F377013
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 270 | 160 | 263 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300025981|Ga0207640_10397426|Ga0207640_103974261 |
| Length | 268 |
| Sequence | VFEGCGLLFLIRRYLSLITNHSMEKAITAEKLSKRFGAFTAVDEISFEVEKGEIFGFLGANGAGKTTAIRMLCGLSLPTSGKATVAGFDVFRENEKIKKNIGYMSQKFSLYEDLTVKENIRFYAGIYGMTDSYIRDQTISLLKQLHMEKEANLLVKSLPLGWKQKLAFSVAIFHHPKIVFLDEPTGGVDPVTRREFWIMIYEAAASGITVFVTTHYMDEAEYCNRVSIMVDGKIEALDSPGGLRKRFNAASMDDVFLKLARKATRSEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 3 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 4 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 5 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 6 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 7 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 117 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 121 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 122 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 123 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 124 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 125 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 126 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 127 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 128 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 149 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 152 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 153 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 154 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 155 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 156 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 157 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 158 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 159 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.41 |
| Metatranscriptomes | 0 |
| Isolates | 2.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.44 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 90.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_449108 | 2162886007 | Bacteria | 1827 |
| 2 | rootH2_10006910 | 3300003320 | Bacteria | 14945 |
| 3 | rootH2_10072708 | 3300003320 | Bacteria | 30934 |
| 4 | rootL2_10032084 | 3300003322 | Bacteria | 14316 |
| 5 | rootL2_10108747 | 3300003322 | Bacteria | 13225 |
| 6 | rootL2_10224709 | 3300003322 | Bacteria | 2330 |
| 7 | rootH1_10011906 | 3300003323 | Bacteria | 17140 |
| 8 | rootH1_10059685 | 3300003323 | Bacteria | 20803 |
| 9 | rootH1_10068010 | 3300003323 | Bacteria | 13848 |
| 10 | Ga0065714_10156490 | 3300005288 | Bacteria | 1075 |
| 11 | Ga0065704_10071719 | 3300005289 | Bacteria | 10104 |
| 12 | Ga0065704_10107451 | 3300005289 | Bacteria | 2055 |
| 13 | Ga0065712_10003559 | 3300005290 | Bacteria | 3652 |
| 14 | Ga0065712_10003882 | 3300005290 | Bacteria | 3480 |
| 15 | Ga0065712_10122019 | 3300005290 | Bacteria | 1657 |
| 16 | Ga0065715_10112754 | 3300005293 | Bacteria | 2517 |
| 17 | Ga0070658_10059816 | 3300005327 | Bacteria | 3102 |
| 18 | Ga0070676_10174996 | 3300005328 | Unclassified | 1391 |
| 19 | Ga0070683_100045843 | 3300005329 | Bacteria | 4036 |
| 20 | Ga0070683_100422780 | 3300005329 | Bacteria | 1271 |
| 21 | Ga0070670_100045621 | 3300005331 | Bacteria | 3768 |
| 22 | Ga0070670_100052471 | 3300005331 | Bacteria | 3502 |
| 23 | Ga0068869_100051001 | 3300005334 | Bacteria | 3001 |
| 24 | Ga0068869_100079522 | 3300005334 | Bacteria | 2443 |
| 25 | Ga0070666_10024006 | 3300005335 | Bacteria | 3971 |
| 26 | Ga0070680_100246458 | 3300005336 | Bacteria | 1510 |
| 27 | Ga0070680_100281513 | 3300005336 | Bacteria | 1409 |
| 28 | Ga0068868_100579538 | 3300005338 | Bacteria | 992 |
| 29 | Ga0070660_100042442 | 3300005339 | Bacteria | 3471 |
| 30 | Ga0070660_100121560 | 3300005339 | Bacteria | 2084 |
| 31 | Ga0070689_100005552 | 3300005340 | Bacteria | 8626 |
| 32 | Ga0070661_100246336 | 3300005344 | Bacteria | 1378 |
| 33 | Ga0070669_100142253 | 3300005353 | Bacteria | 1850 |
| 34 | Ga0070675_100038109 | 3300005354 | Bacteria | 3917 |
| 35 | Ga0070675_100069281 | 3300005354 | Bacteria | 2922 |
| 36 | Ga0070675_100875220 | 3300005354 | Bacteria | 823 |
| 37 | Ga0070673_100015640 | 3300005364 | Bacteria | 5336 |
| 38 | Ga0070673_100201860 | 3300005364 | Bacteria | 1712 |
| 39 | Ga0070673_100509081 | 3300005364 | Bacteria | 1090 |
| 40 | Ga0070673_100538544 | 3300005364 | Bacteria | 1059 |
| 41 | Ga0070700_100118306 | 3300005441 | Bacteria | 1772 |
| 42 | Ga0070662_100035067 | 3300005457 | Bacteria | 3541 |
| 43 | Ga0070681_10218468 | 3300005458 | Bacteria | 1822 |
| 44 | Ga0068867_100026406 | 3300005459 | Bacteria | 4170 |
| 45 | Ga0068867_100043860 | 3300005459 | Bacteria | 3275 |
| 46 | Ga0068867_100044291 | 3300005459 | Bacteria | 3260 |
| 47 | Ga0068867_100189628 | 3300005459 | Bacteria | 1640 |
