F377030

General Info

Members Datasets Scaffolds Average Seq Length
270 182 540 213

Family's Representative Sequence

Representative Sequence 3300028017|Ga0265356_1008706|Ga0265356_10087062
Length 255
Sequence MAIARNGELQITPQDVLLVIDLQNDFCPGGALAVADGDAVLDPIHRLAPKFDHIVLTQDWHTAGHSSFASAHAGKKPFEQIEMGYGMQTLWPDHCIQGSKGAEFHPALRLPQAQLILRKGFRPQIDSYSAFFENDRSTATGLAGYLRERNLIRVFLAGLAYDFCVGYSALDARRLGFEAIILLDACRTIDLNGSVEKIESEFAEAGVVLMDSADVINDADVEEAIRQGQEDASQGKIRSAKEFFDEFETTHPELE

Samples

Sample ID Description Type Environment
1 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
162 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
176 2842677519 Variovorax sp. R-72495 Isolate Unclassified
177 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
178 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
179 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
180 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
181 2929520902 Variovorax beijingensis 502 Isolate Unclassified
182 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 0
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 0
Rhizoplane 2.59
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265356_1008706 3300028017 Bacteria 1152
2 JGI24739J22299_10006468 3300001989 Bacteria 4420
3 JGI24735J21928_10029838 3300002067 Bacteria 1622
4 JGI25151J46595_10029180 3300003187 Bacteria 2188
5 rootH2_10258592 3300003320 Bacteria 1018
6 Ga0070683_100000206 3300005329 Bacteria 39826
7 Ga0070683_100015626 3300005329 Bacteria 6673
8 Ga0070670_100006941 3300005331 Bacteria 9599
9 Ga0068869_100000472 3300005334 Bacteria 22278
10 Ga0070666_10386326 3300005335 Bacteria 1005
11 Ga0068868_100000101 3300005338 Bacteria 52911
12 Ga0068868_100046641 3300005338 Bacteria 3392
13 Ga0070661_100011345 3300005344 Bacteria 6210
14 Ga0070661_100105790 3300005344 Bacteria 2098
15 Ga0070669_100024731 3300005353 Bacteria 4308
16 Ga0070671_100073232 3300005355 Bacteria 2861
17 Ga0070674_100018127 3300005356 Bacteria 4444
18 Ga0070673_100451048 3300005364 Bacteria 1157
19 Ga0070667_100000335 3300005367 Bacteria 52468
20 Ga0070713_100037448 3300005436 Bacteria 3922
21 Ga0070713_100143972 3300005436 Bacteria 2114
22 Ga0070678_100246038 3300005456 Bacteria 1497
23 Ga0070684_100000486 3300005535 Bacteria 27275
24 Ga0070684_100009392 3300005535 Bacteria 7700
25 Ga0068853_100003254 3300005539 Bacteria 12416
26 Ga0070696_100045783 3300005546 Bacteria 3031
27 Ga0068855_100002672 3300005563 Bacteria 21973
28 Ga0068855_100020135 3300005563 Bacteria 8012
29 Ga0068855_100129234 3300005563 Bacteria 2886
30 Ga0070664_100465380 3300005564 Bacteria 1162
31 Ga0068857_100000170 3300005577 Bacteria 40989
32 Ga0068857_100022592 3300005577 Bacteria 5532
33 Ga0068854_100143239 3300005578 Bacteria 1836
34 Ga0068856_100000302 3300005614 Bacteria 53974
35 Ga0068856_100001268 3300005614 Bacteria 26588
36 Ga0068856_100018745 3300005614 Bacteria 6709
37 Ga0068852_100000029 3300005616 Bacteria 105168
38 Ga0068852_100000033 3300005616 Bacteria 101433
39 Ga0068852_100033692 3300005616 Bacteria 4256
40 Ga0068852_100130710 3300005616 Bacteria 2312
