclassified 1067
46 Ga0070667_100608677 3300005367 Bacteria 1007
47 Ga0070709_10592265 3300005434 Bacteria 853
48 Ga0070705_100233236 3300005440 Bacteria 1282
49 Ga0070705_101852074 3300005440 Unclassified 513
50 Ga0070694_101829874 3300005444 Unclassified 518
51 Ga0070708_100234078 3300005445 Bacteria 1724
52 Ga0070708_100547856 3300005445 Bacteria 1091
53 Ga0070708_100835529 3300005445 Unclassified 865
54 Ga0070678_100073268 3300005456 Bacteria 2570
55 Ga0070662_100089919 3300005457 Bacteria 2303
56 Ga0070662_100113933 3300005457 Bacteria 2064
57 Ga0070685_10650845 3300005466 Bacteria 763
58 Ga0070706_100005395 3300005467 Bacteria 12181
59 Ga0070706_100398754 3300005467 Bacteria 1281
60 Ga0070707_100081378 3300005468 Bacteria 3127
61 Ga0070707_100097425 3300005468 Bacteria 2849
62 Ga0070707_100161310 3300005468 Bacteria 2185
63 Ga0070707_100474012 3300005468 Bacteria 1213
64 Ga0070707_100718887 3300005468 Unclassified 962
65 Ga0070698_100953954 3300005471 Unclassified 804
66 Ga0070699_100153883 3300005518 Bacteria 2035
67 Ga0070699_100292675 3300005518 Bacteria 1460
68 Ga0070684_100549184 3300005535 Bacteria 1072
69 Ga0070697_100041633 3300005536 Bacteria 3719
70 Ga0070697_100050643 3300005536 Bacteria 3372
71 Ga0070695_100584324 3300005545 Unclassified 875
72 Ga0070696_101125350 3300005546 Bacteria 661
73 Ga0070665_100015437 3300005548 Bacteria 7670
74 Ga0070665_101735766 3300005548 Unclassified 631
75 Ga0070704_100244726 3300005549 Bacteria 1470
76 Ga0070704_101184119 3300005549 Unclassified 696
77 Ga0068855_100019891 3300005563 Bacteria 8063
78 Ga0068855_100767346 3300005563 Bacteria 1027
79 Ga0070664_101045967 3300005564 Unclassified 768
80 Ga0068864_101207509 3300005618 Unclassified 755
81 Ga0068866_10339067 3300005718 Bacteria 951
82 Ga0068866_11216124 3300005718 Unclassified 544
83 Ga0068861_101786430 3300005719 Unclassified 610
84 Ga0068861_101950065 3300005719 Bacteria 585
85 Ga0068863_100938267 3300005841 Unclassified 867
86 Ga0068858_100150457 3300005842 Bacteria 2188
87 Ga0068858_101327718 3300005842 Unclassified 708
88 Ga0068860_100000569 3300005843 Bacteria 44368
89 Ga0068860_100265894 3300005843 Bacteria 1673
90 Ga0068860_100776657 3300005843 Unclassified 971
91 Ga0068862_100143229 3300005844 Bacteria 2122
92 Ga0068862_101000626 3300005844 Bacteria 827
93 Ga0081455_10035616 3300005937 Bacteria 4445
94 Ga0081455_10102859 3300005937 Bacteria 2289
95 Ga0081539_10066529 3300005985 Bacteria 1953
96 Ga0070717_10000033 3300006028 Bacteria 131514
97 Ga0070716_101144048 3300006173 Unclassified 623
98 Ga0075362_10245956 3300006177 Bacteria 879
99 Ga0097621_100343540 3300006237 Bacteria 1326
100 Ga0097621_100356972 3300006237 Bacteria 1301
101 Ga0075428_100095554 3300006844 Bacteria 3240
102 Ga0068865_100219494 3300006881 Unclassified 1486
103 Ga0068865_100374197 3300006881 Bacteria 1160
104 Ga0075436_100038914 3300006914 Bacteria 3282
105 Ga0099794_10311074 3300007265 Unclassified 816
106 Ga0099794_10372434 3300007265 Unclassified 744
107 Ga0099795_10028731 3300007788 Bacteria 1894
108 Ga0105251_10110365 3300009011 Bacteria 1253