| 48 | Ga0068867_100361077 | 3300005459 | Bacteria | 1215 |
| 49 | Ga0070685_10046013 | 3300005466 | Bacteria | 2504 |
| 50 | Ga0070679_100016413 | 3300005530 | Bacteria | 7141 |
| 51 | Ga0070679_100060368 | 3300005530 | Bacteria | 3779 |
| 52 | Ga0070679_100648559 | 3300005530 | Bacteria | 998 |
| 53 | Ga0070684_100339862 | 3300005535 | Bacteria | 1380 |
| 54 | Ga0070684_100512850 | 3300005535 | Bacteria | 1111 |
| 55 | Ga0068855_100093294 | 3300005563 | Bacteria | 3471 |
| 56 | Ga0068855_100147476 | 3300005563 | Bacteria | 2677 |
| 57 | Ga0070664_100021517 | 3300005564 | Bacteria | 5316 |
| 58 | Ga0070664_100267950 | 3300005564 | Bacteria | 1538 |
| 59 | Ga0068857_100370205 | 3300005577 | Bacteria | 1329 |
| 60 | Ga0068854_100260727 | 3300005578 | Bacteria | 1388 |
| 61 | Ga0068856_100014270 | 3300005614 | Bacteria | 7682 |
| 62 | Ga0070702_100037384 | 3300005615 | Bacteria | 2696 |
| 63 | Ga0070702_100168862 | 3300005615 | Bacteria | 1421 |
| 64 | Ga0068852_100004584 | 3300005616 | Bacteria | 9786 |
| 65 | Ga0068852_100310666 | 3300005616 | Bacteria | 1528 |
| 66 | Ga0068852_100543847 | 3300005616 | Bacteria | 1161 |
| 67 | Ga0068859_100083833 | 3300005617 | Bacteria | 3231 |
| 68 | Ga0068859_101202391 | 3300005617 | Bacteria | 835 |
| 69 | Ga0068864_100394855 | 3300005618 | Bacteria | 1313 |
| 70 | Ga0068861_100003722 | 3300005719 | Bacteria | 10171 |
| 71 | Ga0068861_100067004 | 3300005719 | Bacteria | 2769 |
| 72 | Ga0068861_100084504 | 3300005719 | Bacteria | 2492 |
| 73 | Ga0068861_100646131 | 3300005719 | Bacteria | 977 |
| 74 | Ga0068851_10069679 | 3300005834 | Bacteria | 1817 |
| 75 | Ga0068870_10018783 | 3300005840 | Bacteria | 3343 |
| 76 | Ga0068870_10390730 | 3300005840 | Bacteria | 903 |
| 77 | Ga0068858_100200067 | 3300005842 | Bacteria | 1889 |
| 78 | Ga0068858_100254162 | 3300005842 | Bacteria | 1670 |
| 79 | Ga0068860_100264020 | 3300005843 | Bacteria | 1679 |
| 80 | Ga0068860_100292596 | 3300005843 | Bacteria | 1594 |
| 81 | Ga0068860_100396900 | 3300005843 | Bacteria | 1364 |
| 82 | Ga0068860_100455156 | 3300005843 | Bacteria | 1273 |
| 83 | Ga0068862_100001846 | 3300005844 | Bacteria | 19205 |
| 84 | Ga0068862_100348326 | 3300005844 | Bacteria | 1374 |
| 85 | Ga0075366_10015555 | 3300006195 | Bacteria | 4364 |
| 86 | Ga0075366_10256875 | 3300006195 | Bacteria | 1066 |
| 87 | Ga0068871_100284508 | 3300006358 | Bacteria | 1447 |
| 88 | Ga0097620_100083839 | 3300006931 | Bacteria | 3231 |
| 89 | Ga0097620_101202446 | 3300006931 | Bacteria | 835 |
| 90 | Ga0111539_10030939 | 3300009094 | Bacteria | 6504 |
| 91 | Ga0105247_10001960 | 3300009101 | Bacteria | 14314 |
| 92 | Ga0105243_10086995 | 3300009148 | Bacteria | 2564 |
| 93 | Ga0105242_10097719 | 3300009176 | Bacteria | 2483 |
| 94 | Ga0105242_10414254 | 3300009176 | Bacteria | 1261 |
| 95 | Ga0105249_10010218 | 3300009553 | Bacteria | 8243 |
| 96 | Ga0105249_10248796 | 3300009553 | Bacteria | 1761 |
| 97 | Ga0105239_10108087 | 3300010375 | Bacteria | 3082 |
| 98 | Ga0105239_10886688 | 3300010375 | Bacteria | 1024 |
| 99 | Ga0157373_10112275 | 3300013100 | Bacteria | 1916 |
| 100 | Ga0157373_10390612 | 3300013100 | Bacteria | 996 |
| 101 | Ga0157373_10411597 | 3300013100 | Bacteria | 970 |
| 102 | Ga0157373_10438423 | 3300013100 | Bacteria | 939 |
| 103 | Ga0157371_10235921 | 3300013102 | Bacteria | 1315 |
| 104 | Ga0157370_10000263 | 3300013104 | Bacteria | 66700 |
| 105 | Ga0157370_10040110 | 3300013104 | Bacteria | 4521 |
| 106 | Ga0157370_10300908 | 3300013104 | Bacteria | 1481 |
| 107 | Ga0157370_10360536 | 3300013104 | Bacteria | 1340 |
| 108 | Ga0157370_10521452 | 3300013104 | Bacteria | 1090 |
| 109 | Ga0157369_10018964 | 3300013105 | Bacteria | 7705 |
| 110 | Ga0157369_10143018 | 3300013105 | Bacteria | 2530 |
| 111 | Ga0157374_10093860 | 3300013296 | Bacteria | 2866 |
| 112 | Ga0157374_10303341 | 3300013296 | Bacteria | 1580 |
| 113 | Ga0157378_10070192 | 3300013297 | Bacteria | 3145 |
| 114 | Ga0157378_10265627 | 3300013297 | Bacteria | 1648 |
| 115 | Ga0163162_10008228 | 3300013306 | Bacteria | 10180 |
| 116 | Ga0163162_10522511 | 3300013306 | Bacteria | 1316 |
| 117 | Ga0157372_10179954 | 3300013307 | Bacteria | 2447 |
| 118 | Ga0157372_10251374 | 3300013307 | Bacteria | 2052 |
| 119 | Ga0157372_10382191 | 3300013307 | Bacteria | 1641 |
| 120 | Ga0157372_10389715 | 3300013307 | Bacteria | 1623 |
| 121 | Ga0157372_10545156 | 3300013307 | Bacteria | 1352 |
| 122 | Ga0157372_10547575 | 3300013307 | Bacteria | 1349 |
| 123 | Ga0157372_10593173 | 3300013307 | Bacteria | 1291 |
| 124 | Ga0157372_10779968 | 3300013307 | Bacteria | 1111 |
| 125 | Ga0157372_10943697 | 3300013307 | Bacteria | 1000 |
| 126 | Ga0157375_10020661 | 3300013308 | Bacteria | 6020 |
| 127 | Ga0157375_10249320 | 3300013308 | Bacteria | 1936 |