41 Ga0068859_100104222 3300005617 Bacteria 2895
42 Ga0068864_100000410 3300005618 Bacteria 37188
43 Ga0068861_100929228 3300005719 Bacteria 826
44 Ga0068851_10028697 3300005834 Bacteria 2749
45 Ga0068851_10224191 3300005834 Bacteria 1057
46 Ga0068851_10299680 3300005834 Bacteria 924
47 Ga0068863_100024207 3300005841 Bacteria 5791
48 Ga0068858_100004937 3300005842 Bacteria 13070
49 Ga0068860_100000188 3300005843 Bacteria 98490
50 Ga0068862_100032709 3300005844 Bacteria 4394
51 Ga0081538_10013449 3300005981 Bacteria 6475
52 Ga0070717_10001542 3300006028 Bacteria 15977
53 Ga0075367_10237916 3300006178 Bacteria 1141
54 Ga0075366_10216691 3300006195 Bacteria 1166
55 Ga0097621_100000192 3300006237 Bacteria 39446
56 Ga0068871_100004357 3300006358 Bacteria 9839
57 Ga0075428_100022122 3300006844 Bacteria 7039
58 Ga0075428_100158908 3300006844 Bacteria 2454
59 Ga0075430_100001698 3300006846 Bacteria 17988
60 Ga0075431_100007996 3300006847 Bacteria 10550
61 Ga0075429_100382306 3300006880 Bacteria 1233
62 Ga0068865_100139866 3300006881 Bacteria 1824
63 Ga0097620_100104223 3300006931 Bacteria 2895
64 Ga0105251_10000282 3300009011 Bacteria 51170
65 Ga0105240_10000065 3300009093 Bacteria 213992
66 Ga0105240_10000125 3300009093 Bacteria 159027
67 Ga0105240_10004597 3300009093 Bacteria 20915
68 Ga0105240_10004642 3300009093 Bacteria 20812
69 Ga0105240_10199714 3300009093 Bacteria 2344
70 Ga0111539_10000208 3300009094 Bacteria 69518
71 Ga0111539_10771060 3300009094 Bacteria 1119
72 Ga0105245_10011896 3300009098 Bacteria 7567
73 Ga0105245_10066703 3300009098 Bacteria 3258
74 Ga0105247_10005702 3300009101 Bacteria 7798
75 Ga0114129_10006708 3300009147 Bacteria 16345
76 Ga0114129_10268999 3300009147 Bacteria 2281
77 Ga0114129_10350699 3300009147 Bacteria 1955
78 Ga0105241_10000392 3300009174 Bacteria 33157
79 Ga0105241_10012830 3300009174 Bacteria 6150
80 Ga0105241_10173240 3300009174 Bacteria 1784
81 Ga0105241_10186654 3300009174 Bacteria 1723
82 Ga0105248_10090800 3300009177 Bacteria 3440
83 Ga0105237_10004404 3300009545 Bacteria 16323
84 Ga0105237_10009774 3300009545 Bacteria 10258
85 Ga0105237_10035879 3300009545 Bacteria 5016
86 Ga0105237_10181884 3300009545 Bacteria 2103
87 Ga0105238_10000083 3300009551 Bacteria 107423
88 Ga0105238_10001427 3300009551 Bacteria 23964
89 Ga0105238_10055650 3300009551 Bacteria 3970
90 Ga0105238_10549857 3300009551 Bacteria 1159
91 Ga0105249_10072390 3300009553 Bacteria 3186
92 Ga0105249_11591578 3300009553 Bacteria 726
93 Ga0105239_10002518 3300010375 Bacteria 23288
94 Ga0105239_10032368 3300010375 Bacteria 5747
95 Ga0105239_10402104 3300010375 Bacteria 1550
96 Ga0105246_10000437 3300011119 Bacteria 22270
97 Ga0105246_10309765 3300011119 Bacteria 1278
98 Ga0157370_10000009 3300013104 Bacteria 231270
99 Ga0157369_10000022 3300013105 Bacteria 233081
100 Ga0157369_10002352 3300013105 Bacteria 22744
101 Ga0157369_10004448 3300013105 Bacteria 16523
102 Ga0157369_10103015 3300013105 Bacteria 3040
103 Ga0157369_10133752 3300013105 Bacteria 2627
104 Ga0157374_10054835 3300013296 Bacteria 3719
105 Ga0157374_10087061 3300013296 Bacteria 2973
106 Ga0157378_10030051 3300013297 Bacteria 4800
