F377013

General Info

Members Datasets Scaffolds Average Seq Length
270 160 263 248

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10397426|Ga0207640_103974261
Length 268
Sequence VFEGCGLLFLIRRYLSLITNHSMEKAITAEKLSKRFGAFTAVDEISFEVEKGEIFGFLGANGAGKTTAIRMLCGLSLPTSGKATVAGFDVFRENEKIKKNIGYMSQKFSLYEDLTVKENIRFYAGIYGMTDSYIRDQTISLLKQLHMEKEANLLVKSLPLGWKQKLAFSVAIFHHPKIVFLDEPTGGVDPVTRREFWIMIYEAAASGITVFVTTHYMDEAEYCNRVSIMVDGKIEALDSPGGLRKRFNAASMDDVFLKLARKATRSEV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
3 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
122 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
154 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
155 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
158 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0
Rhizoplane 0
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_449108 2162886007 Bacteria 1827
2 rootH2_10006910 3300003320 Bacteria 14945
3 rootH2_10072708 3300003320 Bacteria 30934
4 rootL2_10032084 3300003322 Bacteria 14316
5 rootL2_10108747 3300003322 Bacteria 13225
6 rootL2_10224709 3300003322 Bacteria 2330
7 rootH1_10011906 3300003323 Bacteria 17140
8 rootH1_10059685 3300003323 Bacteria 20803
9 rootH1_10068010 3300003323 Bacteria 13848
10 Ga0065714_10156490 3300005288 Bacteria 1075
11 Ga0065704_10071719 3300005289 Bacteria 10104
12 Ga0065704_10107451 3300005289 Bacteria 2055
13 Ga0065712_10003559 3300005290 Bacteria 3652
14 Ga0065712_10003882 3300005290 Bacteria 3480
15 Ga0065712_10122019 3300005290 Bacteria 1657
16 Ga0065715_10112754 3300005293 Bacteria 2517
17 Ga0070658_10059816 3300005327 Bacteria 3102
18 Ga0070676_10174996 3300005328 Unclassified 1391
19 Ga0070683_100045843 3300005329 Bacteria 4036
20 Ga0070683_100422780 3300005329 Bacteria 1271
21 Ga0070670_100045621 3300005331 Bacteria 3768
22 Ga0070670_100052471 3300005331 Bacteria 3502
23 Ga0068869_100051001 3300005334 Bacteria 3001
24 Ga0068869_100079522 3300005334 Bacteria 2443
25 Ga0070666_10024006 3300005335 Bacteria 3971
26 Ga0070680_100246458 3300005336 Bacteria 1510
27 Ga0070680_100281513 3300005336 Bacteria 1409
28 Ga0068868_100579538 3300005338 Bacteria 992
29 Ga0070660_100042442 3300005339 Bacteria 3471
30 Ga0070660_100121560 3300005339 Bacteria 2084
31 Ga0070689_100005552 3300005340 Bacteria 8626
32 Ga0070661_100246336 3300005344 Bacteria 1378
33 Ga0070669_100142253 3300005353 Bacteria 1850
34 Ga0070675_100038109 3300005354 Bacteria 3917
35 Ga0070675_100069281 3300005354 Bacteria 2922
36 Ga0070675_100875220 3300005354 Bacteria 823
37 Ga0070673_100015640 3300005364 Bacteria 5336
38 Ga0070673_100201860 3300005364 Bacteria 1712
39 Ga0070673_100509081 3300005364 Bacteria 1090
40 Ga0070673_100538544 3300005364 Bacteria 1059
41 Ga0070700_100118306 3300005441 Bacteria 1772
42 Ga0070662_100035067 3300005457 Bacteria 3541
43 Ga0070681_10218468 3300005458 Bacteria 1822
44 Ga0068867_100026406 3300005459 Bacteria 4170
45 Ga0068867_100043860 3300005459 Bacteria 3275
46 Ga0068867_100044291 3300005459 Bacteria 3260
47 Ga0068867_100189628 3300005459 Bacteria 1640
48 Ga0068867_100361077 3300005459 Bacteria 1215
49 Ga0070685_10046013 3300005466 Bacteria 2504
50 Ga0070679_100016413 3300005530 Bacteria 7141
51 Ga0070679_100060368 3300005530 Bacteria 3779
52 Ga0070679_100648559 3300005530 Bacteria 998
53 Ga0070684_100339862 3300005535 Bacteria 1380
54 Ga0070684_100512850 3300005535 Bacteria 1111
55 Ga0068855_100093294 3300005563 Bacteria 3471
56 Ga0068855_100147476 3300005563 Bacteria 2677
57 Ga0070664_100021517 3300005564 Bacteria 5316
58 Ga0070664_100267950 3300005564 Bacteria 1538
59 Ga0068857_100370205 3300005577 Bacteria 1329
60 Ga0068854_100260727 3300005578 Bacteria 1388
61 Ga0068856_100014270 3300005614 Bacteria 7682
62 Ga0070702_100037384 3300005615 Bacteria 2696
63 Ga0070702_100168862 3300005615 Bacteria 1421
64 Ga0068852_100004584 3300005616 Bacteria 9786
