F376998

General Info

Members Datasets Scaffolds Average Seq Length
270 160 270 216

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10432054|Ga0207662_104320541
Length 248
Sequence VNNPELNSQLHELRRSVGIYRHSAFLIFFHALQIERNIETRVHGRYLVDGPRDAQAPLLVSFHGYAESADLDLSRLQQIQGIEQWVTVAVQGLHRFYRGRSNDVVASWMTKQDRELAISDNIAYTTSVVQSVLKEWSAGKTLVLSGFSQGVAMAFRCAASLKQPVSGVIALGGDIPPELDADMLKRVPGVLIGHGTRDEWYTAEKVAADKRRLQAAGVPVDVFTFEGGHEWTAEFAAVASRFLLACHH

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0
Rhizoplane 3.7
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10093766 3300005290 Bacteria 2280
2 Ga0065715_10018291 3300005293 Bacteria 3300
3 Ga0070676_10609247 3300005328 Unclassified 788
4 Ga0070690_100177436 3300005330 Bacteria 1470
5 Ga0070670_100163261 3300005331 Bacteria 1931
6 Ga0070670_100193093 3300005331 Bacteria 1769
7 Ga0070670_100287166 3300005331 Unclassified 1437
8 Ga0068869_100052380 3300005334 Bacteria 2964
9 Ga0070666_10004442 3300005335 Bacteria 8541
10 Ga0070666_10031423 3300005335 Unclassified 3505
11 Ga0070680_100117782 3300005336 Bacteria 2215
12 Ga0070680_100208302 3300005336 Bacteria 1649
13 Ga0068868_100014709 3300005338 Bacteria 5772
14 Ga0068868_100062085 3300005338 Bacteria 2961
15 Ga0070689_100031437 3300005340 Bacteria 4033
16 Ga0070689_100625709 3300005340 Bacteria 934
17 Ga0070661_100151112 3300005344 Bacteria 1755
18 Ga0070668_100427574 3300005347 Bacteria 1135
19 Ga0070669_100153318 3300005353 Unclassified 1785
20 Ga0070669_100310985 3300005353 Bacteria 1270
21 Ga0070675_100466254 3300005354 Unclassified 1134
22 Ga0070671_100005536 3300005355 Bacteria 10061
23 Ga0070671_100186688 3300005355 Bacteria 1756
24 Ga0070674_100524239 3300005356 Unclassified 990
25 Ga0070673_100689489 3300005364 Bacteria 937
26 Ga0070688_100018494 3300005365 Bacteria 4021
27 Ga0070659_100064104 3300005366 Bacteria 2908
28 Ga0070667_100003314 3300005367 Bacteria 13764
29 Ga0070667_100187959 3300005367 Bacteria 1829
30 Ga0070709_10402639 3300005434 Bacteria 1022
31 Ga0070705_100310988 3300005440 Bacteria 1133
32 Ga0070700_100020211 3300005441 Bacteria 3853
33 Ga0070708_100076429 3300005445 Bacteria 3024
34 Ga0070678_100849212 3300005456 Bacteria 832
35 Ga0070681_10046585 3300005458 Unclassified 4335
36 Ga0068867_100270601 3300005459 Bacteria 1389
37 Ga0070707_100007803 3300005468 Bacteria 9940
38 Ga0070698_100098707 3300005471 Unclassified 2894
39 Ga0070698_100635616 3300005471 Bacteria 1008
40 Ga0070699_100136230 3300005518 Unclassified 2166
41 Ga0070695_100412819 3300005545 Unclassified 1026
42 Ga0070665_100099978 3300005548 Bacteria 2904
43 Ga0068855_100029227 3300005563 Bacteria 6592
44 Ga0070664_100122183 3300005564 Bacteria 2281
45 Ga0070664_100298155 3300005564 Bacteria 1456
46 Ga0068857_100443039 3300005577 Bacteria 1213
47 Ga0068852_100223378 3300005616 Bacteria 1792
48 Ga0068859_100030965 3300005617 Bacteria 5369
49 Ga0068859_100452164 3300005617 Bacteria 1380
50 Ga0068864_100020423 3300005618 Bacteria 5542
51 Ga0068864_100326519 3300005618 Bacteria 1442
52 Ga0068864_100404833 3300005618 Bacteria 1297
53 Ga0068866_10062694 3300005718 Unclassified 1935
54 Ga0068863_100234577 3300005841 Bacteria 1770
55 Ga0068863_100435232 3300005841 Bacteria 1286
56 Ga0068863_100521966 3300005841 Unclassified 1171
57 Ga0068858_100004839 3300005842 Bacteria 13199
58 Ga0068858_100013649 3300005842 Bacteria 7666
59 Ga0068860_100050659 3300005843 Bacteria 3952
60 Ga0068860_100360515 3300005843 Unclassified 1432
61 Ga0068860_100403694 3300005843 Bacteria 1352
62 Ga0070717_10468209 3300006028 Bacteria 1137
63 Ga0075366_10358855 3300006195 Bacteria 895
64 Ga0097621_100019804 3300006237 Bacteria 5174
65 Ga0068871_100015880 3300006358 Bacteria 5653
66 Ga0068871_100062359 3300006358 Bacteria 3046
67 Ga0068871_100226882 3300006358 Bacteria 1620
68 Ga0068871_100542599 3300006358 Unclassified 1052
69 Ga0075428_100028757 3300006844 Bacteria 6150
70 Ga0075428_100088448 3300006844 Unclassified 3378
71 Ga0075428_100118763 3300006844 Bacteria 2879