107 Ga0157378_10239617 3300013297 Bacteria 1732
108 Ga0163162_10094273 3300013306 Bacteria 3079
109 Ga0157372_10000040 3300013307 Bacteria 163677
110 Ga0157372_10010863 3300013307 Bacteria 9692
111 Ga0157372_10097063 3300013307 Bacteria 3360
112 Ga0157372_10150107 3300013307 Bacteria 2689
113 Ga0157372_10172968 3300013307 Bacteria 2499
114 Ga0157372_10322713 3300013307 Bacteria 1798
115 Ga0157375_10021823 3300013308 Bacteria 5882
116 Ga0157375_10289281 3300013308 Bacteria 1802
117 Ga0157375_10325311 3300013308 Bacteria 1702
118 Ga0163163_10000267 3300014325 Bacteria 52274
119 Ga0157380_10157917 3300014326 Bacteria 1968
120 Ga0157379_10005463 3300014968 Bacteria 10918
121 Ga0157379_10272987 3300014968 Bacteria 1538
122 Ga0157376_10005141 3300014969 Bacteria 9121
123 Ga0157376_10368961 3300014969 Bacteria 1379
124 Ga0182007_10006237 3300015262 Bacteria 5131
125 Ga0209129_1018515 3300025258 Bacteria 1336
126 Ga0209025_1001004 3300025294 Bacteria 41792
127 Ga0207656_10023340 3300025321 Bacteria 2490
128 Ga0207642_10036456 3300025899 Bacteria 2110
129 Ga0207710_10001148 3300025900 Bacteria 13489
130 Ga0207680_10357959 3300025903 Bacteria 1026
131 Ga0207647_10003883 3300025904 Bacteria 11173
132 Ga0207705_10394398 3300025909 Bacteria 1070
133 Ga0207654_10000345 3300025911 Bacteria 27658
134 Ga0207654_10000747 3300025911 Bacteria 17986
135 Ga0207695_10000052 3300025913 Bacteria 398089
136 Ga0207695_10000210 3300025913 Bacteria 157198
137 Ga0207695_10000338 3300025913 Bacteria 110289
138 Ga0207695_10010719 3300025913 Bacteria 11189
139 Ga0207695_10115863 3300025913 Bacteria 2654
140 Ga0207671_10000068 3300025914 Bacteria 161429
141 Ga0207671_10000145 3300025914 Bacteria 109306
142 Ga0207671_10351659 3300025914 Bacteria 1169
143 Ga0207663_10296740 3300025916 Bacteria 1206
144 Ga0207649_10004116 3300025920 Bacteria 7914
145 Ga0207649_10019706 3300025920 Bacteria 3860
146 Ga0207694_10000043 3300025924 Bacteria 171251
147 Ga0207694_10000085 3300025924 Bacteria 108662
148 Ga0207694_10274188 3300025924 Bacteria 1384
149 Ga0207650_10008169 3300025925 Bacteria 7136
150 Ga0207687_10001167 3300025927 Bacteria 17935
151 Ga0207687_10036374 3300025927 Bacteria 3354
152 Ga0207700_10020002 3300025928 Bacteria 4536
153 Ga0207644_10060338 3300025931 Bacteria 2744
154 Ga0207669_10050644 3300025937 Bacteria 2484
155 Ga0207704_10022440 3300025938 Bacteria 3382
156 Ga0207711_10134008 3300025941 Bacteria 2223
157 Ga0207689_10001575 3300025942 Bacteria 21614
158 Ga0207661_10000172 3300025944 Bacteria 41691
159 Ga0207679_10062098 3300025945 Bacteria 2783
160 Ga0207667_10007238 3300025949 Bacteria 13388
161 Ga0207667_10075465 3300025949 Bacteria 3501
162 Ga0207667_10093937 3300025949 Bacteria 3097
163 Ga0207667_10631611 3300025949 Bacteria 1078
164 Ga0207640_10161959 3300025981 Bacteria 1656
165 Ga0207640_10528049 3300025981 Bacteria 987
166 Ga0207658_10000142 3300025986 Bacteria 74708
167 Ga0207677_10000135 3300026023 Bacteria 60283
168 Ga0207703_10000513 3300026035 Bacteria 40099
169 Ga0207639_10006976 3300026041 Bacteria 7697
170 Ga0207639_10031467 3300026041 Bacteria 3900