65 Ga0068852_100310666 3300005616 Bacteria 1528
66 Ga0068852_100543847 3300005616 Bacteria 1161
67 Ga0068859_100083833 3300005617 Bacteria 3231
68 Ga0068859_101202391 3300005617 Bacteria 835
69 Ga0068864_100394855 3300005618 Bacteria 1313
70 Ga0068861_100003722 3300005719 Bacteria 10171
71 Ga0068861_100067004 3300005719 Bacteria 2769
72 Ga0068861_100084504 3300005719 Bacteria 2492
73 Ga0068861_100646131 3300005719 Bacteria 977
74 Ga0068851_10069679 3300005834 Bacteria 1817
75 Ga0068870_10018783 3300005840 Bacteria 3343
76 Ga0068870_10390730 3300005840 Bacteria 903
77 Ga0068858_100200067 3300005842 Bacteria 1889
78 Ga0068858_100254162 3300005842 Bacteria 1670
79 Ga0068860_100264020 3300005843 Bacteria 1679
80 Ga0068860_100292596 3300005843 Bacteria 1594
81 Ga0068860_100396900 3300005843 Bacteria 1364
82 Ga0068860_100455156 3300005843 Bacteria 1273
83 Ga0068862_100001846 3300005844 Bacteria 19205
84 Ga0068862_100348326 3300005844 Bacteria 1374
85 Ga0075366_10015555 3300006195 Bacteria 4364
86 Ga0075366_10256875 3300006195 Bacteria 1066
87 Ga0068871_100284508 3300006358 Bacteria 1447
88 Ga0097620_100083839 3300006931 Bacteria 3231
89 Ga0097620_101202446 3300006931 Bacteria 835
90 Ga0111539_10030939 3300009094 Bacteria 6504
91 Ga0105247_10001960 3300009101 Bacteria 14314
92 Ga0105243_10086995 3300009148 Bacteria 2564
93 Ga0105242_10097719 3300009176 Bacteria 2483
94 Ga0105242_10414254 3300009176 Bacteria 1261
95 Ga0105249_10010218 3300009553 Bacteria 8243
96 Ga0105249_10248796 3300009553 Bacteria 1761
97 Ga0105239_10108087 3300010375 Bacteria 3082
98 Ga0105239_10886688 3300010375 Bacteria 1024
99 Ga0157373_10112275 3300013100 Bacteria 1916
100 Ga0157373_10390612 3300013100 Bacteria 996
101 Ga0157373_10411597 3300013100 Bacteria 970
102 Ga0157373_10438423 3300013100 Bacteria 939
103 Ga0157371_10235921 3300013102 Bacteria 1315
104 Ga0157370_10000263 3300013104 Bacteria 66700
105 Ga0157370_10040110 3300013104 Bacteria 4521
106 Ga0157370_10300908 3300013104 Bacteria 1481
107 Ga0157370_10360536 3300013104 Bacteria 1340
108 Ga0157370_10521452 3300013104 Bacteria 1090
109 Ga0157369_10018964 3300013105 Bacteria 7705
110 Ga0157369_10143018 3300013105 Bacteria 2530
111 Ga0157374_10093860 3300013296 Bacteria 2866
112 Ga0157374_10303341 3300013296 Bacteria 1580
113 Ga0157378_10070192 3300013297 Bacteria 3145
114 Ga0157378_10265627 3300013297 Bacteria 1648
115 Ga0163162_10008228 3300013306 Bacteria 10180
116 Ga0163162_10522511 3300013306 Bacteria 1316
117 Ga0157372_10179954 3300013307 Bacteria 2447
118 Ga0157372_10251374 3300013307 Bacteria 2052
119 Ga0157372_10382191 3300013307 Bacteria 1641
120 Ga0157372_10389715 3300013307 Bacteria 1623
121 Ga0157372_10545156 3300013307 Bacteria 1352
122 Ga0157372_10547575 3300013307 Bacteria 1349
123 Ga0157372_10593173 3300013307 Bacteria 1291
124 Ga0157372_10779968 3300013307 Bacteria 1111
125 Ga0157372_10943697 3300013307 Bacteria 1000
126 Ga0157375_10020661 3300013308 Bacteria 6020
127 Ga0157375_10249320 3300013308 Bacteria 1936
128 Ga0157375_10367105 3300013308 Bacteria 1606
129 Ga0163163_10012099 3300014325 Bacteria 7852
130 Ga0163163_10266199 3300014325 Bacteria 1765
131 Ga0157380_10000038 3300014326 Bacteria 78487
132 Ga0157380_10190878 3300014326 Bacteria 1808
133 Ga0157377_10003612 3300014745 Bacteria 7007
134 Ga0157377_10229918 3300014745 Bacteria 1192
135 Ga0209050_1011973 3300025298 Bacteria 4039
136 Ga0207697_10049929 3300025315 Bacteria 1727
137 Ga0207710_10000402 3300025900 Bacteria 28743
138 Ga0207688_10044351 3300025901 Bacteria 2478
139 Ga0207647_10341810 3300025904 Bacteria 848
140 Ga0207643_10008516 3300025908 Bacteria 5501
141 Ga0207705_10018203 3300025909 Bacteria 5022
142 Ga0207707_10488224 3300025912 Bacteria 1051
143 Ga0207660_10414270 3300025917 Bacteria 1086
144 Ga0207657_10011684 3300025919 Bacteria 8701