72 Ga0075430_100452693 3300006846 Bacteria 1059
73 Ga0075431_100024752 3300006847 Bacteria 6154
74 Ga0075431_100052042 3300006847 Bacteria 4223
75 Ga0075431_100089718 3300006847 Unclassified 3173
76 Ga0075431_100094208 3300006847 Bacteria 3090
77 Ga0075431_100185557 3300006847 Bacteria 2133
78 Ga0075431_100413188 3300006847 Bacteria 1349
79 Ga0075431_100491601 3300006847 Bacteria 1219
80 Ga0075433_10644068 3300006852 Bacteria 929
81 Ga0075434_100171586 3300006871 Unclassified 2189
82 Ga0075434_100185523 3300006871 Bacteria 2101
83 Ga0075429_100078359 3300006880 Bacteria 2880
84 Ga0075429_100318694 3300006880 Unclassified 1361
85 Ga0075429_100714341 3300006880 Unclassified 878
86 Ga0068865_100049345 3300006881 Bacteria 2901
87 Ga0068865_100427838 3300006881 Unclassified 1090
88 Ga0097620_100030965 3300006931 Bacteria 5369
89 Ga0097620_100452198 3300006931 Bacteria 1380
90 Ga0105240_10006149 3300009093 Bacteria 17704
91 Ga0105240_10733064 3300009093 Bacteria 1076
92 Ga0111539_10000018 3300009094 Bacteria 270743
93 Ga0111539_10562631 3300009094 Bacteria 1328
94 Ga0111539_10839837 3300009094 Unclassified 1069
95 Ga0105245_10008974 3300009098 Bacteria 8721
96 Ga0114129_10000886 3300009147 Bacteria 39030
97 Ga0114129_10063250 3300009147 Bacteria 5168
98 Ga0114129_10194323 3300009147 Bacteria 2753
99 Ga0114129_10291502 3300009147 Bacteria 2178
100 Ga0114129_10327557 3300009147 Bacteria 2035
101 Ga0114129_10360816 3300009147 Bacteria 1923
102 Ga0105242_10004812 3300009176 Bacteria 10448
103 Ga0105242_10379337 3300009176 Unclassified 1314
104 Ga0105248_10006356 3300009177 Bacteria 12958
105 Ga0105248_10012576 3300009177 Bacteria 9338
106 Ga0105248_10087462 3300009177 Bacteria 3507
107 Ga0105248_10462793 3300009177 Bacteria 1430
108 Ga0157374_10033016 3300013296 Bacteria 4719
109 Ga0163162_10144764 3300013306 Bacteria 2492
110 Ga0163162_10188028 3300013306 Unclassified 2192
111 Ga0157375_10005393 3300013308 Bacteria 11114
112 Ga0157375_10464402 3300013308 Bacteria 1431
113 Ga0157375_11311339 3300013308 Unclassified 851
114 Ga0163163_10026560 3300014325 Bacteria 5537
115 Ga0163163_10253965 3300014325 Bacteria 1809
116 Ga0157380_10015509 3300014326 Bacteria 5601
117 Ga0157380_10023763 3300014326 Bacteria 4628
118 Ga0157380_10080962 3300014326 Unclassified 2655
119 Ga0157380_10311124 3300014326 Unclassified 1456
120 Ga0157379_10006669 3300014968 Bacteria 9969
121 Ga0157379_10051966 3300014968 Bacteria 3659
122 Ga0157376_10031645 3300014969 Bacteria 4240
123 Ga0157376_10197872 3300014969 Bacteria 1847
124 Ga0163161_10008827 3300017792 Bacteria 6968
125 Ga0163161_10065670 3300017792 Bacteria 2648
126 Ga0163161_10784585 3300017792 Bacteria 799
127 Ga0207680_10014446 3300025903 Bacteria 4087
128 Ga0207680_10086391 3300025903 Unclassified 1984
129 Ga0207707_10026199 3300025912 Bacteria 5097
130 Ga0207695_10441503 3300025913 Unclassified 1185
131 Ga0207695_10447824 3300025913 Bacteria 1174
132 Ga0207660_10281074 3300025917 Bacteria 1321
133 Ga0207662_10432054 3300025918 Unclassified 898
134 Ga0207657_10140279 3300025919 Bacteria 1975
135 Ga0207652_10049212 3300025921 Unclassified 3607
136 Ga0207652_10099452 3300025921 Bacteria 2566
137 Ga0207652_10390382 3300025921 Bacteria 1256
138 Ga0207646_10072100 3300025922 Bacteria 3085
139 Ga0207681_10216275 3300025923 Unclassified 1480
140 Ga0207659_10000559 3300025926 Bacteria 22351
141 Ga0207644_10412487 3300025931 Unclassified 1105
142 Ga0207670_10346867 3300025936 Unclassified 1175
143 Ga0207704_10086577 3300025938 Bacteria 2044
144 Ga0207691_10338133 3300025940 Bacteria 1289
145 Ga0207711_10040248 3300025941 Bacteria 3976
146 Ga0207711_10061352 3300025941 Bacteria 3242
147 Ga0207711_10651693 3300025941 Unclassified 982
148 Ga0207689_10065376 3300025942 Bacteria 2991
149 Ga0207679_10059375 3300025945 Bacteria 2838
150 Ga0207667_10273595 3300025949 Bacteria 1726
151 Ga0207651_10016807 3300025960 Bacteria 4301
152 Ga0207668_10652628 3300025972 Bacteria 921