| 128 | Ga0157375_10367105 | 3300013308 | Bacteria | 1606 |
| 129 | Ga0163163_10012099 | 3300014325 | Bacteria | 7852 |
| 130 | Ga0163163_10266199 | 3300014325 | Bacteria | 1765 |
| 131 | Ga0157380_10000038 | 3300014326 | Bacteria | 78487 |
| 132 | Ga0157380_10190878 | 3300014326 | Bacteria | 1808 |
| 133 | Ga0157377_10003612 | 3300014745 | Bacteria | 7007 |
| 134 | Ga0157377_10229918 | 3300014745 | Bacteria | 1192 |
| 135 | Ga0209050_1011973 | 3300025298 | Bacteria | 4039 |
| 136 | Ga0207697_10049929 | 3300025315 | Bacteria | 1727 |
| 137 | Ga0207710_10000402 | 3300025900 | Bacteria | 28743 |
| 138 | Ga0207688_10044351 | 3300025901 | Bacteria | 2478 |
| 139 | Ga0207647_10341810 | 3300025904 | Bacteria | 848 |
| 140 | Ga0207643_10008516 | 3300025908 | Bacteria | 5501 |
| 141 | Ga0207705_10018203 | 3300025909 | Bacteria | 5022 |
| 142 | Ga0207707_10488224 | 3300025912 | Bacteria | 1051 |
| 143 | Ga0207660_10414270 | 3300025917 | Bacteria | 1086 |
| 144 | Ga0207657_10011684 | 3300025919 | Bacteria | 8701 |
| 145 | Ga0207657_10040619 | 3300025919 | Unclassified | 4120 |
| 146 | Ga0207657_10047393 | 3300025919 | Bacteria | 3758 |
| 147 | Ga0207652_10003426 | 3300025921 | Bacteria | 13089 |
| 148 | Ga0207652_10244354 | 3300025921 | Bacteria | 1618 |
| 149 | Ga0207650_10011970 | 3300025925 | Bacteria | 5980 |
| 150 | Ga0207650_10217565 | 3300025925 | Bacteria | 1536 |
| 151 | Ga0207659_10035323 | 3300025926 | Bacteria | 3454 |
| 152 | Ga0207659_10558919 | 3300025926 | Bacteria | 973 |
| 153 | Ga0207644_10030541 | 3300025931 | Bacteria | 3749 |
| 154 | Ga0207644_10164578 | 3300025931 | Bacteria | 1727 |
| 155 | Ga0207706_10038970 | 3300025933 | Bacteria | 4215 |
| 156 | Ga0207686_10272489 | 3300025934 | Bacteria | 1246 |
| 157 | Ga0207670_10106031 | 3300025936 | Bacteria | 2015 |
| 158 | Ga0207669_10104826 | 3300025937 | Bacteria | 1879 |
| 159 | Ga0207689_10022557 | 3300025942 | Bacteria | 5290 |
| 160 | Ga0207689_10063044 | 3300025942 | Bacteria | 3049 |
| 161 | Ga0207689_10503458 | 3300025942 | Bacteria | 1015 |
| 162 | Ga0207661_10068137 | 3300025944 | Bacteria | 2897 |
| 163 | Ga0207679_10310507 | 3300025945 | Bacteria | 1362 |
| 164 | Ga0207679_10314481 | 3300025945 | Bacteria | 1354 |
| 165 | Ga0207679_10430395 | 3300025945 | Bacteria | 1166 |
| 166 | Ga0207667_10126177 | 3300025949 | Bacteria | 2636 |
| 167 | Ga0207712_10098223 | 3300025961 | Bacteria | 2171 |
| 168 | Ga0207668_10029317 | 3300025972 | Bacteria | 3607 |
| 169 | Ga0207640_10208624 | 3300025981 | Bacteria | 1486 |
| 170 | Ga0207640_10397426 | 3300025981 | Bacteria | 1121 |
| 171 | Ga0207677_10124763 | 3300026023 | Bacteria | 1944 |
| 172 | Ga0207677_10400013 | 3300026023 | Bacteria | 1164 |
| 173 | Ga0207703_10161075 | 3300026035 | Bacteria | 1965 |
| 174 | Ga0207703_10310194 | 3300026035 | Bacteria | 1442 |
| 175 | Ga0207639_10062835 | 3300026041 | Bacteria | 2873 |
| 176 | Ga0207702_10156912 | 3300026078 | Bacteria | 2075 |
| 177 | Ga0207641_10344297 | 3300026088 | Bacteria | 1419 |
| 178 | Ga0207641_10589184 | 3300026088 | Bacteria | 1088 |
| 179 | Ga0207648_10001472 | 3300026089 | Bacteria | 25920 |
| 180 | Ga0207648_10314652 | 3300026089 | Bacteria | 1406 |
| 181 | Ga0207648_10316426 | 3300026089 | Bacteria | 1402 |
| 182 | Ga0207676_10094143 | 3300026095 | Bacteria | 2468 |
| 183 | Ga0207674_10085805 | 3300026116 | Bacteria | 3143 |
| 184 | Ga0207674_10086903 | 3300026116 | Bacteria | 3121 |
| 185 | Ga0207674_10250443 | 3300026116 | Bacteria | 1718 |
| 186 | Ga0207674_10606747 | 3300026116 | Bacteria | 1057 |
| 187 | Ga0207674_10717096 | 3300026116 | Bacteria | 965 |
| 188 | Ga0207675_100000326 | 3300026118 | Bacteria | 45358 |
| 189 | Ga0207675_100088494 | 3300026118 | Bacteria | 2909 |
| 190 | Ga0207675_100138665 | 3300026118 | Bacteria | 2309 |
| 191 | Ga0207675_100565476 | 3300026118 | Bacteria | 1137 |
| 192 | Ga0207675_100790663 | 3300026118 | Bacteria | 962 |
| 193 | Ga0207683_10270054 | 3300026121 | Bacteria | 1553 |
| 194 | Ga0207698_10228438 | 3300026142 | Bacteria | 1687 |
| 195 | Ga0209974_10053888 | 3300027876 | Bacteria | 1355 |
| 196 | Ga0268265_10306369 | 3300028380 | Bacteria | 1432 |
| 197 | Ga0268265_10462583 | 3300028380 | Bacteria | 1187 |
| 198 | Ga0268264_10049534 | 3300028381 | Bacteria | 3495 |
| 199 | Ga0265324_10078425 | 3300029957 | Bacteria | 1124 |
| 200 | Ga0265339_10075301 | 3300031249 | Bacteria | 1792 |
| 201 | Ga0265316_10004228 | 3300031344 | Bacteria | 14342 |
| 202 | Ga0307513_10032496 | 3300031456 | Bacteria | 5883 |
| 203 | Ga0307408_100000389 | 3300031548 | Bacteria | 40047 |
| 204 | Ga0316575_10001864 | 3300031665 | Bacteria | 6936 |
| 205 | Ga0265342_10000260 | 3300031712 | Bacteria | 59291 |
| 206 | Ga0307412_10096152 | 3300031911 | Bacteria | 2084 |
| 207 | Ga0373937_0413784 | 3300036401 | Bacteria | 1279 |