109 Ga0111539_13067185 3300009094 Unclassified 539
110 Ga0105247_10520482 3300009101 Unclassified 870
111 Ga0114129_10786258 3300009147 Bacteria 1215
112 Ga0105243_10059839 3300009148 Bacteria 3041
113 Ga0105242_11209666 3300009176 Unclassified 775
114 Ga0105237_10251245 3300009545 Unclassified 1770
115 Ga0105237_10986166 3300009545 Bacteria 849
116 Ga0105249_10279937 3300009553 Unclassified 1665
117 Ga0105249_12198099 3300009553 Bacteria 625
118 Ga0099796_10051565 3300010159 Bacteria 1430
119 Ga0105239_10603675 3300010375 Bacteria 1252
120 Ga0105239_11459803 3300010375 Bacteria 790
121 Ga0105239_12156812 3300010375 Unclassified 648
122 Ga0157369_11606892 3300013105 Bacteria 661
123 Ga0157374_10320486 3300013296 Bacteria 1536
124 Ga0157374_11219731 3300013296 Bacteria 774
125 Ga0157378_10076602 3300013297 Bacteria 3014
126 Ga0157378_10281273 3300013297 Bacteria 1604
127 Ga0157378_10344720 3300013297 Bacteria 1454
128 Ga0163162_10315321 3300013306 Bacteria 1696
129 Ga0163162_11334702 3300013306 Bacteria 815
130 Ga0157372_12268556 3300013307 Unclassified 623
131 Ga0157375_10257587 3300013308 Bacteria 1906
132 Ga0157375_10376467 3300013308 Bacteria 1586
133 Ga0157375_10545075 3300013308 Unclassified 1322
134 Ga0163163_10112282 3300014325 Bacteria 2754
135 Ga0163163_10478993 3300014325 Bacteria 1305
136 Ga0163163_10942526 3300014325 Bacteria 927
137 Ga0157380_12511392 3300014326 Bacteria 581
138 Ga0157379_10229891 3300014968 Bacteria 1681
139 Ga0157379_10361224 3300014968 Bacteria 1331
140 Ga0157376_12128402 3300014969 Unclassified 599
141 Ga0163161_11696379 3300017792 Unclassified 559
142 Ga0207673_1021464 3300025290 Unclassified 874
143 Ga0207697_10042518 3300025315 Bacteria 1867
144 Ga0207697_10070837 3300025315 Bacteria 1461
145 Ga0207697_10320691 3300025315 Unclassified 688
146 Ga0207642_10990744 3300025899 Unclassified 541
147 Ga0207710_10561823 3300025900 Unclassified 595
148 Ga0207688_10092078 3300025901 Bacteria 1742
149 Ga0207688_10484049 3300025901 Unclassified 774
150 Ga0207680_10582380 3300025903 Bacteria 800
151 Ga0207685_10073411 3300025905 Unclassified 1394
152 Ga0207645_10016417 3300025907 Bacteria 4902
153 Ga0207645_10019772 3300025907 Bacteria 4411
154 Ga0207645_10725396 3300025907 Bacteria 676
155 Ga0207705_10689920 3300025909 Bacteria 794
156 Ga0207684_10008914 3300025910 Bacteria 8904
157 Ga0207684_10053206 3300025910 Bacteria 3437
158 Ga0207684_10520124 3300025910 Unclassified 1019
159 Ga0207684_10843802 3300025910 Bacteria 772
160 Ga0207671_10394786 3300025914 Bacteria 1100
161 Ga0207693_10012365 3300025915 Bacteria 6894
162 Ga0207693_10371445 3300025915 Bacteria 1119
163 Ga0207662_10006099 3300025918 Bacteria 6483
164 Ga0207657_10550472 3300025919 Unclassified 902
165 Ga0207646_10106488 3300025922 Bacteria 2515
166 Ga0207646_10107649 3300025922 Bacteria 2501
167 Ga0207646_10187119 3300025922 Unclassified 1870
168 Ga0207646_10413092 3300025922 Bacteria 1219
169 Ga0207681_10056585 3300025923 Bacteria 2676
170 Ga0207681_10085216 3300025923 Bacteria 2242
171 Ga0207681_10896625 3300025923 Unclassified 742