153 Ga0207658_10023593 3300025986 Bacteria 4296
154 Ga0207677_10014414 3300026023 Bacteria 4616
155 Ga0207677_10019027 3300026023 Unclassified 4137
156 Ga0207677_10034307 3300026023 Bacteria 3284
157 Ga0207677_10840883 3300026023 Bacteria 824
158 Ga0207703_10077491 3300026035 Bacteria 2760
159 Ga0207703_10396752 3300026035 Unclassified 1279
160 Ga0207703_10397349 3300026035 Unclassified 1278
161 Ga0207708_10308121 3300026075 Bacteria 1289
162 Ga0207641_10011484 3300026088 Bacteria 7270
163 Ga0207641_10147915 3300026088 Bacteria 2126
164 Ga0207641_10339139 3300026088 Bacteria 1430
165 Ga0207676_10036492 3300026095 Bacteria 3740
166 Ga0207676_10159485 3300026095 Bacteria 1952
167 Ga0207674_10103741 3300026116 Bacteria 2822
168 Ga0207675_100645991 3300026118 Bacteria 1064
169 Ga0207683_10863710 3300026121 Bacteria 840
170 Ga0207698_10196373 3300026142 Bacteria 1803
171 Ga0209971_1029689 3300027682 Bacteria 1309
172 Ga0207428_10000003 3300027907 Bacteria 799783
173 Ga0207428_10001467 3300027907 Bacteria 24687
174 Ga0207428_10089398 3300027907 Bacteria 2394
175 Ga0268266_10008864 3300028379 Bacteria 8905
176 Ga0268266_10106768 3300028379 Bacteria 2476
177 Ga0268265_10904287 3300028380 Bacteria 867
178 Ga0268264_10108784 3300028381 Bacteria 2424
179 Ga0268264_10335230 3300028381 Unclassified 1435
180 Ga0307513_10376728 3300031456 Unclassified 1160
181 Ga0307408_100974632 3300031548 Unclassified 780
182 Ga0307413_10558237 3300031824 Bacteria 930
183 Ga0307410_10029737 3300031852 Bacteria 3483
184 Ga0307412_10325486 3300031911 Unclassified 1225
185 Ga0307412_10717401 3300031911 Bacteria 860
186 Ga0307409_100038927 3300031995 Bacteria 3523
187 Ga0307411_10308857 3300032005 Bacteria 1272
188 Ga0373952_0081797 3300035092 Unclassified 825
189 Ga0373953_0085410 3300035117 Bacteria 1317
190 Ga0373947_0166824 3300035725 Bacteria 1427
191 Ga0373937_0365492 3300036401 Bacteria 1368
192 Ga0373937_0866511 3300036401 Unclassified 852
193 Ga0373925_0260480 3300037068 Bacteria 1393
194 Ga0451789_1217283 3300041443 Bacteria 798
195 Ga0451807_1135813 3300041486 Bacteria 736
196 Ga0451807_2253144 3300041486 Bacteria 1182
197 Ga0450891_006985 3300042129 Unclassified 1036
198 Ga0439434_0082723 3300042435 Bacteria 1020
199 Ga0451577_0580220 3300042876 Bacteria 1018
200 Ga0495664_0311624 3300046477 Bacteria 950
201 Ga0495642_0265534 3300046528 Unclassified 751
202 Ga0495635_0572646 3300046663 Bacteria 739
203 Ga0495647_0129136 3300046681 Bacteria 1069
204 Ga0495658_0068653 3300046683 Bacteria 2053
205 Ga0495613_0070538 3300046689 Bacteria 2548
206 Ga0496104_0208307 3300048907 Bacteria 1867
207 Ga0496106_0129552 3300048909 Bacteria 1978
208 Ga0496107_0329685 3300048910 Bacteria 1136
209 Ga0496109_0546329 3300048912 Unclassified 1093
210 Ga0496110_0083365 3300048913 Bacteria 2852
211 Ga0496110_0306643 3300048913 Bacteria 1446
212 Ga0496112_0585316 3300048915 Bacteria 1048
213 Ga0501033_0381427 3300049570 Unclassified 985
214 Ga0501034_0161643 3300049571 Bacteria 2210
215 Ga0501036_0261975 3300049572 Unclassified 1448
216 Ga0501036_0905406 3300049572 Unclassified 724
217 Ga0501039_0065828 3300049575 Bacteria 2812
218 Ga0501040_0458142 3300049576 Unclassified 918
219 Ga0501041_0074582 3300049577 Bacteria 2085
220 Ga0501048_0041336 3300049582 Bacteria 3303
221 Ga0501048_0123144 3300049582 Bacteria 1833
222 Ga0501048_0145659 3300049582 Bacteria 1675
223 Ga0501067_0091741 3300049583 Bacteria 1686
224 Ga0501069_0032717 3300049585 Bacteria 2863
225 Ga0501071_0034524 3300049587 Bacteria 3601
226 Ga0501071_0211951 3300049587 Bacteria 1457
227 Ga0501072_0553906 3300049588 Unclassified 908
228 Ga0501073_0003127 3300049589 Bacteria 12406
229 Ga0501073_0005272 3300049589 Bacteria 9697
230 Ga0501074_0095156 3300049590 Bacteria 2133
231 Ga0501074_0631910 3300049590 Unclassified 757
232 Ga0501076_0047811 3300049592 Bacteria 3383
233 Ga0501076_0113731 3300049592 Unclassified 2190
234 Ga0501076_0456242 3300049592 Bacteria 1052
235 Ga0501080_0089362 3300049742 Bacteria 2862
236 Ga0501045_0185231 3300049824 Bacteria 1551
237 nmdc:mga00v17_194759_c1 3300050491 Bacteria 1309
238 nmdc:mga05p37_152672_c1 3300050507 Bacteria 2823
239 nmdc:mga05p37_22267_c2 3300050507 Bacteria 2034
240 nmdc:mga05p37_2408_c1 3300050507 Bacteria 21762
241 nmdc:mga05p37_263199_c1 3300050507 Bacteria 2063
242 nmdc:mga05p37_668408_c1 3300050507 Bacteria 1160
243 nmdc:mga05p37_99866_c1 3300050507 Bacteria 3574
244 nmdc:mga09592_202689_c1 3300050508 Bacteria 1718
245 nmdc:mga09592_216294_c1 3300050508 Unclassified 1660
246 nmdc:mga09592_247041_c1 3300050508 Bacteria 1546
247 nmdc:mga09592_295701_c1 3300050508 Unclassified 1404
248 nmdc:mga06r32_10411_c1 3300050510 Bacteria 8393
249 nmdc:mga06r32_287536_c1 3300050510 Bacteria 1631
250 nmdc:mga06r32_692442_c1 3300050510 Bacteria 985
251 nmdc:mga06r32_93257_c1 3300050510 Unclassified 2945
252 nmdc:mga08y16_100910_c1 3300050511 Bacteria 3005
253 nmdc:mga08y16_12970_c1 3300050511 Bacteria 8769
254 nmdc:mga08y16_153695_c1 3300050511 Unclassified 2391
255 nmdc:mga08y16_24232_c1 3300050511 Bacteria 6407
256 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
257 nmdc:mga0n895_274358_c1 3300050512 Unclassified 1710
258 nmdc:mga0n895_39257_c1 3300050512 Unclassified 4592
259 nmdc:mga0n895_80323_c1 3300050512 Bacteria 3249
260 nmdc:mga0rr50_413214_c1 3300050513 Bacteria 1141
261 nmdc:mga0rr50_61656_c1 3300050513 Unclassified 2826
262 nmdc:mga0rr50_89381_c1 3300050513 Unclassified 2395
263 Ga0495619_0073654 3300053085 Bacteria 2289
264 Ga0495619_0153549 3300053085 Unclassified 1588
265 Ga0500646_0037648 3300053090 Bacteria 1352
266 Ga0501084_0052525 3300054114 Bacteria 3410
267 Ga0501084_0282021 3300054114 Bacteria 1403
268 Ga0501082_0091274 3300060353 Bacteria 2630
269 Ga0501082_0289628 3300060353 Bacteria 1426
270 Ga0530510_0133412 3300061734 Bacteria 1828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_1135813 Ga0451807_1135813_60_626 175
2 3300006195 Ga0075366_10358855 Ga0075366_103588551 182
3 3300050491 nmdc:mga00v17_194759_c1 nmdc:mga00v17_194759_c1_429_995 188
4 3300005328 Ga0070676_10609247 Ga0070676_106092472 189
5 3300006844 Ga0075428_100088448 Ga0075428_1000884483 189
6 3300005471 Ga0070698_100098707 Ga0070698_1000987074 190
7 3300005440 Ga0070705_100310988 Ga0070705_1003109882 194
8 3300006844 Ga0075428_100028757 Ga0075428_1000287573 194
9 3300009147 Ga0114129_10327557 Ga0114129_103275572 194
10 3300050507 nmdc:mga05p37_152672_c1 nmdc:mga05p37_152672_c1_762_1352 194
11 3300050508 nmdc:mga09592_216294_c1 nmdc:mga09592_216294_c1_241_831 194
12 3300014326 Ga0157380_10311124 Ga0157380_103111242 195
13 3300041443 Ga0451789_1217283 Ga0451789_1217283_147_749 197
14 3300025921 Ga0207652_10390382 Ga0207652_103903822 199
15 3300049589 Ga0501073_0005272 Ga0501073_0005272_6801_7433 200
16 3300049742 Ga0501080_0089362 Ga0501080_0089362_1035_1667 200
17 3300005331 Ga0070670_100163261 Ga0070670_1001632611 201
18 3300048910 Ga0496107_0329685 Ga0496107_0329685_184_837 201
19 3300053090 Ga0500646_0037648 Ga0500646_0037648_165_809 201
20 3300005340 Ga0070689_100625709 Ga0070689_1006257091 204
21 3300009094 Ga0111539_10000018 Ga0111539_10000018101 204
22 3300027907 Ga0207428_10000003 Ga0207428_10000003363 204
23 3300050511 nmdc:mga08y16_4_c1 nmdc:mga08y16_4_c1_449064_449681 204
24 3300006844 Ga0075428_100118763 Ga0075428_1001187634 206
25 3300006847 Ga0075431_100413188 Ga0075431_1004131882 206
26 3300050510 nmdc:mga06r32_692442_c1 nmdc:mga06r32_692442_c1_184_810 206
27 3300006028 Ga0070717_10468209 Ga0070717_104682092 208
28 3300031824 Ga0307413_10558237 Ga0307413_105582372 208
29 3300049575 Ga0501039_0065828 Ga0501039_0065828_1505_2209 208
30 3300049583 Ga0501067_0091741 Ga0501067_0091741_394_1047 208
31 3300049585 Ga0501069_0032717 Ga0501069_0032717_1041_1694 208
32 3300005355 Ga0070671_100186688 Ga0070671_1001866882 210
33 3300006847 Ga0075431_100094208 Ga0075431_1000942084 210
34 3300009147 Ga0114129_10291502 Ga0114129_102915022 210
35 3300036401 Ga0373937_0866511 Ga0373937_0866511_86_727 210
36 3300046477 Ga0495664_0311624 Ga0495664_0311624_83_736 210
37 3300046663 Ga0495635_0572646 Ga0495635_0572646_24_677 210
38 3300046689 Ga0495613_0070538 Ga0495613_0070538_965_1618 210
39 3300050507 nmdc:mga05p37_668408_c1 nmdc:mga05p37_668408_c1_321_974 210
40 3300053085 Ga0495619_0073654 Ga0495619_0073654_1142_1795 210
41 3300005331 Ga0070670_100287166 Ga0070670_1002871662 211
42 3300005336 Ga0070680_100117782 Ga0070680_1001177823 211
43 3300005353 Ga0070669_100310985 Ga0070669_1003109851 211
44 3300005364 Ga0070673_100689489 Ga0070673_1006894891 211
45 3300005441 Ga0070700_100020211 Ga0070700_1000202112 211
46 3300005456 Ga0070678_100849212 Ga0070678_1008492121 211
47 3300005471 Ga0070698_100635616 Ga0070698_1006356161 211
48 3300006358 Ga0068871_100226882 Ga0068871_1002268822 211
49 3300006847 Ga0075431_100491601 Ga0075431_1004916011 211
50 3300006880 Ga0075429_100078359 Ga0075429_1000783593 211
51 3300009147 Ga0114129_10360816 Ga0114129_103608162 211
52 3300009177 Ga0105248_10087462 Ga0105248_100874622 211
53 3300013308 Ga0157375_10464402 Ga0157375_104644022 211
54 3300014326 Ga0157380_10015509 Ga0157380_100155093 211
55 3300014326 Ga0157380_10023763 Ga0157380_100237632 211
56 3300017792 Ga0163161_10784585 Ga0163161_107845851 211
57 3300025940 Ga0207691_10338133 Ga0207691_103381332 211
58 3300026075 Ga0207708_10308121 Ga0207708_103081212 211
59 3300026121 Ga0207683_10863710 Ga0207683_108637102 211
60 3300027682 Ga0209971_1029689 Ga0209971_10296892 211
61 3300027907 Ga0207428_10001467 Ga0207428_100014673 211
62 3300027907 Ga0207428_10089398 Ga0207428_100893982 211
63 3300031852 Ga0307410_10029737 Ga0307410_100297372 211
64 3300041486 Ga0451807_2253144 Ga0451807_2253144_458_1102 211
65 3300046681 Ga0495647_0129136 Ga0495647_0129136_85_726 211
66 3300049572 Ga0501036_0261975 Ga0501036_0261975_118_762 211
67 3300049576 Ga0501040_0458142 Ga0501040_0458142_156_800 211
68 3300049577 Ga0501041_0074582 Ga0501041_0074582_498_1142 211
69 3300049582 Ga0501048_0041336 Ga0501048_0041336_1602_2246 211
70 3300049582 Ga0501048_0145659 Ga0501048_0145659_104_748 211
71 3300049587 Ga0501071_0034524 Ga0501071_0034524_368_1012 211
72 3300049588 Ga0501072_0553906 Ga0501072_0553906_115_759 211
73 3300049589 Ga0501073_0003127 Ga0501073_0003127_5404_6048 211
74 3300049590 Ga0501074_0095156 Ga0501074_0095156_251_895 211
75 3300049592 Ga0501076_0047811 Ga0501076_0047811_462_1106 211
76 3300049592 Ga0501076_0456242 Ga0501076_0456242_78_722 211
77 3300049824 Ga0501045_0185231 Ga0501045_0185231_452_1096 211
78 3300050507 nmdc:mga05p37_263199_c1 nmdc:mga05p37_263199_c1_488_1132 211
79 3300050508 nmdc:mga09592_202689_c1 nmdc:mga09592_202689_c1_565_1209 211
80 3300050511 nmdc:mga08y16_100910_c1 nmdc:mga08y16_100910_c1_2304_2948 211
81 3300050511 nmdc:mga08y16_12970_c1 nmdc:mga08y16_12970_c1_5885_6529 211
82 3300050511 nmdc:mga08y16_24232_c1 nmdc:mga08y16_24232_c1_3868_4512 211
83 3300050513 nmdc:mga0rr50_413214_c1 nmdc:mga0rr50_413214_c1_482_1126 211
84 3300054114 Ga0501084_0052525 Ga0501084_0052525_481_1125 211
85 3300060353 Ga0501082_0091274 Ga0501082_0091274_87_731 211
86 3300060353 Ga0501082_0289628 Ga0501082_0289628_599_1243 211
87 3300061734 Ga0530510_0133412 Ga0530510_0133412_839_1483 211
88 3300005347 Ga0070668_100427574 Ga0070668_1004275741 212
89 3300005459 Ga0068867_100270601 Ga0068867_1002706011 212
90 3300005518 Ga0070699_100136230 Ga0070699_1001362303 212
91 3300006846 Ga0075430_100452693 Ga0075430_1004526932 212
92 3300006847 Ga0075431_100052042 Ga0075431_1000520422 212
93 3300006847 Ga0075431_100185557 Ga0075431_1001855572 212
94 3300006852 Ga0075433_10644068 Ga0075433_106440682 212
95 3300025972 Ga0207668_10652628 Ga0207668_106526281 212
96 3300031548 Ga0307408_100974632 Ga0307408_1009746321 212
97 3300031911 Ga0307412_10717401 Ga0307412_107174012 212
98 3300031995 Ga0307409_100038927 Ga0307409_1000389273 212
99 3300032005 Ga0307411_10308857 Ga0307411_103088572 212
100 3300042435 Ga0439434_0082723 Ga0439434_0082723_300_944 212
101 3300049582 Ga0501048_0123144 Ga0501048_0123144_211_885 212
102 3300049587 Ga0501071_0211951 Ga0501071_0211951_700_1374 212
103 3300049592 Ga0501076_0113731 Ga0501076_0113731_1115_1789 212
104 3300050510 nmdc:mga06r32_287536_c1 nmdc:mga06r32_287536_c1_447_1109 212
105 3300054114 Ga0501084_0282021 Ga0501084_0282021_676_1350 212
106 3300005335 Ga0070666_10031423 Ga0070666_100314234 213
107 3300005338 Ga0068868_100014709 Ga0068868_1000147094 213
108 3300005468 Ga0070707_100007803 Ga0070707_1000078039 213
109 3300005718 Ga0068866_10062694 Ga0068866_100626943 213
110 3300005842 Ga0068858_100004839 Ga0068858_10000483912 213
111 3300005843 Ga0068860_100360515 Ga0068860_1003605153 213
112 3300006358 Ga0068871_100062359 Ga0068871_1000623595 213
113 3300006847 Ga0075431_100089718 Ga0075431_1000897182 213
114 3300006871 Ga0075434_100171586 Ga0075434_1001715862 213
115 3300006880 Ga0075429_100318694 Ga0075429_1003186942 213
116 3300006880 Ga0075429_100714341 Ga0075429_1007143411 213
117 3300006881 Ga0068865_100049345 Ga0068865_1000493455 213
118 3300009093 Ga0105240_10733064 Ga0105240_107330642 213
119 3300009094 Ga0111539_10562631 Ga0111539_105626312 213
120 3300009098 Ga0105245_10008974 Ga0105245_100089745 213
121 3300009147 Ga0114129_10000886 Ga0114129_1000088627 213
122 3300009147 Ga0114129_10063250 Ga0114129_100632503 213
123 3300009176 Ga0105242_10004812 Ga0105242_100048125 213
124 3300009177 Ga0105248_10012576 Ga0105248_100125766 213
125 3300013296 Ga0157374_10033016 Ga0157374_100330165 213
126 3300014968 Ga0157379_10051966 Ga0157379_100519665 213
127 3300014969 Ga0157376_10031645 Ga0157376_100316455 213
128 3300025903 Ga0207680_10086391 Ga0207680_100863913 213
129 3300025913 Ga0207695_10447824 Ga0207695_104478242 213
130 3300025922 Ga0207646_10072100 Ga0207646_100721002 213
131 3300025938 Ga0207704_10086577 Ga0207704_100865773 213
132 3300025941 Ga0207711_10061352 Ga0207711_100613523 213
133 3300026023 Ga0207677_10014414 Ga0207677_100144145 213
134 3300026035 Ga0207703_10077491 Ga0207703_100774912 213
135 3300028379 Ga0268266_10008864 Ga0268266_100088647 213
136 3300028381 Ga0268264_10335230 Ga0268264_103352302 213
137 3300046528 Ga0495642_0265534 Ga0495642_0265534_20_673 213
138 3300050507 nmdc:mga05p37_22267_c2 nmdc:mga05p37_22267_c2_1354_2016 213
139 3300050507 nmdc:mga05p37_2408_c1 nmdc:mga05p37_2408_c1_580_1245 213
140 3300050507 nmdc:mga05p37_99866_c1 nmdc:mga05p37_99866_c1_573_1241 213
141 3300050508 nmdc:mga09592_247041_c1 nmdc:mga09592_247041_c1_663_1328 213
142 3300050508 nmdc:mga09592_295701_c1 nmdc:mga09592_295701_c1_130_798 213
143 3300050510 nmdc:mga06r32_93257_c1 nmdc:mga06r32_93257_c1_1987_2655 213
144 3300050511 nmdc:mga08y16_153695_c1 nmdc:mga08y16_153695_c1_151_816 213
145 3300050512 nmdc:mga0n895_274358_c1 nmdc:mga0n895_274358_c1_323_976 213
146 3300050512 nmdc:mga0n895_39257_c1 nmdc:mga0n895_39257_c1_2990_3655 213
147 3300050513 nmdc:mga0rr50_61656_c1 nmdc:mga0rr50_61656_c1_1878_2543 213
148 3300050513 nmdc:mga0rr50_89381_c1 nmdc:mga0rr50_89381_c1_1253_1900 213
149 3300005293 Ga0065715_10018291 Ga0065715_100182912 214
150 3300005336 Ga0070680_100208302 Ga0070680_1002083022 214
151 3300005366 Ga0070659_100064104 Ga0070659_1000641043 214
152 3300005434 Ga0070709_10402639 Ga0070709_104026392 214
153 3300005458 Ga0070681_10046585 Ga0070681_100465856 214
154 3300005563 Ga0068855_100029227 Ga0068855_1000292274 214
155 3300005564 Ga0070664_100298155 Ga0070664_1002981552 214
156 3300005577 Ga0068857_100443039 Ga0068857_1004430392 214
157 3300005616 Ga0068852_100223378 Ga0068852_1002233783 214
158 3300005618 Ga0068864_100404833 Ga0068864_1004048331 214
159 3300005841 Ga0068863_100521966 Ga0068863_1005219662 214
160 3300005843 Ga0068860_100403694 Ga0068860_1004036942 214
161 3300006358 Ga0068871_100542599 Ga0068871_1005425992 214
162 3300006881 Ga0068865_100427838 Ga0068865_1004278381 214
163 3300009093 Ga0105240_10006149 Ga0105240_100061497 214
164 3300009177 Ga0105248_10462793 Ga0105248_104627932 214
165 3300013306 Ga0163162_10188028 Ga0163162_101880282 214
166 3300013308 Ga0157375_11311339 Ga0157375_113113391 214
167 3300014325 Ga0163163_10026560 Ga0163163_100265604 214
168 3300017792 Ga0163161_10065670 Ga0163161_100656702 214
169 3300025912 Ga0207707_10026199 Ga0207707_100261995 214
170 3300025913 Ga0207695_10441503 Ga0207695_104415032 214
171 3300025917 Ga0207660_10281074 Ga0207660_102810742 214
172 3300025919 Ga0207657_10140279 Ga0207657_101402793 214
173 3300025921 Ga0207652_10049212 Ga0207652_100492124 214
174 3300025921 Ga0207652_10099452 Ga0207652_100994523 214
175 3300025941 Ga0207711_10651693 Ga0207711_106516932 214
176 3300025949 Ga0207667_10273595 Ga0207667_102735952 214
177 3300026088 Ga0207641_10147915 Ga0207641_101479153 214
178 3300026095 Ga0207676_10036492 Ga0207676_100364922 214
179 3300026116 Ga0207674_10103741 Ga0207674_101037414 214
180 3300026142 Ga0207698_10196373 Ga0207698_101963732 214
181 3300035725 Ga0373947_0166824 Ga0373947_0166824_23_688 214
182 3300036401 Ga0373937_0365492 Ga0373937_0365492_666_1331 214
183 3300037068 Ga0373925_0260480 Ga0373925_0260480_381_1046 214
184 3300042876 Ga0451577_0580220 Ga0451577_0580220_141_803 214
185 3300048907 Ga0496104_0208307 Ga0496104_0208307_163_825 214
186 3300048909 Ga0496106_0129552 Ga0496106_0129552_564_1226 214
187 3300048912 Ga0496109_0546329 Ga0496109_0546329_279_941 214
188 3300048913 Ga0496110_0306643 Ga0496110_0306643_185_853 214
189 3300048915 Ga0496112_0585316 Ga0496112_0585316_242_904 214
190 3300049571 Ga0501034_0161643 Ga0501034_0161643_1042_1695 214
191 3300005330 Ga0070690_100177436 Ga0070690_1001774361 215
192 3300005331 Ga0070670_100193093 Ga0070670_1001930933 215
193 3300005334 Ga0068869_100052380 Ga0068869_1000523804 215
194 3300005335 Ga0070666_10004442 Ga0070666_100044423 215
195 3300005338 Ga0068868_100062085 Ga0068868_1000620852 215
196 3300005340 Ga0070689_100031437 Ga0070689_1000314372 215
197 3300005344 Ga0070661_100151112 Ga0070661_1001511122 215
198 3300005353 Ga0070669_100153318 Ga0070669_1001533183 215
199 3300005354 Ga0070675_100466254 Ga0070675_1004662543 215
200 3300005355 Ga0070671_100005536 Ga0070671_1000055362 215
201 3300005365 Ga0070688_100018494 Ga0070688_1000184942 215
202 3300005367 Ga0070667_100003314 Ga0070667_1000033142 215
203 3300005367 Ga0070667_100187959 Ga0070667_1001879592 215
204 3300005445 Ga0070708_100076429 Ga0070708_1000764294 215
205 3300005545 Ga0070695_100412819 Ga0070695_1004128191 215
206 3300005548 Ga0070665_100099978 Ga0070665_1000999781 215
207 3300005564 Ga0070664_100122183 Ga0070664_1001221833 215
208 3300005617 Ga0068859_100030965 Ga0068859_1000309651 215
209 3300005617 Ga0068859_100452164 Ga0068859_1004521643 215
210 3300005618 Ga0068864_100020423 Ga0068864_1000204232 215
211 3300005618 Ga0068864_100326519 Ga0068864_1003265193 215
212 3300005841 Ga0068863_100234577 Ga0068863_1002345773 215
213 3300005841 Ga0068863_100435232 Ga0068863_1004352322 215
214 3300005842 Ga0068858_100013649 Ga0068858_1000136491 215
215 3300005843 Ga0068860_100050659 Ga0068860_1000506594 215
216 3300006237 Ga0097621_100019804 Ga0097621_1000198045 215
217 3300006358 Ga0068871_100015880 Ga0068871_1000158805 215
218 3300006871 Ga0075434_100185523 Ga0075434_1001855231 215
219 3300006931 Ga0097620_100030965 Ga0097620_1000309651 215
220 3300006931 Ga0097620_100452198 Ga0097620_1004521983 215
221 3300009094 Ga0111539_10839837 Ga0111539_108398372 215
222 3300009147 Ga0114129_10194323 Ga0114129_101943231 215
223 3300009176 Ga0105242_10379337 Ga0105242_103793373 215
224 3300009177 Ga0105248_10006356 Ga0105248_1000635610 215
225 3300013306 Ga0163162_10144764 Ga0163162_101447641 215
226 3300013308 Ga0157375_10005393 Ga0157375_100053939 215
227 3300014325 Ga0163163_10253965 Ga0163163_102539652 215
228 3300014326 Ga0157380_10080962 Ga0157380_100809623 215
229 3300014968 Ga0157379_10006669 Ga0157379_100066699 215
230 3300014969 Ga0157376_10197872 Ga0157376_101978722 215
231 3300017792 Ga0163161_10008827 Ga0163161_100088277 215
232 3300025903 Ga0207680_10014446 Ga0207680_100144463 215
233 3300025923 Ga0207681_10216275 Ga0207681_102162753 215
234 3300025926 Ga0207659_10000559 Ga0207659_1000055918 215
235 3300025931 Ga0207644_10412487 Ga0207644_104124872 215
236 3300025936 Ga0207670_10346867 Ga0207670_103468671 215
237 3300025941 Ga0207711_10040248 Ga0207711_100402482 215
238 3300025942 Ga0207689_10065376 Ga0207689_100653763 215
239 3300025945 Ga0207679_10059375 Ga0207679_100593754 215
240 3300025960 Ga0207651_10016807 Ga0207651_100168073 215
241 3300025986 Ga0207658_10023593 Ga0207658_100235932 215
242 3300026023 Ga0207677_10019027 Ga0207677_100190271 215
243 3300026023 Ga0207677_10034307 Ga0207677_100343075 215
244 3300026023 Ga0207677_10840883 Ga0207677_108408831 215
245 3300026035 Ga0207703_10396752 Ga0207703_103967522 215
246 3300026035 Ga0207703_10397349 Ga0207703_103973492 215
247 3300026088 Ga0207641_10011484 Ga0207641_100114844 215
248 3300026088 Ga0207641_10339139 Ga0207641_103391393 215
249 3300026095 Ga0207676_10159485 Ga0207676_101594852 215
250 3300026118 Ga0207675_100645991 Ga0207675_1006459912 215
251 3300028379 Ga0268266_10106768 Ga0268266_101067682 215
252 3300028380 Ga0268265_10904287 Ga0268265_109042872 215
253 3300028381 Ga0268264_10108784 Ga0268264_101087842 215
254 3300031456 Ga0307513_10376728 Ga0307513_103767282 215
255 3300035117 Ga0373953_0085410 Ga0373953_0085410_607_1266 215
256 3300046683 Ga0495658_0068653 Ga0495658_0068653_36_692 215
257 3300048913 Ga0496110_0083365 Ga0496110_0083365_567_1226 215
258 3300050512 nmdc:mga0n895_80323_c1 nmdc:mga0n895_80323_c1_1269_1949 215
259 3300053085 Ga0495619_0153549 Ga0495619_0153549_60_716 215
260 3300005290 Ga0065712_10093766 Ga0065712_100937663 216
261 3300005356 Ga0070674_100524239 Ga0070674_1005242391 216
262 3300006847 Ga0075431_100024752 Ga0075431_1000247526 216
263 3300025918 Ga0207662_10432054 Ga0207662_104320541 216
264 3300031911 Ga0307412_10325486 Ga0307412_103254862 216
265 3300035092 Ga0373952_0081797 Ga0373952_0081797_114_794 216
266 3300042129 Ga0450891_006985 Ga0450891_006985_274_963 216
267 3300049570 Ga0501033_0381427 Ga0501033_0381427_201_854 216
268 3300049572 Ga0501036_0905406 Ga0501036_0905406_25_678 216
269 3300049590 Ga0501074_0631910 Ga0501074_0631910_73_726 216
270 3300050510 nmdc:mga06r32_10411_c1 nmdc:mga06r32_10411_c1_5246_5896 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

43

247

0.78

PF01738

DLH

Dienelactone hydrolase family

94

240

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fhz-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase at 2.0 angstrom resolution 0.8394 6 214
3u0v-assembly1.cif.gz_A crystal structure analysis of human lyplal1 0.8282 13 216
1aur-assembly1.cif.gz_B pmsf-inhibited carboxylesterase from pseudomonas fluorescens 0.8233 14 216
4ftw-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase n110c/l145h at 2.3 angstrom resolution 0.821 6 214
6avx-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 f65l 0.8124 26 216
ID Description Score Start End Superfamily
3u0vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8282 13 216 3.40.50.1820
3b5eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8265 5 212 3.40.50.1820
4ftwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.821 6 214 3.40.50.1820
af_P76561_1_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8204 10 211 3.40.50.1820
af_Q55FK4_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8124 14 214 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V8EFJ5-F1-model_v4 Phospholipase 0.9803 116 214
AF-A0A2V8FNB2-F1-model_v4 Phospholipase 0.979 1 212 GO:0016787
AF-A0A2V8KFT8-F1-model_v4 Phospholipase 0.9717 1 216 GO:0016787
AF-A0A2V8KFT8-F1-model_v4 Phospholipase 0.9629 1 216 GO:0016787
AF-A0A381S5B9-F1-model_v4 Phospholipase/carboxylesterase/thioesterase domain-containing protein 0.9623 1 146 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.47 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map