| 208 | Ga0451853_3770812 | 3300041512 | Bacteria | 1326 |
| 209 | Ga0439431_0004255 | 3300041997 | Bacteria | 3142 |
| 210 | Ga0450923_000172 | 3300042125 | Bacteria | 6008 |
| 211 | Ga0451577_0080423 | 3300042876 | Bacteria | 2906 |
| 212 | Ga0451577_0557572 | 3300042876 | Bacteria | 1040 |
| 213 | Ga0466972_0008769 | 3300044658 | Bacteria | 5072 |
| 214 | Ga0466982_0038491 | 3300044672 | Bacteria | 2884 |
| 215 | Ga0466965_0079538 | 3300044683 | Bacteria | 1656 |
| 216 | Ga0466964_0073064 | 3300044706 | Bacteria | 1455 |
| 217 | Ga0453684_0001177 | 3300044712 | Bacteria | 81167 |
| 218 | Ga0453684_0024925 | 3300044712 | Bacteria | 8709 |
| 219 | Ga0453684_0102698 | 3300044712 | Bacteria | 3495 |
| 220 | Ga0453684_0206583 | 3300044712 | Bacteria | 2285 |
| 221 | Ga0453684_0399824 | 3300044712 | Bacteria | 1539 |
| 222 | Ga0466970_0034855 | 3300044765 | Bacteria | 2665 |
| 223 | Ga0466960_0256447 | 3300044901 | Bacteria | 973 |
| 224 | Ga0451576_0051766 | 3300045051 | Bacteria | 4305 |
| 225 | Ga0451576_0286026 | 3300045051 | Bacteria | 1724 |
| 226 | Ga0451576_0419380 | 3300045051 | Bacteria | 1404 |
| 227 | Ga0466967_0030803 | 3300045976 | Bacteria | 4506 |
| 228 | Ga0495638_0000121 | 3300046460 | Bacteria | 126440 |
| 229 | Ga0495668_0001412 | 3300046616 | Bacteria | 23403 |
| 230 | Ga0495625_0197916 | 3300046660 | Bacteria | 1328 |
| 231 | Ga0495625_0296788 | 3300046660 | Bacteria | 1035 |
| 232 | Ga0495674_0250125 | 3300047319 | Bacteria | 1459 |
| 233 | Ga0495672_0010073 | 3300047320 | Bacteria | 6766 |
| 234 | Ga0495672_0027491 | 3300047320 | Bacteria | 3614 |
| 235 | Ga0495686_0010384 | 3300047472 | Bacteria | 6628 |
| 236 | Ga0501031_0092582 | 3300049568 | Bacteria | 1972 |
| 237 | Ga0501032_0146848 | 3300049569 | Bacteria | 1552 |
| 238 | Ga0501034_0000410 | 3300049571 | Bacteria | 72148 |
| 239 | Ga0501034_0261489 | 3300049571 | Bacteria | 1673 |
| 240 | Ga0501036_0092754 | 3300049572 | Bacteria | 2551 |
| 241 | Ga0501037_0076590 | 3300049573 | Bacteria | 2428 |
| 242 | Ga0501038_0140087 | 3300049574 | Bacteria | 1979 |
| 243 | Ga0501039_0021533 | 3300049575 | Bacteria | 4944 |
| 244 | Ga0501043_0015489 | 3300049579 | Bacteria | 5973 |
| 245 | Ga0501043_0207202 | 3300049579 | Bacteria | 1520 |
| 246 | Ga0501070_0022775 | 3300049586 | Bacteria | 5244 |
| 247 | Ga0501221_081651 | 3300049704 | Bacteria | 779 |
| 248 | Ga0501035_0107318 | 3300049822 | Bacteria | 2448 |
| 249 | Ga0501035_0473145 | 3300049822 | Bacteria | 1034 |
| 250 | Ga0501044_0012233 | 3300049823 | Bacteria | 9292 |
| 251 | Ga0501044_0097796 | 3300049823 | Bacteria | 2956 |
| 252 | Ga0501044_0211579 | 3300049823 | Bacteria | 1893 |
| 253 | Ga0501284_00021 | 3300050005 | Bacteria | 89729 |
| 254 | nmdc:mga0k408_5067_c1 | 3300050493 | Bacteria | 6981 |
| 255 | Ga0500578_0000150 | 3300053086 | Bacteria | 83541 |
| 256 | Ga0500583_0040426 | 3300053092 | Bacteria | 2113 |
| 257 | Ga0500641_0024124 | 3300053096 | Bacteria | 2343 |
| 258 | Ga0500616_0000004 | 3300053153 | Bacteria | 1002714 |
| 259 | Ga0500616_0043042 | 3300053153 | Bacteria | 2415 |
| 260 | Ga0500611_000006 | 3300053727 | Bacteria | 226069 |
| 261 | Ga0500645_034285 | 3300053730 | Bacteria | 1516 |
| 262 | Ga0500645_060690 | 3300053730 | Bacteria | 1094 |
| 263 | Ga0501082_0302198 | 3300060353 | Bacteria | 1394 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049704 | Ga0501221_081651 | Ga0501221_081651_36_698 | 216 |
| 2 | 3300013307 | Ga0157372_10593173 | Ga0157372_105931732 | 221 |
| 3 | 3300053730 | Ga0500645_060690 | Ga0500645_060690_396_1079 | 223 |
| 4 | 3300005719 | Ga0068861_100067004 | Ga0068861_1000670043 | 227 |
| 5 | 3300026118 | Ga0207675_100565476 | Ga0207675_1005654762 | 227 |
| 6 | 3300014326 | Ga0157380_10000038 | Ga0157380_1000003820 | 231 |
| 7 | 3300046660 | Ga0495625_0296788 | Ga0495625_0296788_216_932 | 233 |
| 8 | 3300031911 | Ga0307412_10096152 | Ga0307412_100961523 | 236 |
| 9 | 3300044683 | Ga0466965_0079538 | Ga0466965_0079538_688_1416 | 236 |
| 10 | 3300044706 | Ga0466964_0073064 | Ga0466964_0073064_172_894 | 236 |
| 11 | 3300044901 | Ga0466960_0256447 | Ga0466960_0256447_12_734 | 236 |
| 12 | 3300045976 | Ga0466967_0030803 | Ga0466967_0030803_2453_3175 | 236 |
| 13 | 3300046660 | Ga0495625_0197916 | Ga0495625_0197916_321_1061 | 236 |
| 14 | iso_pu_bacteria | 2896085136 | 2896088337 | 238 |
| 15 | iso_pu_bacteria | 2643221600 | 2644009901 | 239 |
| 16 | iso_pu_bacteria | 2643221667 | 2644369730 | 239 |
| 17 | iso_pu_bacteria | 2883068021 | 2883071736 | 239 |
| 18 | iso_pu_bacteria | 2896109856 | 2896111813 | 239 |
| 19 | iso_pu_bacteria | 2919191525 | 2919192018 | 239 |
| 20 | iso_pu_bacteria | 8054307821 | 8054310611 | 239 |
| 21 | 3300042876 | Ga0451577_0080423 | Ga0451577_0080423_1868_2590 | 240 |
| 22 | 3300031249 | Ga0265339_10075301 | Ga0265339_100753012 | 241 |