171 Ga0207639_10158418 3300026041 Bacteria 1905
172 Ga0207702_10001615 3300026078 Bacteria 22285
173 Ga0207702_10003155 3300026078 Bacteria 15263
174 Ga0207641_10000706 3300026088 Bacteria 35914
175 Ga0207648_10113499 3300026089 Bacteria 2380
176 Ga0207676_10000385 3300026095 Bacteria 37717
177 Ga0207674_10000688 3300026116 Bacteria 44010
178 Ga0207675_100060514 3300026118 Bacteria 3536
179 Ga0207675_100947397 3300026118 Bacteria 878
180 Ga0207683_10007040 3300026121 Bacteria 9645
181 Ga0207698_10000007 3300026142 Bacteria 289457
182 Ga0207698_10000040 3300026142 Bacteria 100053
183 Ga0207698_10005045 3300026142 Bacteria 8099
184 Ga0207698_10047070 3300026142 Bacteria 3263
185 Ga0207428_10000016 3300027907 Bacteria 327690
186 Ga0207428_10250957 3300027907 Bacteria 1319
187 Ga0207428_10494674 3300027907 Bacteria 888
188 Ga0268266_10452857 3300028379 Bacteria 1220
189 Ga0268264_10000275 3300028381 Bacteria 88501
190 Ga0265323_10123008 3300028653 Bacteria 844
191 Ga0307515_10017870 3300028794 Bacteria 12886
192 Ga0265338_10003528 3300028800 Bacteria 21909
193 Ga0265330_10047222 3300031235 Bacteria 1895
194 Ga0265316_10015938 3300031344 Bacteria 6542
195 Ga0265316_10197562 3300031344 Bacteria 1492
196 Ga0307408_100300131 3300031548 Bacteria 1345
197 Ga0265314_10016946 3300031711 Bacteria 5735
198 Ga0265314_10047343 3300031711 Bacteria 3027
199 Ga0265314_10120336 3300031711 Bacteria 1654
200 Ga0265342_10000780 3300031712 Bacteria 32368
201 Ga0265342_10038987 3300031712 Bacteria 2890
202 Ga0307413_10076121 3300031824 Bacteria 2132
203 Ga0307410_10048756 3300031852 Bacteria 2839
204 Ga0307412_10560386 3300031911 Bacteria 961
205 Ga0307409_100028813 3300031995 Bacteria 3963
206 Ga0307416_100475523 3300032002 Bacteria 1308
207 Ga0307411_10045936 3300032005 Bacteria 2812
208 Ga0316583_10082597 3300032133 Bacteria 1122
209 Ga0373954_0065785 3300035118 Bacteria 1716
210 Ga0373957_0086748 3300035120 Bacteria 1240
211 Ga0373937_0002838 3300036401 Bacteria 14483
212 Ga0373937_0454872 3300036401 Bacteria 1216
213 Ga0373925_0250304 3300037068 Bacteria 1421
214 Ga0395898_0027603 3300037466 Bacteria 5695
215 Ga0395905_0011720 3300037471 Bacteria 8464
216 Ga0395901_0044098 3300038443 Bacteria 4626
217 Ga0436361_0922551 3300039447 Bacteria 824
218 Ga0450918_033152 3300042531 Bacteria 915
219 Ga0451577_0086598 3300042876 Bacteria 2795
220 Ga0466961_0115217 3300044693 Bacteria 1689
221 Ga0495629_0156836 3300046459 Bacteria 1581
222 Ga0495580_0265893 3300046472 Bacteria 1172
223 Ga0495582_0076646 3300046473 Bacteria 1854
224 Ga0495643_0073174 3300046522 Bacteria 1796
225 Ga0495665_0284712 3300046531 Bacteria 848
226 Ga0495656_0075866 3300046615 Bacteria 1505
227 Ga0495623_0269057 3300046679 Bacteria 952
228 Ga0495613_0174136 3300046689 Bacteria 1526
229 Ga0495671_0144207 3300046692 Bacteria 1160
230 Ga0496101_0104440 3300048904 Bacteria 2125
231 Ga0496104_0019161 3300048907 Bacteria 6255
232 Ga0496104_0254948 3300048907 Bacteria 1667
233 Ga0496105_0134407 3300048908 Bacteria 2038
234 Ga0496105_0359323 3300048908 Bacteria 1162
235 Ga0496114_0042987 3300048917 Bacteria 3747