172 Ga0207650_11129280 3300025925 Unclassified 667
173 Ga0207650_11704582 3300025925 Unclassified 534
174 Ga0207659_10127910 3300025926 Bacteria 1956
175 Ga0207659_10139717 3300025926 Bacteria 1879
176 Ga0207659_10687583 3300025926 Bacteria 876
177 Ga0207687_10933203 3300025927 Unclassified 743
178 Ga0207644_10001481 3300025931 Bacteria 15096
179 Ga0207644_10834567 3300025931 Bacteria 771
180 Ga0207690_10481622 3300025932 Unclassified 1001
181 Ga0207706_10049764 3300025933 Bacteria 3703
182 Ga0207706_10609864 3300025933 Unclassified 937
183 Ga0207706_11121426 3300025933 Unclassified 656
184 Ga0207709_10142705 3300025935 Bacteria 1648
185 Ga0207670_11661698 3300025936 Unclassified 543
186 Ga0207704_10602142 3300025938 Bacteria 900
187 Ga0207704_11210064 3300025938 Unclassified 644
188 Ga0207691_10062659 3300025940 Bacteria 3373
189 Ga0207689_10169341 3300025942 Bacteria 1800
190 Ga0207679_10432197 3300025945 Unclassified 1164
191 Ga0207667_10065511 3300025949 Bacteria 3789
192 Ga0207667_10586754 3300025949 Bacteria 1125
193 Ga0207651_10013490 3300025960 Bacteria 4678
194 Ga0207712_10324977 3300025961 Unclassified 1271
195 Ga0207668_10188788 3300025972 Bacteria 1631
196 Ga0207668_10230313 3300025972 Bacteria 1493
197 Ga0207668_10667789 3300025972 Unclassified 911
198 Ga0207668_10751309 3300025972 Unclassified 860
199 Ga0207658_10050103 3300025986 Bacteria 3071
200 Ga0207658_10093078 3300025986 Bacteria 2343
201 Ga0207658_10692674 3300025986 Bacteria 920
202 Ga0207658_10698598 3300025986 Unclassified 916
203 Ga0207677_10142954 3300026023 Bacteria 1835
204 Ga0207677_10245837 3300026023 Unclassified 1450
205 Ga0207703_10036912 3300026035 Bacteria 3892
206 Ga0207703_10184384 3300026035 Bacteria 1844
207 Ga0207641_10499676 3300026088 Bacteria 1181
208 Ga0207641_10609902 3300026088 Unclassified 1069
209 Ga0207641_10699514 3300026088 Unclassified 998
210 Ga0207648_10784539 3300026089 Unclassified 886
211 Ga0207676_10968451 3300026095 Unclassified 837
212 Ga0207675_101966961 3300026118 Bacteria 602
213 Ga0207683_10020785 3300026121 Bacteria 5616
214 Ga0209974_10223488 3300027876 Unclassified 702
215 Ga0268266_10004452 3300028379 Bacteria 13400
216 Ga0268266_11581495 3300028379 Unclassified 631
217 Ga0268264_10004324 3300028381 Bacteria 12122
218 Ga0268264_10168573 3300028381 Bacteria 1978
219 Ga0268264_11087054 3300028381 Bacteria 808
220 Ga0268264_11539943 3300028381 Unclassified 675
221 Ga0373948_0217925 3300034817 Unclassified 504
222 Ga0373951_0010712 3300035091 Bacteria 2059
223 Ga0373954_0015706 3300035118 Bacteria 3387
224 Ga0373954_0101030 3300035118 Bacteria 1392
225 Ga0373957_0110700 3300035120 Unclassified 1106
226 Ga0373955_0312159 3300035172 Unclassified 949
227 Ga0373955_0385245 3300035172 Bacteria 851
228 Ga0373962_0281985 3300035242 Unclassified 585
229 Ga0373931_0088493 3300035691 Bacteria 1721
230 Ga0373933_0200239 3300035724 Unclassified 1278
231 Ga0373937_0054727 3300036401 Bacteria 3662
232 Ga0373937_0301989 3300036401 Unclassified 1513
233 Ga0451798_0703252 3300041458 Unclassified 671