| 23 | 3300031344 | Ga0265316_10004228 | Ga0265316_1000422810 | 241 |
| 24 | 3300031665 | Ga0316575_10001864 | Ga0316575_100018643 | 241 |
| 25 | 3300031712 | Ga0265342_10000260 | Ga0265342_100002604 | 241 |
| 26 | 3300042876 | Ga0451577_0557572 | Ga0451577_0557572_68_805 | 241 |
| 27 | 3300044712 | Ga0453684_0001177 | Ga0453684_0001177_6006_6743 | 241 |
| 28 | 3300044712 | Ga0453684_0024925 | Ga0453684_0024925_22_756 | 241 |
| 29 | 3300044712 | Ga0453684_0102698 | Ga0453684_0102698_984_1721 | 241 |
| 30 | 3300045051 | Ga0451576_0051766 | Ga0451576_0051766_998_1735 | 241 |
| 31 | 3300045051 | Ga0451576_0419380 | Ga0451576_0419380_129_866 | 241 |
| 32 | 3300003320 | rootH2_10072708 | rootH2_1007270815 | 242 |
| 33 | 3300005344 | Ga0070661_100246336 | Ga0070661_1002463362 | 242 |
| 34 | 3300005354 | Ga0070675_100875220 | Ga0070675_1008752201 | 242 |
| 35 | 3300005364 | Ga0070673_100201860 | Ga0070673_1002018601 | 242 |
| 36 | 3300005564 | Ga0070664_100267950 | Ga0070664_1002679502 | 242 |
| 37 | 3300005615 | Ga0070702_100037384 | Ga0070702_1000373843 | 242 |
| 38 | 3300005840 | Ga0068870_10390730 | Ga0068870_103907302 | 242 |
| 39 | 3300005842 | Ga0068858_100254162 | Ga0068858_1002541622 | 242 |
| 40 | 3300009176 | Ga0105242_10414254 | Ga0105242_104142541 | 242 |
| 41 | 3300013296 | Ga0157374_10303341 | Ga0157374_103033411 | 242 |
| 42 | 3300013297 | Ga0157378_10070192 | Ga0157378_100701923 | 242 |
| 43 | 3300013306 | Ga0163162_10522511 | Ga0163162_105225112 | 242 |
| 44 | 3300013308 | Ga0157375_10367105 | Ga0157375_103671051 | 242 |
| 45 | 3300014745 | Ga0157377_10003612 | Ga0157377_100036125 | 242 |
| 46 | 3300025901 | Ga0207688_10044351 | Ga0207688_100443513 | 242 |
| 47 | 3300025934 | Ga0207686_10272489 | Ga0207686_102724891 | 242 |
| 48 | 3300025945 | Ga0207679_10310507 | Ga0207679_103105071 | 242 |
| 49 | 3300025981 | Ga0207640_10397426 | Ga0207640_103974261 | 242 |
| 50 | 3300026023 | Ga0207677_10400013 | Ga0207677_104000131 | 242 |
| 51 | 3300026035 | Ga0207703_10161075 | Ga0207703_101610752 | 242 |
| 52 | 3300026088 | Ga0207641_10589184 | Ga0207641_105891841 | 242 |
| 53 | 3300031548 | Ga0307408_100000389 | Ga0307408_10000038916 | 242 |
| 54 | 3300044712 | Ga0453684_0206583 | Ga0453684_0206583_121_867 | 242 |
| 55 | 2162886007 | SwRhRL2b_contig_449108 | SwRhRL2b_0071.00006730 | 243 |
| 56 | 3300003320 | rootH2_10006910 | rootH2_1000691012 | 243 |
| 57 | 3300003322 | rootL2_10032084 | rootL2_100320848 | 243 |
| 58 | 3300003322 | rootL2_10108747 | rootL2_101087474 | 243 |
| 59 | 3300003322 | rootL2_10224709 | rootL2_102247092 | 243 |
| 60 | 3300003323 | rootH1_10011906 | rootH1_100119067 | 243 |
| 61 | 3300003323 | rootH1_10059685 | rootH1_1005968515 | 243 |
| 62 | 3300003323 | rootH1_10068010 | rootH1_1006801011 | 243 |
| 63 | 3300005288 | Ga0065714_10156490 | Ga0065714_101564901 | 243 |
| 64 | 3300005289 | Ga0065704_10071719 | Ga0065704_100717197 | 243 |
| 65 | 3300005289 | Ga0065704_10107451 | Ga0065704_101074512 | 243 |
| 66 | 3300005290 | Ga0065712_10003559 | Ga0065712_100035594 | 243 |
| 67 | 3300005290 | Ga0065712_10003882 | Ga0065712_100038823 | 243 |
| 68 | 3300005290 | Ga0065712_10122019 | Ga0065712_101220192 | 243 |
| 69 | 3300005293 | Ga0065715_10112754 | Ga0065715_101127542 | 243 |
| 70 | 3300005327 | Ga0070658_10059816 | Ga0070658_100598163 | 243 |
| 71 | 3300005328 | Ga0070676_10174996 | Ga0070676_101749962 | 243 |
| 72 | 3300005329 | Ga0070683_100045843 | Ga0070683_1000458434 | 243 |
| 73 | 3300005329 | Ga0070683_100422780 | Ga0070683_1004227802 | 243 |
| 74 | 3300005331 | Ga0070670_100045621 | Ga0070670_1000456214 | 243 |
| 75 | 3300005331 | Ga0070670_100052471 | Ga0070670_1000524712 | 243 |
| 76 | 3300005334 | Ga0068869_100051001 | Ga0068869_1000510012 | 243 |
| 77 | 3300005334 | Ga0068869_100079522 | Ga0068869_1000795222 | 243 |
| 78 | 3300005335 | Ga0070666_10024006 | Ga0070666_100240063 | 243 |
| 79 | 3300005336 | Ga0070680_100246458 | Ga0070680_1002464581 | 243 |
| 80 | 3300005336 | Ga0070680_100281513 | Ga0070680_1002815131 | 243 |
| 81 | 3300005338 | Ga0068868_100579538 | Ga0068868_1005795382 | 243 |
| 82 | 3300005339 | Ga0070660_100042442 | Ga0070660_1000424421 | 243 |
| 83 | 3300005339 | Ga0070660_100121560 | Ga0070660_1001215602 | 243 |
| 84 | 3300005340 | Ga0070689_100005552 | Ga0070689_10000555212 | 243 |
| 85 | 3300005353 | Ga0070669_100142253 | Ga0070669_1001422532 | 243 |
| 86 | 3300005354 | Ga0070675_100038109 | Ga0070675_1000381095 | 243 |
| 87 | 3300005354 | Ga0070675_100069281 | Ga0070675_1000692814 | 243 |
| 88 | 3300005364 | Ga0070673_100015640 | Ga0070673_1000156402 | 243 |
| 89 | 3300005364 | Ga0070673_100509081 | Ga0070673_1005090811 | 243 |
| 90 | 3300005364 | Ga0070673_100538544 | Ga0070673_1005385442 | 243 |
| 91 | 3300005441 | Ga0070700_100118306 | Ga0070700_1001183062 | 243 |