145 Ga0207657_10040619 3300025919 Unclassified 4120
146 Ga0207657_10047393 3300025919 Bacteria 3758
147 Ga0207652_10003426 3300025921 Bacteria 13089
148 Ga0207652_10244354 3300025921 Bacteria 1618
149 Ga0207650_10011970 3300025925 Bacteria 5980
150 Ga0207650_10217565 3300025925 Bacteria 1536
151 Ga0207659_10035323 3300025926 Bacteria 3454
152 Ga0207659_10558919 3300025926 Bacteria 973
153 Ga0207644_10030541 3300025931 Bacteria 3749
154 Ga0207644_10164578 3300025931 Bacteria 1727
155 Ga0207706_10038970 3300025933 Bacteria 4215
156 Ga0207686_10272489 3300025934 Bacteria 1246
157 Ga0207670_10106031 3300025936 Bacteria 2015
158 Ga0207669_10104826 3300025937 Bacteria 1879
159 Ga0207689_10022557 3300025942 Bacteria 5290
160 Ga0207689_10063044 3300025942 Bacteria 3049
161 Ga0207689_10503458 3300025942 Bacteria 1015
162 Ga0207661_10068137 3300025944 Bacteria 2897
163 Ga0207679_10310507 3300025945 Bacteria 1362
164 Ga0207679_10314481 3300025945 Bacteria 1354
165 Ga0207679_10430395 3300025945 Bacteria 1166
166 Ga0207667_10126177 3300025949 Bacteria 2636
167 Ga0207712_10098223 3300025961 Bacteria 2171
168 Ga0207668_10029317 3300025972 Bacteria 3607
169 Ga0207640_10208624 3300025981 Bacteria 1486
170 Ga0207640_10397426 3300025981 Bacteria 1121
171 Ga0207677_10124763 3300026023 Bacteria 1944
172 Ga0207677_10400013 3300026023 Bacteria 1164
173 Ga0207703_10161075 3300026035 Bacteria 1965
174 Ga0207703_10310194 3300026035 Bacteria 1442
175 Ga0207639_10062835 3300026041 Bacteria 2873
176 Ga0207702_10156912 3300026078 Bacteria 2075
177 Ga0207641_10344297 3300026088 Bacteria 1419
178 Ga0207641_10589184 3300026088 Bacteria 1088
179 Ga0207648_10001472 3300026089 Bacteria 25920
180 Ga0207648_10314652 3300026089 Bacteria 1406
181 Ga0207648_10316426 3300026089 Bacteria 1402
182 Ga0207676_10094143 3300026095 Bacteria 2468
183 Ga0207674_10085805 3300026116 Bacteria 3143
184 Ga0207674_10086903 3300026116 Bacteria 3121
185 Ga0207674_10250443 3300026116 Bacteria 1718
186 Ga0207674_10606747 3300026116 Bacteria 1057
187 Ga0207674_10717096 3300026116 Bacteria 965
188 Ga0207675_100000326 3300026118 Bacteria 45358
189 Ga0207675_100088494 3300026118 Bacteria 2909
190 Ga0207675_100138665 3300026118 Bacteria 2309
191 Ga0207675_100565476 3300026118 Bacteria 1137
192 Ga0207675_100790663 3300026118 Bacteria 962
193 Ga0207683_10270054 3300026121 Bacteria 1553
194 Ga0207698_10228438 3300026142 Bacteria 1687
195 Ga0209974_10053888 3300027876 Bacteria 1355
196 Ga0268265_10306369 3300028380 Bacteria 1432
197 Ga0268265_10462583 3300028380 Bacteria 1187
198 Ga0268264_10049534 3300028381 Bacteria 3495
199 Ga0265324_10078425 3300029957 Bacteria 1124
200 Ga0265339_10075301 3300031249 Bacteria 1792
201 Ga0265316_10004228 3300031344 Bacteria 14342
202 Ga0307513_10032496 3300031456 Bacteria 5883
203 Ga0307408_100000389 3300031548 Bacteria 40047
204 Ga0316575_10001864 3300031665 Bacteria 6936
205 Ga0265342_10000260 3300031712 Bacteria 59291
206 Ga0307412_10096152 3300031911 Bacteria 2084
207 Ga0373937_0413784 3300036401 Bacteria 1279
208 Ga0451853_3770812 3300041512 Bacteria 1326
209 Ga0439431_0004255 3300041997 Bacteria 3142
210 Ga0450923_000172 3300042125 Bacteria 6008
211 Ga0451577_0080423 3300042876 Bacteria 2906
212 Ga0451577_0557572 3300042876 Bacteria 1040
213 Ga0466972_0008769 3300044658 Bacteria 5072
214 Ga0466982_0038491 3300044672 Bacteria 2884
215 Ga0466965_0079538 3300044683 Bacteria 1656
216 Ga0466964_0073064 3300044706 Bacteria 1455
217 Ga0453684_0001177 3300044712 Bacteria 81167
218 Ga0453684_0024925 3300044712 Bacteria 8709
219 Ga0453684_0102698 3300044712 Bacteria 3495
220 Ga0453684_0206583 3300044712 Bacteria 2285
221 Ga0453684_0399824 3300044712 Bacteria 1539
222 Ga0466970_0034855 3300044765 Bacteria 2665
223 Ga0466960_0256447 3300044901 Bacteria 973
224 Ga0451576_0051766 3300045051 Bacteria 4305
225 Ga0451576_0286026 3300045051 Bacteria 1724