234 Ga0451843_1688403 3300041509 Unclassified 501
235 Ga0466964_0176662 3300044706 Bacteria 1010
236 Ga0466967_0900866 3300045976 Unclassified 880
237 Ga0495651_0213121 3300046462 Bacteria 1342
238 Ga0495653_0248016 3300046463 Bacteria 1183
239 Ga0495580_0403509 3300046472 Unclassified 921
240 Ga0495584_0202630 3300046491 Bacteria 1009
241 Ga0495618_0367196 3300046514 Bacteria 885
242 Ga0495652_0070216 3300046529 Bacteria 2929
243 Ga0495598_0091006 3300046537 Unclassified 995
244 Ga0495634_0508219 3300046642 Unclassified 706
245 Ga0495659_0064234 3300046664 Unclassified 1363
246 Ga0495657_0091641 3300046675 Unclassified 1949
247 Ga0495657_0897138 3300046675 Unclassified 504
248 Ga0495599_0092957 3300046678 Bacteria 1882
249 Ga0495647_0474913 3300046681 Bacteria 580
250 Ga0495669_0045071 3300046684 Bacteria 1966
251 Ga0495669_0061725 3300046684 Unclassified 1697
252 Ga0495669_0259573 3300046684 Unclassified 835
253 Ga0495613_0192758 3300046689 Bacteria 1440
254 Ga0495674_0176406 3300047319 Bacteria 1781
255 Ga0495675_0019408 3300047444 Bacteria 4320
256 Ga0496102_0921523 3300048905 Bacteria 795
257 Ga0496104_0860677 3300048907 Unclassified 812
258 Ga0496104_1847146 3300048907 Unclassified 506
259 Ga0496106_0877788 3300048909 Unclassified 709
260 Ga0496108_0571102 3300048911 Unclassified 986
261 Ga0496112_0067619 3300048915 Bacteria 3527
262 Ga0496112_0132838 3300048915 Bacteria 2460
263 nmdc:mga03683_47144_c1 3300050489 Unclassified 1444
264 nmdc:mga03n38_359020_c1 3300050490 Bacteria 794
265 nmdc:mga05p37_424672_c1 3300050507 Bacteria 1546
266 nmdc:mga08y16_1961077_c1 3300050511 Unclassified 535
267 nmdc:mga0a205_674522_c1 3300050515 Bacteria 884
268 Ga0495601_0108306 3300053077 Bacteria 1798
269 Ga0495595_0073435 3300053084 Bacteria 1620
270 Ga0500555_000020 3300053103 Bacteria 172742
271 Ga0453683_1128556
272 SwRhRL2b_contig_3177080
273 JGI24746J21847_1060152
274 JGI24744J21845_10029097
275 JGI24035J26624_1010529
276 JGI24035J26624_1018764
277 Ga0065714_10390771
278 Ga0065704_10035100
279 Ga0065704_10101808
280 Ga0065704_10320824
281 Ga0065712_10009919
282 Ga0065715_10027319
283 Ga0065707_10024306
284 Ga0070658_10667428
285 Ga0070676_10085780
286 Ga0070690_100385717
287 Ga0070670_100085019
288 Ga0068869_100160692
289 Ga0070666_10007841
290 Ga0070666_10619946
291 Ga0068868_100132316
292 Ga0068868_100230743
293 Ga0070689_100501775
294 Ga0070689_101700556
295 Ga0070687_100243816
296 Ga0070668_100159866
297 Ga0070668_100234325
298 Ga0070668_100464292
299 Ga0070668_100498503
300 Ga0070669_100070552
301 Ga0070669_100071535
302 Ga0070669_100097198
303 Ga0070675_100180201
304 Ga0070675_100318527
305 Ga0070675_100605419
306 Ga0070671_100014619
307 Ga0070671_101325950
308 Ga0070674_100012161
309 Ga0070673_100035044
310 Ga0070688_100349034
311 Ga0070688_101179810
312 Ga0070659_100523348
313 Ga0070667_100002725
314 Ga0070667_100434281
315 Ga0070667_100543418
316 Ga0070667_100608677
317 Ga0070709_10592265
318 Ga0070705_100233236
319 Ga0070705_101852074
320 Ga0070694_101829874
321 Ga0070708_100234078
322 Ga0070708_100547856