236 Ga0496115_0017441 3300048918 Bacteria 5491
237 Ga0496120_0128529 3300048923 Bacteria 1301
238 Ga0496123_0051488 3300048926 Bacteria 2741
239 Ga0496123_0114784 3300048926 Bacteria 1530
240 Ga0495682_0132573 3300049460 Bacteria 891
241 Ga0501292_003965 3300049515 Bacteria 2002
242 Ga0501034_0002618 3300049571 Bacteria 21346
243 Ga0501034_0226571 3300049571 Bacteria 1820
244 Ga0501048_0307173 3300049582 Bacteria 1129
245 Ga0501072_0890462 3300049588 Bacteria 695
246 Ga0501207_010235 3300049654 Bacteria 1381
247 Ga0501262_009181 3300049759 Bacteria 1219
248 nmdc:mga03n38_56162_c1 3300050490 Bacteria 1776
249 nmdc:mga06z11_112053_c1 3300050494 Bacteria 1512
250 nmdc:mga07m45_1302_c1 3300050496 Bacteria 11344
251 nmdc:mga07m45_2696_c1 3300050496 Bacteria 4542
252 nmdc:mga05p37_119470_c1 3300050507 Bacteria 3238
253 nmdc:mga05p37_81902_c1 3300050507 Bacteria 3976
254 nmdc:mga09592_276882_c1 3300050508 Bacteria 1455
255 nmdc:mga0qj67_1217_c1 3300050509 Bacteria 17909
256 nmdc:mga06r32_17456_c1 3300050510 Bacteria 6551
257 nmdc:mga08y16_26_c1 3300050511 Bacteria 223965
258 nmdc:mga08y16_346352_c1 3300050511 Bacteria 1527
259 nmdc:mga0a205_471385_c1 3300050515 Bacteria 1114
260 Ga0500627_0063823 3300053158 Bacteria 1624
261 Ga0590077_060444 3300059426 Bacteria 859
262 Ga0501082_0154668 3300060353 Bacteria 1993
263 2828306737 2828305725 Bacteria 4916900
264 2842679382 2842677519 Bacteria 5615038
265 2883358219 2883354860 Bacteria 5865246
266 2897806061 2897803580 Bacteria 7000062
267 2904543194 2904541872 Bacteria 8915136
268 2919466495 2919462493 Bacteria 5817112
269 2929524025 2929520902 Bacteria 6765052
270 2945950548 2945945610 Bacteria 5951079
271 Ga0265356_1008706
272 JGI24739J22299_10006468
273 JGI24735J21928_10029838
274 JGI25151J46595_10029180
275 rootH2_10258592
276 Ga0070683_100000206
277 Ga0070683_100015626
278 Ga0070670_100006941
279 Ga0068869_100000472
280 Ga0070666_10386326
281 Ga0068868_100000101
282 Ga0068868_100046641
283 Ga0070661_100011345
284 Ga0070661_100105790
285 Ga0070669_100024731
286 Ga0070671_100073232
287 Ga0070674_100018127
288 Ga0070673_100451048
289 Ga0070667_100000335
290 Ga0070713_100037448
291 Ga0070713_100143972
292 Ga0070678_100246038
293 Ga0070684_100000486
294 Ga0070684_100009392
295 Ga0068853_100003254
296 Ga0070696_100045783
297 Ga0068855_100002672
298 Ga0068855_100020135
299 Ga0068855_100129234
300 Ga0070664_100465380
301 Ga0068857_100000170
302 Ga0068857_100022592
303 Ga0068854_100143239
304 Ga0068856_100000302
305 Ga0068856_100001268
306 Ga0068856_100018745
307 Ga0068852_100000029
308 Ga0068852_100000033
309 Ga0068852_100033692
310 Ga0068852_100130710
311 Ga0068859_100104222
312 Ga0068864_100000410
313 Ga0068861_100929228
314 Ga0068851_10028697
315 Ga0068851_10224191
316 Ga0068851_10299680
317 Ga0068863_100024207
318 Ga0068858_100004937
319 Ga0068860_100000188
320 Ga0068862_100032709
321 Ga0081538_10013449
322 Ga0070717_10001542
323 Ga0075367_10237916
324 Ga0075366_10216691
325 Ga0097621_100000192
326 Ga0068871_100004357
327 Ga0075428_100022122
328 Ga0075428_100158908
329 Ga0075430_100001698
330 Ga0075431_100007996
331 Ga0075429_100382306
332 Ga0068865_100139866
333 Ga0097620_100104223
334 Ga0105251_10000282
335 Ga0105240_10000065
336 Ga0105240_10000125
337 Ga0105240_10004597
338 Ga0105240_10004642
339 Ga0105240_10199714
340 Ga0111539_10000208
341 Ga0111539_10771060
342 Ga0105245_10011896
343 Ga0105245_10066703
344 Ga0105247_10005702
345 Ga0114129_10006708
346 Ga0114129_10268999
347 Ga0114129_10350699
348 Ga0105241_10000392
349 Ga0105241_10012830
350 Ga0105241_10173240
351 Ga0105241_10186654
352 Ga0105248_10090800
353 Ga0105237_10004404
354 Ga0105237_10009774
355 Ga0105237_10035879
356 Ga0105237_10181884
357 Ga0105238_10000083
358 Ga0105238_10001427
359 Ga0105238_10055650
360 Ga0105238_10549857
361 Ga0105249_10072390
362 Ga0105249_11591578
363 Ga0105239_10002518
364 Ga0105239_10032368
365 Ga0105239_10402104
366 Ga0105246_10000437
367 Ga0105246_10309765
368 Ga0157370_10000009
369 Ga0157369_10000022
370 Ga0157369_10002352
371 Ga0157369_10004448
372 Ga0157369_10103015
373 Ga0157369_10133752
374 Ga0157374_10054835
375 Ga0157374_10087061
376 Ga0157378_10030051
377 Ga0157378_10239617
378 Ga0163162_10094273
379 Ga0157372_10000040
380 Ga0157372_10010863
381 Ga0157372_10097063
382 Ga0157372_10150107
383 Ga0157372_10172968
384 Ga0157372_10322713
385 Ga0157375_10021823
386 Ga0157375_10289281
387 Ga0157375_10325311
388 Ga0163163_10000267
389 Ga0157380_10157917
390 Ga0157379_10005463
391 Ga0157379_10272987
392 Ga0157376_10005141
393 Ga0157376_10368961
394 Ga0182007_10006237
395 Ga0209129_1018515
396 Ga0209025_1001004
397 Ga0207656_10023340
398 Ga0207642_10036456
399 Ga0207710_10001148
400 Ga0207680_10357959
401 Ga0207647_10003883
402 Ga0207705_10394398
403 Ga0207654_10000345
404 Ga0207654_10000747
405 Ga0207695_10000052
406 Ga0207695_10000210
407 Ga0207695_10000338
408 Ga0207695_10010719
409 Ga0207695_10115863
410 Ga0207671_10000068
411 Ga0207671_10000145
412 Ga0207671_10351659
413 Ga0207663_10296740
414 Ga0207649_10004116
415 Ga0207649_10019706
416 Ga0207694_10000043
417 Ga0207694_10000085
418 Ga0207694_10274188
419 Ga0207650_10008169
420 Ga0207687_10001167
421 Ga0207687_10036374
422 Ga0207700_10020002
423 Ga0207644_10060338
424 Ga0207669_10050644
425 Ga0207704_10022440
426 Ga0207711_10134008
427 Ga0207689_10001575
428 Ga0207661_10000172
429 Ga0207679_10062098
430 Ga0207667_10007238
431 Ga0207667_10075465
432 Ga0207667_10093937
433 Ga0207667_10631611
434 Ga0207640_10161959
435 Ga0207640_10528049
436 Ga0207658_10000142
437 Ga0207677_10000135
438 Ga0207703_10000513
439 Ga0207639_10006976
440 Ga0207639_10031467
441 Ga0207639_10158418
442 Ga0207702_10001615
443 Ga0207702_10003155
444 Ga0207641_10000706
445 Ga0207648_10113499
446 Ga0207676_10000385
447 Ga0207674_10000688
448 Ga0207675_100060514
449 Ga0207675_100947397
450 Ga0207683_10007040
451 Ga0207698_10000007
452 Ga0207698_10000040
453 Ga0207698_10005045
454 Ga0207698_10047070
455 Ga0207428_10000016
456 Ga0207428_10250957
457 Ga0207428_10494674
458 Ga0268266_10452857
459 Ga0268264_10000275
460 Ga0265323_10123008
461 Ga0307515_10017870
462 Ga0265338_10003528
463 Ga0265330_10047222
464 Ga0265316_10015938
465 Ga0265316_10197562
466 Ga0307408_100300131
467 Ga0265314_10016946
468 Ga0265314_10047343
469 Ga0265314_10120336
470 Ga0265342_10000780
471 Ga0265342_10038987
472 Ga0307413_10076121
473 Ga0307410_10048756
474 Ga0307412_10560386
475 Ga0307409_100028813
476 Ga0307416_100475523
477 Ga0307411_10045936
478 Ga0316583_10082597
479 Ga0373954_0065785
480 Ga0373957_0086748
481 Ga0373937_0002838
482 Ga0373937_0454872
483 Ga0373925_0250304
484 Ga0395898_0027603
485 Ga0395905_0011720
486 Ga0395901_0044098
487 Ga0436361_0922551
488 Ga0450918_033152
489 Ga0451577_0086598
490 Ga0466961_0115217
491 Ga0495629_0156836
492 Ga0495580_0265893
493 Ga0495582_0076646
494 Ga0495643_0073174
495 Ga0495665_0284712
496 Ga0495656_0075866
497 Ga0495623_0269057
498 Ga0495613_0174136
499 Ga0495671_0144207
500 Ga0496101_0104440
501 Ga0496104_0019161
502 Ga0496104_0254948
503 Ga0496105_0134407
504 Ga0496105_0359323
505 Ga0496114_0042987
506 Ga0496115_0017441
507 Ga0496120_0128529
508 Ga0496123_0051488
509 Ga0496123_0114784
510 Ga0495682_0132573
511 Ga0501292_003965
512 Ga0501034_0002618
513 Ga0501034_0226571
514 Ga0501048_0307173
515 Ga0501072_0890462
516 Ga0501207_010235
517 Ga0501262_009181
518 nmdc:mga03n38_56162_c1
519 nmdc:mga06z11_112053_c1
520 nmdc:mga07m45_1302_c1
521 nmdc:mga07m45_2696_c1
522 nmdc:mga05p37_119470_c1
523 nmdc:mga05p37_81902_c1
524 nmdc:mga09592_276882_c1
525 nmdc:mga0qj67_1217_c1
526 nmdc:mga06r32_17456_c1
527 nmdc:mga08y16_26_c1
528 nmdc:mga08y16_346352_c1
529 nmdc:mga0a205_471385_c1
530 Ga0500627_0063823
531 Ga0590077_060444
532 Ga0501082_0154668
533 2828306737
534 2842679382
535 2883358219
536 2897806061
537 2904543194
538 2919466495
539 2929524025
540 2945950548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

15

214

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.9942 29 231
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.9704 29 231
3r2j-assembly2.cif.gz_C crystal structure of pnc1 from l. infantum in complex with nicotinate 0.9395 25 235
3r2j-assembly2.cif.gz_C crystal structure of pnc1 from l. infantum in complex with nicotinate 0.9303 25 235
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.9094 31 228
ID Description Score Start End Superfamily
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9942 29 231 3.40.50.850
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9704 29 231 3.40.50.850
af_Q54BH7_1_207_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9506 32 231 3.40.50.850
af_P21369_4_203_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9494 33 226 3.40.50.850
3r2jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.937 25 235 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A7G8W399-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9996 30 231 GO:0008936
GO:0019363
GO:0046872
AF-A0A536VUA4-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9994 132 231 GO:0016811
GO:0019363
GO:0046872
AF-A0A101K2C4-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9983 29 228 GO:0016811
GO:0019363
GO:0046872
AF-A0A536YUJ8-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9978 25 233 GO:0008936
GO:0019363
GO:0046872
AF-A0A6N1C0J6-F1-model_v4 deleted 0.9977 30 231

Map