226 Ga0451576_0419380 3300045051 Bacteria 1404
227 Ga0466967_0030803 3300045976 Bacteria 4506
228 Ga0495638_0000121 3300046460 Bacteria 126440
229 Ga0495668_0001412 3300046616 Bacteria 23403
230 Ga0495625_0197916 3300046660 Bacteria 1328
231 Ga0495625_0296788 3300046660 Bacteria 1035
232 Ga0495674_0250125 3300047319 Bacteria 1459
233 Ga0495672_0010073 3300047320 Bacteria 6766
234 Ga0495672_0027491 3300047320 Bacteria 3614
235 Ga0495686_0010384 3300047472 Bacteria 6628
236 Ga0501031_0092582 3300049568 Bacteria 1972
237 Ga0501032_0146848 3300049569 Bacteria 1552
238 Ga0501034_0000410 3300049571 Bacteria 72148
239 Ga0501034_0261489 3300049571 Bacteria 1673
240 Ga0501036_0092754 3300049572 Bacteria 2551
241 Ga0501037_0076590 3300049573 Bacteria 2428
242 Ga0501038_0140087 3300049574 Bacteria 1979
243 Ga0501039_0021533 3300049575 Bacteria 4944
244 Ga0501043_0015489 3300049579 Bacteria 5973
245 Ga0501043_0207202 3300049579 Bacteria 1520
246 Ga0501070_0022775 3300049586 Bacteria 5244
247 Ga0501221_081651 3300049704 Bacteria 779
248 Ga0501035_0107318 3300049822 Bacteria 2448
249 Ga0501035_0473145 3300049822 Bacteria 1034
250 Ga0501044_0012233 3300049823 Bacteria 9292
251 Ga0501044_0097796 3300049823 Bacteria 2956
252 Ga0501044_0211579 3300049823 Bacteria 1893
253 Ga0501284_00021 3300050005 Bacteria 89729
254 nmdc:mga0k408_5067_c1 3300050493 Bacteria 6981
255 Ga0500578_0000150 3300053086 Bacteria 83541
256 Ga0500583_0040426 3300053092 Bacteria 2113
257 Ga0500641_0024124 3300053096 Bacteria 2343
258 Ga0500616_0000004 3300053153 Bacteria 1002714
259 Ga0500616_0043042 3300053153 Bacteria 2415
260 Ga0500611_000006 3300053727 Bacteria 226069
261 Ga0500645_034285 3300053730 Bacteria 1516
262 Ga0500645_060690 3300053730 Bacteria 1094
263 Ga0501082_0302198 3300060353 Bacteria 1394

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049704 Ga0501221_081651 Ga0501221_081651_36_698 216
2 3300013307 Ga0157372_10593173 Ga0157372_105931732 221
3 3300053730 Ga0500645_060690 Ga0500645_060690_396_1079 223
4 3300005719 Ga0068861_100067004 Ga0068861_1000670043 227
5 3300026118 Ga0207675_100565476 Ga0207675_1005654762 227
6 3300014326 Ga0157380_10000038 Ga0157380_1000003820 231
7 3300046660 Ga0495625_0296788 Ga0495625_0296788_216_932 233
8 3300031911 Ga0307412_10096152 Ga0307412_100961523 236
9 3300044683 Ga0466965_0079538 Ga0466965_0079538_688_1416 236
10 3300044706 Ga0466964_0073064 Ga0466964_0073064_172_894 236
11 3300044901 Ga0466960_0256447 Ga0466960_0256447_12_734 236
12 3300045976 Ga0466967_0030803 Ga0466967_0030803_2453_3175 236
13 3300046660 Ga0495625_0197916 Ga0495625_0197916_321_1061 236
14 iso_pu_bacteria 2896085136 2896088337 238
15 iso_pu_bacteria 2643221600 2644009901 239
16 iso_pu_bacteria 2643221667 2644369730 239
17 iso_pu_bacteria 2883068021 2883071736 239
18 iso_pu_bacteria 2896109856 2896111813 239
19 iso_pu_bacteria 2919191525 2919192018 239
20 iso_pu_bacteria 8054307821 8054310611 239
21 3300042876 Ga0451577_0080423 Ga0451577_0080423_1868_2590 240
22 3300031249 Ga0265339_10075301 Ga0265339_100753012 241
23 3300031344 Ga0265316_10004228 Ga0265316_1000422810 241
24 3300031665 Ga0316575_10001864 Ga0316575_100018643 241
25 3300031712 Ga0265342_10000260 Ga0265342_100002604 241
26 3300042876 Ga0451577_0557572 Ga0451577_0557572_68_805 241
27 3300044712 Ga0453684_0001177 Ga0453684_0001177_6006_6743 241
28 3300044712 Ga0453684_0024925 Ga0453684_0024925_22_756 241
29 3300044712 Ga0453684_0102698 Ga0453684_0102698_984_1721 241
30 3300045051 Ga0451576_0051766 Ga0451576_0051766_998_1735 241
31 3300045051 Ga0451576_0419380 Ga0451576_0419380_129_866 241
32 3300003320 rootH2_10072708 rootH2_1007270815 242
33 3300005344 Ga0070661_100246336 Ga0070661_1002463362 242
34 3300005354 Ga0070675_100875220 Ga0070675_1008752201 242
35 3300005364 Ga0070673_100201860 Ga0070673_1002018601 242
36 3300005564 Ga0070664_100267950 Ga0070664_1002679502 242
37 3300005615 Ga0070702_100037384 Ga0070702_1000373843 242
38 3300005840 Ga0068870_10390730 Ga0068870_103907302 242
39 3300005842 Ga0068858_100254162 Ga0068858_1002541622 242
40 3300009176 Ga0105242_10414254 Ga0105242_104142541 242
41 3300013296 Ga0157374_10303341 Ga0157374_103033411 242
42 3300013297 Ga0157378_10070192 Ga0157378_100701923 242
43 3300013306 Ga0163162_10522511 Ga0163162_105225112 242
44 3300013308 Ga0157375_10367105 Ga0157375_103671051 242
45 3300014745 Ga0157377_10003612 Ga0157377_100036125 242
46 3300025901 Ga0207688_10044351 Ga0207688_100443513 242
47 3300025934 Ga0207686_10272489 Ga0207686_102724891 242
48 3300025945 Ga0207679_10310507 Ga0207679_103105071 242
49 3300025981 Ga0207640_10397426 Ga0207640_103974261 242
50 3300026023 Ga0207677_10400013 Ga0207677_104000131 242
51 3300026035 Ga0207703_10161075 Ga0207703_101610752 242
52 3300026088 Ga0207641_10589184 Ga0207641_105891841 242
53 3300031548 Ga0307408_100000389 Ga0307408_10000038916 242
54 3300044712 Ga0453684_0206583 Ga0453684_0206583_121_867 242
55 2162886007 SwRhRL2b_contig_449108 SwRhRL2b_0071.00006730 243
56 3300003320 rootH2_10006910 rootH2_1000691012 243
57 3300003322 rootL2_10032084 rootL2_100320848 243
58 3300003322 rootL2_10108747 rootL2_101087474 243
59 3300003322 rootL2_10224709 rootL2_102247092 243
60 3300003323 rootH1_10011906 rootH1_100119067 243
61 3300003323 rootH1_10059685 rootH1_1005968515 243
62 3300003323 rootH1_10068010 rootH1_1006801011 243
63 3300005288 Ga0065714_10156490 Ga0065714_101564901 243
64 3300005289 Ga0065704_10071719 Ga0065704_100717197 243
65 3300005289 Ga0065704_10107451 Ga0065704_101074512 243
66 3300005290 Ga0065712_10003559 Ga0065712_100035594 243
67 3300005290 Ga0065712_10003882 Ga0065712_100038823 243
68 3300005290 Ga0065712_10122019 Ga0065712_101220192 243
69 3300005293 Ga0065715_10112754 Ga0065715_101127542 243
70 3300005327 Ga0070658_10059816 Ga0070658_100598163 243
71 3300005328 Ga0070676_10174996 Ga0070676_101749962 243
72 3300005329 Ga0070683_100045843 Ga0070683_1000458434 243
73 3300005329 Ga0070683_100422780 Ga0070683_1004227802 243
74 3300005331 Ga0070670_100045621 Ga0070670_1000456214 243
75 3300005331 Ga0070670_100052471 Ga0070670_1000524712 243
76 3300005334 Ga0068869_100051001 Ga0068869_1000510012 243
77 3300005334 Ga0068869_100079522 Ga0068869_1000795222 243
78 3300005335 Ga0070666_10024006 Ga0070666_100240063 243
79 3300005336 Ga0070680_100246458 Ga0070680_1002464581 243
80 3300005336 Ga0070680_100281513 Ga0070680_1002815131 243
81 3300005338 Ga0068868_100579538 Ga0068868_1005795382 243
82 3300005339 Ga0070660_100042442 Ga0070660_1000424421 243
83 3300005339 Ga0070660_100121560 Ga0070660_1001215602 243
84 3300005340 Ga0070689_100005552 Ga0070689_10000555212 243
85 3300005353 Ga0070669_100142253 Ga0070669_1001422532 243
86 3300005354 Ga0070675_100038109 Ga0070675_1000381095 243
87 3300005354 Ga0070675_100069281 Ga0070675_1000692814 243
88 3300005364 Ga0070673_100015640 Ga0070673_1000156402 243
89 3300005364 Ga0070673_100509081 Ga0070673_1005090811 243
90 3300005364 Ga0070673_100538544 Ga0070673_1005385442 243
91 3300005441 Ga0070700_100118306 Ga0070700_1001183062 243
92 3300005457 Ga0070662_100035067 Ga0070662_1000350672 243
93 3300005458 Ga0070681_10218468 Ga0070681_102184682 243
94 3300005459 Ga0068867_100026406 Ga0068867_1000264062 243
95 3300005459 Ga0068867_100043860 Ga0068867_1000438602 243
96 3300005459 Ga0068867_100044291 Ga0068867_1000442914 243
97 3300005459 Ga0068867_100189628 Ga0068867_1001896282 243
98 3300005459 Ga0068867_100361077 Ga0068867_1003610772 243
99 3300005466 Ga0070685_10046013 Ga0070685_100460133 243
100 3300005530 Ga0070679_100016413 Ga0070679_1000164134 243
101 3300005530 Ga0070679_100060368 Ga0070679_1000603682 243
102 3300005530 Ga0070679_100648559 Ga0070679_1006485592 243
103 3300005535 Ga0070684_100339862 Ga0070684_1003398622 243
104 3300005535 Ga0070684_100512850 Ga0070684_1005128502 243
105 3300005563 Ga0068855_100093294 Ga0068855_1000932944 243
106 3300005563 Ga0068855_100147476 Ga0068855_1001474763 243
107 3300005564 Ga0070664_100021517 Ga0070664_1000215173 243
108 3300005577 Ga0068857_100370205 Ga0068857_1003702052 243
109 3300005578 Ga0068854_100260727 Ga0068854_1002607271 243
110 3300005614 Ga0068856_100014270 Ga0068856_1000142707 243
111 3300005615 Ga0070702_100168862 Ga0070702_1001688622 243
112 3300005616 Ga0068852_100004584 Ga0068852_1000045847 243
113 3300005616 Ga0068852_100310666 Ga0068852_1003106661 243
114 3300005616 Ga0068852_100543847 Ga0068852_1005438472 243
115 3300005617 Ga0068859_100083833 Ga0068859_1000838331 243
116 3300005617 Ga0068859_101202391 Ga0068859_1012023911 243
117 3300005618 Ga0068864_100394855 Ga0068864_1003948552 243
118 3300005719 Ga0068861_100003722 Ga0068861_1000037229 243
119 3300005719 Ga0068861_100084504 Ga0068861_1000845042 243
120 3300005719 Ga0068861_100646131 Ga0068861_1006461312 243
121 3300005834 Ga0068851_10069679 Ga0068851_100696792 243
122 3300005840 Ga0068870_10018783 Ga0068870_100187833 243
123 3300005842 Ga0068858_100200067 Ga0068858_1002000672 243
124 3300005843 Ga0068860_100264020 Ga0068860_1002640202 243
125 3300005843 Ga0068860_100292596 Ga0068860_1002925962 243
126 3300005843 Ga0068860_100396900 Ga0068860_1003969002 243
127 3300005843 Ga0068860_100455156 Ga0068860_1004551562 243
128 3300005844 Ga0068862_100001846 Ga0068862_10000184618 243
129 3300005844 Ga0068862_100348326 Ga0068862_1003483261 243
130 3300006195 Ga0075366_10015555 Ga0075366_100155557 243
131 3300006195 Ga0075366_10256875 Ga0075366_102568751 243
132 3300006358 Ga0068871_100284508 Ga0068871_1002845082 243
133 3300006931 Ga0097620_100083839 Ga0097620_1000838391 243
134 3300006931 Ga0097620_101202446 Ga0097620_1012024461 243
135 3300009094 Ga0111539_10030939 Ga0111539_100309392 243
136 3300009101 Ga0105247_10001960 Ga0105247_100019606 243
137 3300009148 Ga0105243_10086995 Ga0105243_100869952 243
138 3300009176 Ga0105242_10097719 Ga0105242_100977192 243
139 3300009553 Ga0105249_10010218 Ga0105249_100102184 243
140 3300009553 Ga0105249_10248796 Ga0105249_102487962 243
141 3300010375 Ga0105239_10108087 Ga0105239_101080873 243
142 3300010375 Ga0105239_10886688 Ga0105239_108866881 243
143 3300013100 Ga0157373_10112275 Ga0157373_101122752 243
144 3300013100 Ga0157373_10390612 Ga0157373_103906121 243
145 3300013100 Ga0157373_10411597 Ga0157373_104115972 243
146 3300013100 Ga0157373_10438423 Ga0157373_104384231 243
147 3300013102 Ga0157371_10235921 Ga0157371_102359212 243
148 3300013104 Ga0157370_10000263 Ga0157370_1000026377 243
149 3300013104 Ga0157370_10040110 Ga0157370_100401103 243
150 3300013104 Ga0157370_10300908 Ga0157370_103009082 243
151 3300013104 Ga0157370_10360536 Ga0157370_103605362 243
152 3300013104 Ga0157370_10521452 Ga0157370_105214522 243
153 3300013105 Ga0157369_10018964 Ga0157369_100189642 243
154 3300013105 Ga0157369_10143018 Ga0157369_101430183 243
155 3300013296 Ga0157374_10093860 Ga0157374_100938603 243
156 3300013297 Ga0157378_10265627 Ga0157378_102656272 243
157 3300013306 Ga0163162_10008228 Ga0163162_100082289 243
158 3300013307 Ga0157372_10179954 Ga0157372_101799543 243
159 3300013307 Ga0157372_10251374 Ga0157372_102513742 243
160 3300013307 Ga0157372_10382191 Ga0157372_103821912 243
161 3300013307 Ga0157372_10389715 Ga0157372_103897152 243
162 3300013307 Ga0157372_10545156 Ga0157372_105451562 243
163 3300013307 Ga0157372_10547575 Ga0157372_105475752 243
164 3300013307 Ga0157372_10779968 Ga0157372_107799682 243
165 3300013307 Ga0157372_10943697 Ga0157372_109436972 243
166 3300013308 Ga0157375_10020661 Ga0157375_100206613 243
167 3300013308 Ga0157375_10249320 Ga0157375_102493202 243
168 3300014325 Ga0163163_10012099 Ga0163163_100120998 243