323 Ga0070708_100835529
324 Ga0070678_100073268
325 Ga0070662_100089919
326 Ga0070662_100113933
327 Ga0070685_10650845
328 Ga0070706_100005395
329 Ga0070706_100398754
330 Ga0070707_100081378
331 Ga0070707_100097425
332 Ga0070707_100161310
333 Ga0070707_100474012
334 Ga0070707_100718887
335 Ga0070698_100953954
336 Ga0070699_100153883
337 Ga0070699_100292675
338 Ga0070684_100549184
339 Ga0070697_100041633
340 Ga0070697_100050643
341 Ga0070695_100584324
342 Ga0070696_101125350
343 Ga0070665_100015437
344 Ga0070665_101735766
345 Ga0070704_100244726
346 Ga0070704_101184119
347 Ga0068855_100019891
348 Ga0068855_100767346
349 Ga0070664_101045967
350 Ga0068864_101207509
351 Ga0068866_10339067
352 Ga0068866_11216124
353 Ga0068861_101786430
354 Ga0068861_101950065
355 Ga0068863_100938267
356 Ga0068858_100150457
357 Ga0068858_101327718
358 Ga0068860_100000569
359 Ga0068860_100265894
360 Ga0068860_100776657
361 Ga0068862_100143229
362 Ga0068862_101000626
363 Ga0081455_10035616
364 Ga0081455_10102859
365 Ga0081539_10066529
366 Ga0070717_10000033
367 Ga0070716_101144048
368 Ga0075362_10245956
369 Ga0097621_100343540
370 Ga0097621_100356972
371 Ga0075428_100095554
372 Ga0068865_100219494
373 Ga0068865_100374197
374 Ga0075436_100038914
375 Ga0099794_10311074
376 Ga0099794_10372434
377 Ga0099795_10028731
378 Ga0105251_10110365
379 Ga0111539_13067185
380 Ga0105247_10520482
381 Ga0114129_10786258
382 Ga0105243_10059839
383 Ga0105242_11209666
384 Ga0105237_10251245
385 Ga0105237_10986166
386 Ga0105249_10279937
387 Ga0105249_12198099
388 Ga0099796_10051565
389 Ga0105239_10603675
390 Ga0105239_11459803
391 Ga0105239_12156812
392 Ga0157369_11606892
393 Ga0157374_10320486
394 Ga0157374_11219731
395 Ga0157378_10076602
396 Ga0157378_10281273
397 Ga0157378_10344720
398 Ga0163162_10315321
399 Ga0163162_11334702
400 Ga0157372_12268556
401 Ga0157375_10257587
402 Ga0157375_10376467
403 Ga0157375_10545075
404 Ga0163163_10112282
405 Ga0163163_10478993
406 Ga0163163_10942526
407 Ga0157380_12511392
408 Ga0157379_10229891
409 Ga0157379_10361224
410 Ga0157376_12128402
411 Ga0163161_11696379
412 Ga0207673_1021464
413 Ga0207697_10042518
414 Ga0207697_10070837
415 Ga0207697_10320691
416 Ga0207642_10990744
417 Ga0207710_10561823
418 Ga0207688_10092078
419 Ga0207688_10484049
420 Ga0207680_10582380
421 Ga0207685_10073411
422 Ga0207645_10016417
423 Ga0207645_10019772
424 Ga0207645_10725396
425 Ga0207705_10689920
426 Ga0207684_10008914
427 Ga0207684_10053206
428 Ga0207684_10520124
429 Ga0207684_10843802
430 Ga0207671_10394786
431 Ga0207693_10012365
432 Ga0207693_10371445
433 Ga0207662_10006099
434 Ga0207657_10550472
435 Ga0207646_10106488
436 Ga0207646_10107649
437 Ga0207646_10187119
438 Ga0207646_10413092
439 Ga0207681_10056585
440 Ga0207681_10085216
441 Ga0207681_10896625
442 Ga0207650_11129280
443 Ga0207650_11704582
444 Ga0207659_10127910
445 Ga0207659_10139717
446 Ga0207659_10687583
447 Ga0207687_10933203
448 Ga0207644_10001481
449 Ga0207644_10834567
450 Ga0207690_10481622
451 Ga0207706_10049764
452 Ga0207706_10609864
453 Ga0207706_11121426
454 Ga0207709_10142705
455 Ga0207670_11661698
456 Ga0207704_10602142
457 Ga0207704_11210064
458 Ga0207691_10062659
459 Ga0207689_10169341
460 Ga0207679_10432197
461 Ga0207667_10065511
462 Ga0207667_10586754
463 Ga0207651_10013490
464 Ga0207712_10324977
465 Ga0207668_10188788
466 Ga0207668_10230313
467 Ga0207668_10667789
468 Ga0207668_10751309
469 Ga0207658_10050103
470 Ga0207658_10093078
471 Ga0207658_10692674
472 Ga0207658_10698598
473 Ga0207677_10142954
474 Ga0207677_10245837
475 Ga0207703_10036912
476 Ga0207703_10184384
477 Ga0207641_10499676
478 Ga0207641_10609902
479 Ga0207641_10699514
480 Ga0207648_10784539
481 Ga0207676_10968451
482 Ga0207675_101966961
483 Ga0207683_10020785
484 Ga0209974_10223488
485 Ga0268266_10004452
486 Ga0268266_11581495
487 Ga0268264_10004324
488 Ga0268264_10168573
489 Ga0268264_11087054
490 Ga0268264_11539943
491 Ga0373948_0217925
492 Ga0373951_0010712
493 Ga0373954_0015706
494 Ga0373954_0101030
495 Ga0373957_0110700
496 Ga0373955_0312159
497 Ga0373955_0385245
498 Ga0373962_0281985
499 Ga0373931_0088493
500 Ga0373933_0200239
501 Ga0373937_0054727
502 Ga0373937_0301989
503 Ga0451798_0703252
504 Ga0451843_1688403
505 Ga0466964_0176662
506 Ga0466967_0900866
507 Ga0495651_0213121
508 Ga0495653_0248016
509 Ga0495580_0403509
510 Ga0495584_0202630
511 Ga0495618_0367196
512 Ga0495652_0070216
513 Ga0495598_0091006
514 Ga0495634_0508219
515 Ga0495659_0064234
516 Ga0495657_0091641
517 Ga0495657_0897138
518 Ga0495599_0092957
519 Ga0495647_0474913
520 Ga0495669_0045071
521 Ga0495669_0061725
522 Ga0495669_0259573
523 Ga0495613_0192758
524 Ga0495674_0176406
525 Ga0495675_0019408
526 Ga0496102_0921523
527 Ga0496104_0860677
528 Ga0496104_1847146
529 Ga0496106_0877788
530 Ga0496108_0571102
531 Ga0496112_0067619
532 Ga0496112_0132838
533 nmdc:mga03683_47144_c1
534 nmdc:mga03n38_359020_c1
535 nmdc:mga05p37_424672_c1
536 nmdc:mga08y16_1961077_c1
537 nmdc:mga0a205_674522_c1
538 Ga0495601_0108306
539 Ga0495595_0073435
540 Ga0500555_000020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

125

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.8434 2 117
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.8367 1 118
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8358 5 114
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8281 1 118
5wew-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound 0.823 2 118
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.878 64 118 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8655 68 120 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8496 64 118 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8472 68 120 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8397 64 118 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A128F373-F1-model_v4 VOC domain-containing protein 0.9665 65 118
AF-A0A2V6DGP9-F1-model_v4 Glyoxalase 0.9662 40 120
AF-Q7NA19-F1-model_v4 Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 1/17 0.9656 65 118
AF-A0A7Y0QVA6-F1-model_v4 deleted 0.9646 65 118
AF-A0A353GPK1-F1-model_v4 VOC domain-containing protein 0.9615 65 118

Map