| 92 | 3300005457 | Ga0070662_100035067 | Ga0070662_1000350672 | 243 |
| 93 | 3300005458 | Ga0070681_10218468 | Ga0070681_102184682 | 243 |
| 94 | 3300005459 | Ga0068867_100026406 | Ga0068867_1000264062 | 243 |
| 95 | 3300005459 | Ga0068867_100043860 | Ga0068867_1000438602 | 243 |
| 96 | 3300005459 | Ga0068867_100044291 | Ga0068867_1000442914 | 243 |
| 97 | 3300005459 | Ga0068867_100189628 | Ga0068867_1001896282 | 243 |
| 98 | 3300005459 | Ga0068867_100361077 | Ga0068867_1003610772 | 243 |
| 99 | 3300005466 | Ga0070685_10046013 | Ga0070685_100460133 | 243 |
| 100 | 3300005530 | Ga0070679_100016413 | Ga0070679_1000164134 | 243 |
| 101 | 3300005530 | Ga0070679_100060368 | Ga0070679_1000603682 | 243 |
| 102 | 3300005530 | Ga0070679_100648559 | Ga0070679_1006485592 | 243 |
| 103 | 3300005535 | Ga0070684_100339862 | Ga0070684_1003398622 | 243 |
| 104 | 3300005535 | Ga0070684_100512850 | Ga0070684_1005128502 | 243 |
| 105 | 3300005563 | Ga0068855_100093294 | Ga0068855_1000932944 | 243 |
| 106 | 3300005563 | Ga0068855_100147476 | Ga0068855_1001474763 | 243 |
| 107 | 3300005564 | Ga0070664_100021517 | Ga0070664_1000215173 | 243 |
| 108 | 3300005577 | Ga0068857_100370205 | Ga0068857_1003702052 | 243 |
| 109 | 3300005578 | Ga0068854_100260727 | Ga0068854_1002607271 | 243 |
| 110 | 3300005614 | Ga0068856_100014270 | Ga0068856_1000142707 | 243 |
| 111 | 3300005615 | Ga0070702_100168862 | Ga0070702_1001688622 | 243 |
| 112 | 3300005616 | Ga0068852_100004584 | Ga0068852_1000045847 | 243 |
| 113 | 3300005616 | Ga0068852_100310666 | Ga0068852_1003106661 | 243 |
| 114 | 3300005616 | Ga0068852_100543847 | Ga0068852_1005438472 | 243 |
| 115 | 3300005617 | Ga0068859_100083833 | Ga0068859_1000838331 | 243 |
| 116 | 3300005617 | Ga0068859_101202391 | Ga0068859_1012023911 | 243 |
| 117 | 3300005618 | Ga0068864_100394855 | Ga0068864_1003948552 | 243 |
| 118 | 3300005719 | Ga0068861_100003722 | Ga0068861_1000037229 | 243 |
| 119 | 3300005719 | Ga0068861_100084504 | Ga0068861_1000845042 | 243 |
| 120 | 3300005719 | Ga0068861_100646131 | Ga0068861_1006461312 | 243 |
| 121 | 3300005834 | Ga0068851_10069679 | Ga0068851_100696792 | 243 |
| 122 | 3300005840 | Ga0068870_10018783 | Ga0068870_100187833 | 243 |
| 123 | 3300005842 | Ga0068858_100200067 | Ga0068858_1002000672 | 243 |
| 124 | 3300005843 | Ga0068860_100264020 | Ga0068860_1002640202 | 243 |
| 125 | 3300005843 | Ga0068860_100292596 | Ga0068860_1002925962 | 243 |
| 126 | 3300005843 | Ga0068860_100396900 | Ga0068860_1003969002 | 243 |
| 127 | 3300005843 | Ga0068860_100455156 | Ga0068860_1004551562 | 243 |
| 128 | 3300005844 | Ga0068862_100001846 | Ga0068862_10000184618 | 243 |
| 129 | 3300005844 | Ga0068862_100348326 | Ga0068862_1003483261 | 243 |
| 130 | 3300006195 | Ga0075366_10015555 | Ga0075366_100155557 | 243 |
| 131 | 3300006195 | Ga0075366_10256875 | Ga0075366_102568751 | 243 |
| 132 | 3300006358 | Ga0068871_100284508 | Ga0068871_1002845082 | 243 |
| 133 | 3300006931 | Ga0097620_100083839 | Ga0097620_1000838391 | 243 |
| 134 | 3300006931 | Ga0097620_101202446 | Ga0097620_1012024461 | 243 |
| 135 | 3300009094 | Ga0111539_10030939 | Ga0111539_100309392 | 243 |
| 136 | 3300009101 | Ga0105247_10001960 | Ga0105247_100019606 | 243 |
| 137 | 3300009148 | Ga0105243_10086995 | Ga0105243_100869952 | 243 |
| 138 | 3300009176 | Ga0105242_10097719 | Ga0105242_100977192 | 243 |
| 139 | 3300009553 | Ga0105249_10010218 | Ga0105249_100102184 | 243 |
| 140 | 3300009553 | Ga0105249_10248796 | Ga0105249_102487962 | 243 |
| 141 | 3300010375 | Ga0105239_10108087 | Ga0105239_101080873 | 243 |
| 142 | 3300010375 | Ga0105239_10886688 | Ga0105239_108866881 | 243 |
| 143 | 3300013100 | Ga0157373_10112275 | Ga0157373_101122752 | 243 |
| 144 | 3300013100 | Ga0157373_10390612 | Ga0157373_103906121 | 243 |
| 145 | 3300013100 | Ga0157373_10411597 | Ga0157373_104115972 | 243 |
| 146 | 3300013100 | Ga0157373_10438423 | Ga0157373_104384231 | 243 |
| 147 | 3300013102 | Ga0157371_10235921 | Ga0157371_102359212 | 243 |
| 148 | 3300013104 | Ga0157370_10000263 | Ga0157370_1000026377 | 243 |
| 149 | 3300013104 | Ga0157370_10040110 | Ga0157370_100401103 | 243 |
| 150 | 3300013104 | Ga0157370_10300908 | Ga0157370_103009082 | 243 |
| 151 | 3300013104 | Ga0157370_10360536 | Ga0157370_103605362 | 243 |
| 152 | 3300013104 | Ga0157370_10521452 | Ga0157370_105214522 | 243 |
| 153 | 3300013105 | Ga0157369_10018964 | Ga0157369_100189642 | 243 |
| 154 | 3300013105 | Ga0157369_10143018 | Ga0157369_101430183 | 243 |
| 155 | 3300013296 | Ga0157374_10093860 | Ga0157374_100938603 | 243 |
| 156 | 3300013297 | Ga0157378_10265627 | Ga0157378_102656272 | 243 |
| 157 | 3300013306 | Ga0163162_10008228 | Ga0163162_100082289 | 243 |
| 158 | 3300013307 | Ga0157372_10179954 | Ga0157372_101799543 | 243 |
| 159 | 3300013307 | Ga0157372_10251374 | Ga0157372_102513742 | 243 |