169 3300014325 Ga0163163_10266199 Ga0163163_102661992 243
170 3300014326 Ga0157380_10190878 Ga0157380_101908782 243
171 3300014745 Ga0157377_10229918 Ga0157377_102299182 243
172 3300025298 Ga0209050_1011973 Ga0209050_10119732 243
173 3300025315 Ga0207697_10049929 Ga0207697_100499292 243
174 3300025900 Ga0207710_10000402 Ga0207710_1000040219 243
175 3300025904 Ga0207647_10341810 Ga0207647_103418101 243
176 3300025908 Ga0207643_10008516 Ga0207643_100085163 243
177 3300025909 Ga0207705_10018203 Ga0207705_100182034 243
178 3300025912 Ga0207707_10488224 Ga0207707_104882242 243
179 3300025917 Ga0207660_10414270 Ga0207660_104142702 243
180 3300025919 Ga0207657_10011684 Ga0207657_100116842 243
181 3300025919 Ga0207657_10040619 Ga0207657_100406191 243
182 3300025919 Ga0207657_10047393 Ga0207657_100473931 243
183 3300025921 Ga0207652_10003426 Ga0207652_100034265 243
184 3300025921 Ga0207652_10244354 Ga0207652_102443542 243
185 3300025925 Ga0207650_10011970 Ga0207650_100119702 243
186 3300025925 Ga0207650_10217565 Ga0207650_102175652 243
187 3300025926 Ga0207659_10035323 Ga0207659_100353232 243
188 3300025926 Ga0207659_10558919 Ga0207659_105589192 243
189 3300025931 Ga0207644_10030541 Ga0207644_100305412 243
190 3300025931 Ga0207644_10164578 Ga0207644_101645782 243
191 3300025933 Ga0207706_10038970 Ga0207706_100389702 243
192 3300025936 Ga0207670_10106031 Ga0207670_101060312 243
193 3300025937 Ga0207669_10104826 Ga0207669_101048262 243
194 3300025942 Ga0207689_10022557 Ga0207689_100225575 243
195 3300025942 Ga0207689_10063044 Ga0207689_100630441 243
196 3300025942 Ga0207689_10503458 Ga0207689_105034581 243
197 3300025944 Ga0207661_10068137 Ga0207661_100681374 243
198 3300025945 Ga0207679_10314481 Ga0207679_103144812 243
199 3300025945 Ga0207679_10430395 Ga0207679_104303952 243
200 3300025949 Ga0207667_10126177 Ga0207667_101261773 243
201 3300025961 Ga0207712_10098223 Ga0207712_100982232 243
202 3300025972 Ga0207668_10029317 Ga0207668_100293173 243
203 3300025981 Ga0207640_10208624 Ga0207640_102086242 243
204 3300026023 Ga0207677_10124763 Ga0207677_101247632 243
205 3300026035 Ga0207703_10310194 Ga0207703_103101942 243
206 3300026041 Ga0207639_10062835 Ga0207639_100628351 243
207 3300026078 Ga0207702_10156912 Ga0207702_101569122 243
208 3300026088 Ga0207641_10344297 Ga0207641_103442972 243
209 3300026089 Ga0207648_10001472 Ga0207648_1000147225 243
210 3300026089 Ga0207648_10314652 Ga0207648_103146521 243
211 3300026089 Ga0207648_10316426 Ga0207648_103164262 243
212 3300026095 Ga0207676_10094143 Ga0207676_100941432 243
213 3300026116 Ga0207674_10085805 Ga0207674_100858053 243
214 3300026116 Ga0207674_10086903 Ga0207674_100869032 243
215 3300026116 Ga0207674_10250443 Ga0207674_102504432 243
216 3300026116 Ga0207674_10606747 Ga0207674_106067471 243
217 3300026116 Ga0207674_10717096 Ga0207674_107170961 243
218 3300026118 Ga0207675_100000326 Ga0207675_10000032628 243
219 3300026118 Ga0207675_100088494 Ga0207675_1000884943 243
220 3300026118 Ga0207675_100138665 Ga0207675_1001386652 243
221 3300026118 Ga0207675_100790663 Ga0207675_1007906631 243
222 3300026121 Ga0207683_10270054 Ga0207683_102700541 243
223 3300026142 Ga0207698_10228438 Ga0207698_102284382 243
224 3300027876 Ga0209974_10053888 Ga0209974_100538882 243
225 3300028380 Ga0268265_10306369 Ga0268265_103063692 243
226 3300028380 Ga0268265_10462583 Ga0268265_104625832 243
227 3300028381 Ga0268264_10049534 Ga0268264_100495344 243
228 3300029957 Ga0265324_10078425 Ga0265324_100784251 243
229 3300031456 Ga0307513_10032496 Ga0307513_100324963 243
230 3300036401 Ga0373937_0413784 Ga0373937_0413784_403_1146 243
231 3300041512 Ga0451853_3770812 Ga0451853_3770812_539_1288 243
232 3300041997 Ga0439431_0004255 Ga0439431_0004255_2058_2789 243
233 3300042125 Ga0450923_000172 Ga0450923_000172_2848_3594 243
234 3300044658 Ga0466972_0008769 Ga0466972_0008769_253_999 243
235 3300044672 Ga0466982_0038491 Ga0466982_0038491_923_1663 243
236 3300044712 Ga0453684_0399824 Ga0453684_0399824_705_1448 243
237 3300044765 Ga0466970_0034855 Ga0466970_0034855_1592_2335 243
238 3300045051 Ga0451576_0286026 Ga0451576_0286026_824_1567 243
239 3300046460 Ga0495638_0000121 Ga0495638_0000121_24116_24856 243
240 3300046616 Ga0495668_0001412 Ga0495668_0001412_18578_19324 243
241 3300047319 Ga0495674_0250125 Ga0495674_0250125_116_859 243
242 3300047320 Ga0495672_0010073 Ga0495672_0010073_4461_5207 243
243 3300047320 Ga0495672_0027491 Ga0495672_0027491_2420_3193 243
244 3300047472 Ga0495686_0010384 Ga0495686_0010384_754_1500 243
245 3300049568 Ga0501031_0092582 Ga0501031_0092582_205_954 243
246 3300049569 Ga0501032_0146848 Ga0501032_0146848_52_801 243
247 3300049571 Ga0501034_0000410 Ga0501034_0000410_30957_31700 243
248 3300049571 Ga0501034_0261489 Ga0501034_0261489_306_1049 243
249 3300049572 Ga0501036_0092754 Ga0501036_0092754_989_1738 243
250 3300049573 Ga0501037_0076590 Ga0501037_0076590_1238_1987 243
251 3300049574 Ga0501038_0140087 Ga0501038_0140087_372_1121 243
252 3300049575 Ga0501039_0021533 Ga0501039_0021533_1848_2597 243
253 3300049579 Ga0501043_0015489 Ga0501043_0015489_1019_1768 243
254 3300049579 Ga0501043_0207202 Ga0501043_0207202_648_1394 243
255 3300049586 Ga0501070_0022775 Ga0501070_0022775_1049_1792 243
256 3300049822 Ga0501035_0107318 Ga0501035_0107318_1625_2374 243
257 3300049822 Ga0501035_0473145 Ga0501035_0473145_122_865 243
258 3300049823 Ga0501044_0012233 Ga0501044_0012233_4441_5190 243
259 3300049823 Ga0501044_0097796 Ga0501044_0097796_830_1576 243
260 3300049823 Ga0501044_0211579 Ga0501044_0211579_471_1211 243
261 3300050005 Ga0501284_00021 Ga0501284_00021_23280_24026 243
262 3300050493 nmdc:mga0k408_5067_c1 nmdc:mga0k408_5067_c1_2304_3050 243
263 3300053086 Ga0500578_0000150 Ga0500578_0000150_26917_27666 243
264 3300053092 Ga0500583_0040426 Ga0500583_0040426_873_1613 243
265 3300053096 Ga0500641_0024124 Ga0500641_0024124_598_1344 243
266 3300053153 Ga0500616_0000004 Ga0500616_0000004_640412_641152 243
267 3300053153 Ga0500616_0043042 Ga0500616_0043042_143_883 243
268 3300053727 Ga0500611_000006 Ga0500611_000006_108299_109045 243
269 3300053730 Ga0500645_034285 Ga0500645_034285_614_1360 243
270 3300060353 Ga0501082_0302198 Ga0501082_0302198_578_1327 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

42

186

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

75

217

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.957 3 225
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9551 3 225
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9536 4 218
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9485 5 237
7e7o-assembly1.cif.gz_A cryo-em structure of human abca4 in nrpe-bound state 0.9408 3 226
ID Description Score Start End Superfamily
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9619 3 224 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9578 2 230 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9571 6 227 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.956 1 243 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9541 2 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y2MRM8-F1-model_v4 ABC transporter ATP-binding protein 0.9885 1 240 GO:0005524
GO:0016887
AF-A0A4R2F7J7-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9876 1 239 GO:0005524
GO:0016887
AF-A0A562PFS4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9861 3 110 GO:0005524
GO:0016887
AF-A0A428Z536-F1-model_v4 Transport permease protein 0.9808 3 226 GO:0005524
GO:0005886
GO:0016887
GO:0043215
GO:0046677
GO:0140359
GO:1900753
AF-A0A7V3NIK6-F1-model_v4 ABC transporter ATP-binding protein 0.9807 8 225 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.48 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map