| 160 | 3300013307 | Ga0157372_10382191 | Ga0157372_103821912 | 243 |
| 161 | 3300013307 | Ga0157372_10389715 | Ga0157372_103897152 | 243 |
| 162 | 3300013307 | Ga0157372_10545156 | Ga0157372_105451562 | 243 |
| 163 | 3300013307 | Ga0157372_10547575 | Ga0157372_105475752 | 243 |
| 164 | 3300013307 | Ga0157372_10779968 | Ga0157372_107799682 | 243 |
| 165 | 3300013307 | Ga0157372_10943697 | Ga0157372_109436972 | 243 |
| 166 | 3300013308 | Ga0157375_10020661 | Ga0157375_100206613 | 243 |
| 167 | 3300013308 | Ga0157375_10249320 | Ga0157375_102493202 | 243 |
| 168 | 3300014325 | Ga0163163_10012099 | Ga0163163_100120998 | 243 |
| 169 | 3300014325 | Ga0163163_10266199 | Ga0163163_102661992 | 243 |
| 170 | 3300014326 | Ga0157380_10190878 | Ga0157380_101908782 | 243 |
| 171 | 3300014745 | Ga0157377_10229918 | Ga0157377_102299182 | 243 |
| 172 | 3300025298 | Ga0209050_1011973 | Ga0209050_10119732 | 243 |
| 173 | 3300025315 | Ga0207697_10049929 | Ga0207697_100499292 | 243 |
| 174 | 3300025900 | Ga0207710_10000402 | Ga0207710_1000040219 | 243 |
| 175 | 3300025904 | Ga0207647_10341810 | Ga0207647_103418101 | 243 |
| 176 | 3300025908 | Ga0207643_10008516 | Ga0207643_100085163 | 243 |
| 177 | 3300025909 | Ga0207705_10018203 | Ga0207705_100182034 | 243 |
| 178 | 3300025912 | Ga0207707_10488224 | Ga0207707_104882242 | 243 |
| 179 | 3300025917 | Ga0207660_10414270 | Ga0207660_104142702 | 243 |
| 180 | 3300025919 | Ga0207657_10011684 | Ga0207657_100116842 | 243 |
| 181 | 3300025919 | Ga0207657_10040619 | Ga0207657_100406191 | 243 |
| 182 | 3300025919 | Ga0207657_10047393 | Ga0207657_100473931 | 243 |
| 183 | 3300025921 | Ga0207652_10003426 | Ga0207652_100034265 | 243 |
| 184 | 3300025921 | Ga0207652_10244354 | Ga0207652_102443542 | 243 |
| 185 | 3300025925 | Ga0207650_10011970 | Ga0207650_100119702 | 243 |
| 186 | 3300025925 | Ga0207650_10217565 | Ga0207650_102175652 | 243 |
| 187 | 3300025926 | Ga0207659_10035323 | Ga0207659_100353232 | 243 |
| 188 | 3300025926 | Ga0207659_10558919 | Ga0207659_105589192 | 243 |
| 189 | 3300025931 | Ga0207644_10030541 | Ga0207644_100305412 | 243 |
| 190 | 3300025931 | Ga0207644_10164578 | Ga0207644_101645782 | 243 |
| 191 | 3300025933 | Ga0207706_10038970 | Ga0207706_100389702 | 243 |
| 192 | 3300025936 | Ga0207670_10106031 | Ga0207670_101060312 | 243 |
| 193 | 3300025937 | Ga0207669_10104826 | Ga0207669_101048262 | 243 |
| 194 | 3300025942 | Ga0207689_10022557 | Ga0207689_100225575 | 243 |
| 195 | 3300025942 | Ga0207689_10063044 | Ga0207689_100630441 | 243 |
| 196 | 3300025942 | Ga0207689_10503458 | Ga0207689_105034581 | 243 |
| 197 | 3300025944 | Ga0207661_10068137 | Ga0207661_100681374 | 243 |
| 198 | 3300025945 | Ga0207679_10314481 | Ga0207679_103144812 | 243 |
| 199 | 3300025945 | Ga0207679_10430395 | Ga0207679_104303952 | 243 |
| 200 | 3300025949 | Ga0207667_10126177 | Ga0207667_101261773 | 243 |
| 201 | 3300025961 | Ga0207712_10098223 | Ga0207712_100982232 | 243 |
| 202 | 3300025972 | Ga0207668_10029317 | Ga0207668_100293173 | 243 |
| 203 | 3300025981 | Ga0207640_10208624 | Ga0207640_102086242 | 243 |
| 204 | 3300026023 | Ga0207677_10124763 | Ga0207677_101247632 | 243 |
| 205 | 3300026035 | Ga0207703_10310194 | Ga0207703_103101942 | 243 |
| 206 | 3300026041 | Ga0207639_10062835 | Ga0207639_100628351 | 243 |
| 207 | 3300026078 | Ga0207702_10156912 | Ga0207702_101569122 | 243 |
| 208 | 3300026088 | Ga0207641_10344297 | Ga0207641_103442972 | 243 |
| 209 | 3300026089 | Ga0207648_10001472 | Ga0207648_1000147225 | 243 |
| 210 | 3300026089 | Ga0207648_10314652 | Ga0207648_103146521 | 243 |
| 211 | 3300026089 | Ga0207648_10316426 | Ga0207648_103164262 | 243 |
| 212 | 3300026095 | Ga0207676_10094143 | Ga0207676_100941432 | 243 |
| 213 | 3300026116 | Ga0207674_10085805 | Ga0207674_100858053 | 243 |
| 214 | 3300026116 | Ga0207674_10086903 | Ga0207674_100869032 | 243 |
| 215 | 3300026116 | Ga0207674_10250443 | Ga0207674_102504432 | 243 |
| 216 | 3300026116 | Ga0207674_10606747 | Ga0207674_106067471 | 243 |
| 217 | 3300026116 | Ga0207674_10717096 | Ga0207674_107170961 | 243 |
| 218 | 3300026118 | Ga0207675_100000326 | Ga0207675_10000032628 | 243 |
| 219 | 3300026118 | Ga0207675_100088494 | Ga0207675_1000884943 | 243 |
| 220 | 3300026118 | Ga0207675_100138665 | Ga0207675_1001386652 | 243 |
| 221 | 3300026118 | Ga0207675_100790663 | Ga0207675_1007906631 | 243 |
| 222 | 3300026121 | Ga0207683_10270054 | Ga0207683_102700541 | 243 |
| 223 | 3300026142 | Ga0207698_10228438 | Ga0207698_102284382 | 243 |
| 224 | 3300027876 | Ga0209974_10053888 | Ga0209974_100538882 | 243 |
| 225 | 3300028380 | Ga0268265_10306369 | Ga0268265_103063692 | 243 |
| 226 | 3300028380 | Ga0268265_10462583 | Ga0268265_104625832 | 243 |
| 227 | 3300028381 | Ga0268264_10049534 | Ga0268264_100495344 | 243 |
| 228 | 3300029957 | Ga0265324_10078425 | Ga0265324_100784251 | 243 |
| 229 | 3300031456 | Ga0307513_10032496 | Ga0307513_100324963 | 243 |
| 230 | 3300036401 | Ga0373937_0413784 | Ga0373937_0413784_403_1146 | 243 |
| 231 | 3300041512 | Ga0451853_3770812 | Ga0451853_3770812_539_1288 | 243 |
| 232 | 3300041997 | Ga0439431_0004255 | Ga0439431_0004255_2058_2789 | 243 |
| 233 | 3300042125 | Ga0450923_000172 | Ga0450923_000172_2848_3594 | 243 |
| 234 | 3300044658 | Ga0466972_0008769 | Ga0466972_0008769_253_999 | 243 |
| 235 | 3300044672 | Ga0466982_0038491 | Ga0466982_0038491_923_1663 | 243 |
| 236 | 3300044712 | Ga0453684_0399824 | Ga0453684_0399824_705_1448 | 243 |
| 237 | 3300044765 | Ga0466970_0034855 | Ga0466970_0034855_1592_2335 | 243 |
| 238 | 3300045051 | Ga0451576_0286026 | Ga0451576_0286026_824_1567 | 243 |
| 239 | 3300046460 | Ga0495638_0000121 | Ga0495638_0000121_24116_24856 | 243 |
| 240 | 3300046616 | Ga0495668_0001412 | Ga0495668_0001412_18578_19324 | 243 |
| 241 | 3300047319 | Ga0495674_0250125 | Ga0495674_0250125_116_859 | 243 |
| 242 | 3300047320 | Ga0495672_0010073 | Ga0495672_0010073_4461_5207 | 243 |
| 243 | 3300047320 | Ga0495672_0027491 | Ga0495672_0027491_2420_3193 | 243 |
| 244 | 3300047472 | Ga0495686_0010384 | Ga0495686_0010384_754_1500 | 243 |
| 245 | 3300049568 | Ga0501031_0092582 | Ga0501031_0092582_205_954 | 243 |
| 246 | 3300049569 | Ga0501032_0146848 | Ga0501032_0146848_52_801 | 243 |
| 247 | 3300049571 | Ga0501034_0000410 | Ga0501034_0000410_30957_31700 | 243 |
| 248 | 3300049571 | Ga0501034_0261489 | Ga0501034_0261489_306_1049 | 243 |
| 249 | 3300049572 | Ga0501036_0092754 | Ga0501036_0092754_989_1738 | 243 |
| 250 | 3300049573 | Ga0501037_0076590 | Ga0501037_0076590_1238_1987 | 243 |
| 251 | 3300049574 | Ga0501038_0140087 | Ga0501038_0140087_372_1121 | 243 |
| 252 | 3300049575 | Ga0501039_0021533 | Ga0501039_0021533_1848_2597 | 243 |
| 253 | 3300049579 | Ga0501043_0015489 | Ga0501043_0015489_1019_1768 | 243 |
| 254 | 3300049579 | Ga0501043_0207202 | Ga0501043_0207202_648_1394 | 243 |
| 255 | 3300049586 | Ga0501070_0022775 | Ga0501070_0022775_1049_1792 | 243 |
| 256 | 3300049822 | Ga0501035_0107318 | Ga0501035_0107318_1625_2374 | 243 |
| 257 | 3300049822 | Ga0501035_0473145 | Ga0501035_0473145_122_865 | 243 |
| 258 | 3300049823 | Ga0501044_0012233 | Ga0501044_0012233_4441_5190 | 243 |
| 259 | 3300049823 | Ga0501044_0097796 | Ga0501044_0097796_830_1576 | 243 |
| 260 | 3300049823 | Ga0501044_0211579 | Ga0501044_0211579_471_1211 | 243 |
| 261 | 3300050005 | Ga0501284_00021 | Ga0501284_00021_23280_24026 | 243 |
| 262 | 3300050493 | nmdc:mga0k408_5067_c1 | nmdc:mga0k408_5067_c1_2304_3050 | 243 |
| 263 | 3300053086 | Ga0500578_0000150 | Ga0500578_0000150_26917_27666 | 243 |
| 264 | 3300053092 | Ga0500583_0040426 | Ga0500583_0040426_873_1613 | 243 |
| 265 | 3300053096 | Ga0500641_0024124 | Ga0500641_0024124_598_1344 | 243 |
| 266 | 3300053153 | Ga0500616_0000004 | Ga0500616_0000004_640412_641152 | 243 |
| 267 | 3300053153 | Ga0500616_0043042 | Ga0500616_0043042_143_883 | 243 |
| 268 | 3300053727 | Ga0500611_000006 | Ga0500611_000006_108299_109045 | 243 |
| 269 | 3300053730 | Ga0500645_034285 | Ga0500645_034285_614_1360 | 243 |
| 270 | 3300060353 | Ga0501082_0302198 | Ga0501082_0302198_578_1327 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.957 | 3 | 225 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9551 | 3 | 225 |
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9536 | 4 | 218 |
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9485 | 5 | 237 |
| 7e7o-assembly1.cif.gz_A | cryo-em structure of human abca4 in nrpe-bound state | 0.9408 | 3 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VDR4_479_718_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9619 | 3 | 224 | 3.40.50.300 |
| af_P9WQL9_1_244_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9578 | 2 | 230 | 3.40.50.300 |
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9571 | 6 | 227 | 3.40.50.300 |
| af_P37624_268_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.956 | 1 | 243 | 3.40.50.300 |
| af_Q9VVK6_333_568_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9541 | 2 | 229 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2MRM8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9885 | 1 | 240 |
GO:0005524
GO:0016887 |
| AF-A0A4R2F7J7-F1-model_v4 | ABC-2 type transport system ATP-binding protein | 0.9876 | 1 | 239 |
GO:0005524
GO:0016887 |
| AF-A0A562PFS4-F1-model_v4 | ABC-2 type transport system ATP-binding protein | 0.9861 | 3 | 110 |
GO:0005524
GO:0016887 |
| AF-A0A428Z536-F1-model_v4 | Transport permease protein | 0.9808 | 3 | 226 |
GO:0005524
GO:0005886 GO:0016887 GO:0043215 GO:0046677 GO:0140359 GO:1900753 |
| AF-A0A7V3NIK6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9807 | 8 | 225 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar