F376964

General Info

Members Datasets Scaffolds Average Seq Length
270 187 540 79

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_13277231|Ga0157380_132772312
Length 76
Sequence MKTMTCKQLGGPCDLAHHGEDANDVIKAQDQHLKEVAGDGAHDQAAAEMKGRWKHPIKGMGWYKQAKKDFAALPED

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
116 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
117 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
120 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
123 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 2.59
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 0
Rhizoplane 12.96
Rhizosphere 78.15
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_13277231 3300014326 Bacteria 517
2 JGI24739J22299_10039613 3300001989 Bacteria 1577
3 JGI24737J22298_10180649 3300001990 Bacteria 623
4 JGI24735J21928_10042196 3300002067 Bacteria 1329
5 rootL2_10107442 3300003322 Bacteria 7920
6 Ga0070658_10063789 3300005327 Bacteria 3004
7 Ga0070658_11117184 3300005327 Bacteria 685
8 Ga0070676_11443218 3300005328 Bacteria 529
9 Ga0070680_101458965 3300005336 Bacteria 592
10 Ga0068868_100423368 3300005338 Bacteria 1153
11 Ga0070660_100431142 3300005339 Bacteria 1092
12 Ga0070660_101480296 3300005339 Bacteria 577
13 Ga0070689_101352954 3300005340 Bacteria 642
14 Ga0070692_11024044 3300005345 Bacteria 579
15 Ga0070668_100685601 3300005347 Bacteria 903
16 Ga0070668_101056329 3300005347 Bacteria 731
17 Ga0070673_102096664 3300005364 Unclassified 537
18 Ga0070688_101615358 3300005365 Bacteria 529
19 Ga0070714_100000002 3300005435 Bacteria 386673
20 Ga0070701_10481392 3300005438 Bacteria 802
21 Ga0070705_100255498 3300005440 Bacteria 1233
22 Ga0070663_100001386 3300005455 Bacteria 13277
23 Ga0070678_100051513 3300005456 Bacteria 2985
24 Ga0070678_100285204 3300005456 Bacteria 1398
25 Ga0070678_100840675 3300005456 Bacteria 836
26 Ga0070678_101846404 3300005456 Bacteria 570
27 Ga0070681_10039676 3300005458 Bacteria 4720
28 Ga0070685_11418866 3300005466 Bacteria 533
29 Ga0070706_100006320 3300005467 Bacteria 11194
30 Ga0070706_100371904 3300005467 Bacteria 1331
31 Ga0070707_100407085 3300005468 Bacteria 1320
32 Ga0070679_100003521 3300005530 Bacteria 14333
33 Ga0070679_100081170 3300005530 Bacteria 3232
34 Ga0070679_101212335 3300005530 Bacteria 700
35 Ga0070684_100902360 3300005535 Bacteria 828
36 Ga0070695_100137399 3300005545 Bacteria 1691
37 Ga0070696_100837573 3300005546 Bacteria 759
38 Ga0070704_100079347 3300005549 Bacteria 2411
39 Ga0068855_101754819 3300005563 Bacteria 632
40 Ga0068854_101438805 3300005578 Unclassified 624
41 Ga0070702_100124709 3300005615 Bacteria 1617
42 Ga0068866_10542290 3300005718 Bacteria 776
43 Ga0068866_11123359 3300005718 Bacteria 564
44 Ga0068870_11011855 3300005840 Bacteria 593
45 Ga0068858_100944186 3300005842 Bacteria 844
46 Ga0068860_101963421 3300005843 Unclassified 607
47 Ga0081455_10009918 3300005937 Bacteria 9744
48 Ga0081538_10000423 3300005981 Bacteria 47580
49 Ga0081538_10002103 3300005981 Bacteria 19854
50 Ga0075365_10067275 3300006038 Bacteria 2405
51 Ga0075365_10752652 3300006038 Bacteria 688
52 Ga0075364_10075650 3300006051 Bacteria 2222
53 Ga0070712_101347020 3300006175 Unclassified 622
54 Ga0068871_101719570 3300006358 Bacteria 595
55 Ga0075430_100599089 3300006846 Bacteria 909
56 Ga0075434_100237897 3300006871 Bacteria 1841
57 Ga0068865_100185450 3300006881 Bacteria 1605
58 Ga0105240_10060309 3300009093 Bacteria 4729
59 Ga0105240_11406848 3300009093 Bacteria 733
60 Ga0105245_10013114 3300009098 Bacteria 7222
61 Ga0105245_12024888 3300009098 Unclassified 629
62 Ga0105243_10650660 3300009148 Bacteria 1021
63 Ga0105243_11725896 3300009148 Unclassified 656
64 Ga0105242_10065904 3300009176 Bacteria 2990
65 Ga0105242_10642364 3300009176 Bacteria 1031
66 Ga0105242_10911512 3300009176 Bacteria 880
67 Ga0105248_12805551 3300009177 Bacteria 556
68 Ga0105249_12355691 3300009553 Unclassified 605
69 Ga0105239_11256900 3300010375 Bacteria 854
70 Ga0105246_11734548 3300011119 Bacteria 594
71 Ga0157369_10082509 3300013105 Bacteria 3439
72 Ga0157369_10800768 3300013105 Bacteria 968
73 Ga0157369_11094348 3300013105 Bacteria 815
74 Ga0157369_11663536 3300013105 Unclassified 649
75 Ga0157374_11722481 3300013296 Bacteria 652
76 Ga0157374_12585283 3300013296 Bacteria 535
77 Ga0157378_12295928 3300013297 Bacteria 591
78 Ga0163162_10030053 3300013306 Bacteria 5381
79 Ga0163162_10781873 3300013306 Bacteria 1073
80 Ga0163162_11846111 3300013306 Bacteria 691
81 Ga0157372_13298950 3300013307 Bacteria 514
82 Ga0157375_10015560 3300013308 Bacteria 6813
83 Ga0157375_10674937 3300013308 Bacteria 1188
84 Ga0157375_12189457 3300013308 Unclassified 658
85 Ga0157380_11157743 3300014326 Bacteria 815
86 Ga0157380_12603155 3300014326 Bacteria 572
87 Ga0157376_11209987 3300014969 Unclassified 784
88 Ga0197907_11059188 3300020069 Bacteria 1178
89 Ga0197907_11267062 3300020069 Bacteria 637
90 Ga0206354_11227071 3300020081 Bacteria 815
91 Ga0206353_10574470 3300020082 Bacteria 806
92 Ga0224712_10205781 3300022467 Bacteria 896
93 Ga0224712_10332757 3300022467 Bacteria 715
94 Ga0209051_1000539 3300025303 Bacteria 46616
95 Ga0207653_10400408 3300025885 Bacteria 538
96 Ga0207642_10887339 3300025899 Bacteria 571
97 Ga0207645_10210302 3300025907 Bacteria 1281
98 Ga0207705_10247056 3300025909 Bacteria 1360
99 Ga0207705_10760570 3300025909 Bacteria 753
100 Ga0207684_10002595 3300025910 Bacteria 18094
101 Ga0207684_10161845 3300025910 Bacteria 1927
102 Ga0207707_10617586 3300025912 Bacteria 916
103 Ga0207695_10292203 3300025913 Bacteria 1522
104 Ga0207660_11106684 3300025917 Bacteria 645
105 Ga0207657_10452774 3300025919 Bacteria 1007
106 Ga0207649_10645701 3300025920 Bacteria 817
107 Ga0207652_10002902 3300025921 Bacteria 14336
108 Ga0207652_10198009 3300025921 Bacteria 1808
109 Ga0207646_10428327 3300025922 Bacteria 1194
110 Ga0207694_10652770 3300025924 Bacteria 886
111 Ga0207687_10047327 3300025927 Bacteria 2981
112 Ga0207687_11713891 3300025927 Unclassified 538
113 Ga0207664_10000038 3300025929 Bacteria 166264
114 Ga0207644_11384866 3300025931 Bacteria 591
115 Ga0207686_10116095 3300025934 Bacteria 1814
116 Ga0207686_10320319 3300025934 Bacteria 1158
117 Ga0207709_10924909 3300025935 Unclassified 710
118 Ga0207704_10926899 3300025938 Bacteria 734
119 Ga0207691_11405269 3300025940 Bacteria 573
120 Ga0207689_10449790 3300025942 Bacteria 1077
121 Ga0207661_10133619 3300025944 Bacteria 2128
122 Ga0207667_11199443 3300025949 Bacteria 739
123 Ga0207640_10954546 3300025981 Unclassified 752
124 Ga0207658_11049441 3300025986 Bacteria 744
125 Ga0207677_10394129 3300026023 Bacteria 1172
126 Ga0207703_11293742 3300026035 Bacteria 701
127 Ga0207678_10011415 3300026067 Bacteria 7799
128 Ga0207702_11534101 3300026078 Bacteria 660
129 Ga0207641_12032770 3300026088 Unclassified 576
130 Ga0207683_10203802 3300026121 Bacteria 1799
131 Ga0207683_10420679 3300026121 Bacteria 1230
132 Ga0207683_11564393 3300026121 Bacteria 608
133 Ga0207698_10172352 3300026142 Bacteria 1907
134 Ga0268264_10563722 3300028381 Bacteria 1119
135 Ga0268264_10719386 3300028381 Bacteria 993
136 Ga0307512_10261941 3300030522 Bacteria 848
137 Ga0265765_1006695 3300030879 Bacteria 1232
138 Ga0265320_10195129 3300031240 Bacteria 905
139 Ga0265327_10021733 3300031251 Bacteria 3863
140 Ga0265327_10425093 3300031251 Bacteria 575
141 Ga0307509_10033883 3300031507 Bacteria 5617
142 Ga0307405_10565127 3300031731 Bacteria 923
143 Ga0307413_11213029 3300031824 Bacteria 657
144 Ga0307413_11278799 3300031824 Bacteria 641
145 Ga0307410_10285829 3300031852 Bacteria 1296
146 Ga0307410_11380051 3300031852 Bacteria 618
147 Ga0307406_10476877 3300031901 Bacteria 1007
148 Ga0307409_100924114 3300031995 Bacteria 887
149 Ga0307409_101440164 3300031995 Bacteria 716
150 Ga0307415_100333454 3300032126 Bacteria 1270
151 Ga0307507_10022295 3300033179 Bacteria 7006
152 Ga0373935_0045265 3300035692 Bacteria 2776
153 Ga0436364_1285376 3300037853 Bacteria 555
154 Ga0395901_0167651 3300038443 Bacteria 2305
155 Ga0395901_0218483 3300038443 Bacteria 1993
156 Ga0395901_0225578 3300038443 Bacteria 1957
157 Ga0395901_0253186 3300038443 Bacteria 1834
158 Ga0436363_0312312 3300039450 Bacteria 668
159 Ga0451806_683992 3300041462 Bacteria 521
160 Ga0451833_0062549 3300041491 Bacteria 660
161 Ga0451835_0363723 3300041492 Bacteria 591
162 Ga0451837_1402040 3300041494 Bacteria 596
163 Ga0451847_0893063 3300041503 Unclassified 566
164 Ga0451843_0318403 3300041509 Bacteria 546
165 Ga0451853_1454728 3300041512 Unclassified 602
166 Ga0451853_1688701 3300041512 Bacteria 565
167 Ga0439458_0005988 3300042157 Bacteria 2721
168 Ga0439459_0010440 3300042438 Bacteria 1620
169 Ga0439459_0047228 3300042438 Bacteria 934
170 Ga0466969_0028874 3300044656 Bacteria 2835
171 Ga0466966_0042329 3300044684 Bacteria 2924
172 Ga0466966_0385387 3300044684 Bacteria 842
173 Ga0466966_0517140 3300044684 Bacteria 718
174 Ga0466961_0090224 3300044693 Bacteria 1935
175 Ga0466961_0372426 3300044693 Bacteria 868
176 Ga0466961_0691391 3300044693 Bacteria 611
177 Ga0466971_0681802 3300044719 Unclassified 516
178 Ga0466968_0661188 3300044735 Bacteria 531
179 Ga0466970_0771908 3300044765 Bacteria 562
180 Ga0466960_0188843 3300044901 Bacteria 1120
181 Ga0466959_0013535 3300045049 Bacteria 5913
182 Ga0466959_0842934 3300045049 Unclassified 612
183 Ga0466958_0030423 3300045836 Bacteria 3207
184 Ga0466967_0083426 3300045976 Bacteria 2890
185 Ga0495653_0563351 3300046463 Bacteria 704
186 Ga0495664_0571761 3300046477 Bacteria 673
187 Ga0495664_0887509 3300046477 Bacteria 522
188 Ga0495632_0084050 3300046519 Bacteria 1515
189 Ga0495645_0209176 3300046543 Bacteria 1318
190 Ga0495600_0906811 3300046809 Bacteria 520
191 Ga0496100_1455687 3300048903 Unclassified 541
192 Ga0496101_0059858 3300048904 Bacteria 2762
193 Ga0496101_0301017 3300048904 Bacteria 1256
194 Ga0496102_0139105 3300048905 Bacteria 2276
195 Ga0496102_1620787 3300048905 Bacteria 565
196 Ga0496102_1692847 3300048905 Bacteria 550
197 Ga0496103_0393814 3300048906 Bacteria 890
198 Ga0496104_0025790 3300048907 Bacteria 5420
199 Ga0496104_0620286 3300048907 Bacteria 991
200 Ga0496105_0012876 3300048908 Bacteria 6629
201 Ga0496105_0038723 3300048908 Bacteria 3928
202 Ga0496105_0469136 3300048908 Bacteria 992
203 Ga0496105_0745021 3300048908 Bacteria 749
204 Ga0496106_0248497 3300048909 Bacteria 1422
205 Ga0496106_0642913 3300048909 Bacteria 848
206 Ga0496107_0287927 3300048910 Bacteria 1223
207 Ga0496108_0104134 3300048911 Bacteria 2422
208 Ga0496108_1480673 3300048911 Bacteria 565
209 Ga0496109_0145149 3300048912 Bacteria 2220
210 Ga0496109_0250524 3300048912 Bacteria 1668
211 Ga0496110_0040719 3300048913 Bacteria 4050
212 Ga0496110_0088875 3300048913 Bacteria 2760
213 Ga0496111_0036008 3300048914 Bacteria 3539
214 Ga0496111_0086623 3300048914 Bacteria 2292
215 Ga0496111_0146411 3300048914 Bacteria 1751
216 Ga0496112_0272132 3300048915 Bacteria 1642
217 Ga0496112_0470648 3300048915 Bacteria 1194
218 Ga0496112_0779112 3300048915 Bacteria 882
219 Ga0496113_0097919 3300048916 Bacteria 2270
220 Ga0496114_0137590 3300048917 Bacteria 2112
221 Ga0496114_0403814 3300048917 Bacteria 1210
222 Ga0496115_0898897 3300048918 Bacteria 683
223 Ga0496115_1215043 3300048918 Bacteria 566
224 Ga0496115_1345562 3300048918 Bacteria 530
225 Ga0496126_0629582 3300048929 Bacteria 842
226 Ga0501031_0118869 3300049568 Bacteria 1727
227 Ga0501032_0377041 3300049569 Bacteria 912
228 Ga0501034_0065978 3300049571 Bacteria 3633
229 Ga0501034_0150960 3300049571 Bacteria 2299
230 Ga0501034_0247003 3300049571 Bacteria 1729
231 Ga0501034_0629018 3300049571 Bacteria 977
232 Ga0501036_0018075 3300049572 Bacteria 5902
233 Ga0501036_0453221 3300049572 Bacteria 1069
234 Ga0501037_0011351 3300049573 Bacteria 6559
235 Ga0501038_0434058 3300049574 Bacteria 1012
236 Ga0501039_0223911 3300049575 Bacteria 1478
237 Ga0501039_0909326 3300049575 Bacteria 685
238 Ga0501039_1039712 3300049575 Bacteria 636
239 Ga0501041_0348863 3300049577 Bacteria 935
240 Ga0501041_1030169 3300049577 Bacteria 530
241 Ga0501043_0120455 3300049579 Bacteria 2058
242 Ga0501046_0056924 3300049580 Bacteria 3067
243 Ga0501047_0005954 3300049581 Bacteria 11460
244 Ga0501047_0595515 3300049581 Bacteria 927
245 Ga0501048_0663003 3300049582 Bacteria 749
246 Ga0501068_0013680 3300049584 Bacteria 4621
247 Ga0501069_0023732 3300049585 Bacteria 3343
248 Ga0501069_0855184 3300049585 Bacteria 552
249 Ga0501070_0005033 3300049586 Bacteria 11277
250 Ga0501070_0336880 3300049586 Bacteria 1225
251 Ga0501070_0785392 3300049586 Bacteria 749
252 Ga0501071_0186534 3300049587 Bacteria 1555
253 Ga0501073_0001230 3300049589 Bacteria 18690
254 Ga0501074_0000590 3300049590 Bacteria 22552
255 Ga0501076_0080662 3300049592 Bacteria 2612
256 Ga0501076_1318337 3300049592 Bacteria 594
257 Ga0501079_0787122 3300049741 Bacteria 749
258 Ga0501080_0007318 3300049742 Bacteria 9961
259 Ga0501044_0093377 3300049823 Bacteria 3034
260 Ga0501045_1414084 3300049824 Bacteria 505
261 nmdc:mga00v17_64143_c1 3300050491 Bacteria 2263
262 nmdc:mga0yw44_1149699_c1 3300050492 Bacteria 524
263 nmdc:mga0yw44_405429_c1 3300050492 Bacteria 922
264 nmdc:mga0n895_346668_c1 3300050512 Bacteria 1504
265 Ga0495619_0604752 3300053085 Bacteria 750
266 Ga0500583_0112859 3300053092 Unclassified 1340
267 Ga0500628_000127 3300053129 Bacteria 15347
268 Ga0500616_0026933 3300053153 Bacteria 3177
269 Ga0466962_0084281 3300061719 Unclassified 1521
270 2753268802 2751185782 Bacteria 11227053
271 Ga0157380_13277231
272 JGI24739J22299_10039613
273 JGI24737J22298_10180649
274 JGI24735J21928_10042196
275 rootL2_10107442
276 Ga0070658_10063789
277 Ga0070658_11117184
278 Ga0070676_11443218
279 Ga0070680_101458965
280 Ga0068868_100423368
281 Ga0070660_100431142
282 Ga0070660_101480296
283 Ga0070689_101352954
284 Ga0070692_11024044
285 Ga0070668_100685601
286 Ga0070668_101056329
287 Ga0070673_102096664
288 Ga0070688_101615358
289 Ga0070714_100000002
290 Ga0070701_10481392
291 Ga0070705_100255498
292 Ga0070663_100001386
293 Ga0070678_100051513
294 Ga0070678_100285204
295 Ga0070678_100840675
296 Ga0070678_101846404
297 Ga0070681_10039676
298 Ga0070685_11418866
299 Ga0070706_100006320
300 Ga0070706_100371904
301 Ga0070707_100407085
302 Ga0070679_100003521
303 Ga0070679_100081170
304 Ga0070679_101212335
305 Ga0070684_100902360
306 Ga0070695_100137399
307 Ga0070696_100837573
308 Ga0070704_100079347
309 Ga0068855_101754819
310 Ga0068854_101438805
311 Ga0070702_100124709
312 Ga0068866_10542290
313 Ga0068866_11123359
314 Ga0068870_11011855
315 Ga0068858_100944186
316 Ga0068860_101963421
317 Ga0081455_10009918
318 Ga0081538_10000423
319 Ga0081538_10002103
320 Ga0075365_10067275
321 Ga0075365_10752652
322 Ga0075364_10075650
323 Ga0070712_101347020
324 Ga0068871_101719570
325 Ga0075430_100599089
326 Ga0075434_100237897
327 Ga0068865_100185450
328 Ga0105240_10060309
329 Ga0105240_11406848
330 Ga0105245_10013114
331 Ga0105245_12024888
332 Ga0105243_10650660
333 Ga0105243_11725896
334 Ga0105242_10065904
335 Ga0105242_10642364
336 Ga0105242_10911512
337 Ga0105248_12805551
338 Ga0105249_12355691
339 Ga0105239_11256900
340 Ga0105246_11734548
341 Ga0157369_10082509
342 Ga0157369_10800768
343 Ga0157369_11094348
344 Ga0157369_11663536
345 Ga0157374_11722481
346 Ga0157374_12585283
347 Ga0157378_12295928
348 Ga0163162_10030053
349 Ga0163162_10781873
350 Ga0163162_11846111
351 Ga0157372_13298950
352 Ga0157375_10015560
353 Ga0157375_10674937
354 Ga0157375_12189457
355 Ga0157380_11157743
356 Ga0157380_12603155
357 Ga0157376_11209987
358 Ga0197907_11059188
359 Ga0197907_11267062
360 Ga0206354_11227071
361 Ga0206353_10574470
362 Ga0224712_10205781
363 Ga0224712_10332757
364 Ga0209051_1000539
365 Ga0207653_10400408
366 Ga0207642_10887339
367 Ga0207645_10210302
368 Ga0207705_10247056
369 Ga0207705_10760570
370 Ga0207684_10002595
371 Ga0207684_10161845
372 Ga0207707_10617586
373 Ga0207695_10292203
374 Ga0207660_11106684
375 Ga0207657_10452774
376 Ga0207649_10645701
377 Ga0207652_10002902
378 Ga0207652_10198009
379 Ga0207646_10428327
380 Ga0207694_10652770
381 Ga0207687_10047327
382 Ga0207687_11713891
383 Ga0207664_10000038
384 Ga0207644_11384866
385 Ga0207686_10116095
386 Ga0207686_10320319
387 Ga0207709_10924909
388 Ga0207704_10926899
389 Ga0207691_11405269
390 Ga0207689_10449790
391 Ga0207661_10133619
392 Ga0207667_11199443
393 Ga0207640_10954546
394 Ga0207658_11049441
395 Ga0207677_10394129
396 Ga0207703_11293742
397 Ga0207678_10011415
398 Ga0207702_11534101
399 Ga0207641_12032770
400 Ga0207683_10203802
401 Ga0207683_10420679
402 Ga0207683_11564393
403 Ga0207698_10172352
404 Ga0268264_10563722
405 Ga0268264_10719386
406 Ga0307512_10261941
407 Ga0265765_1006695
408 Ga0265320_10195129
409 Ga0265327_10021733
410 Ga0265327_10425093
411 Ga0307509_10033883
412 Ga0307405_10565127
413 Ga0307413_11213029
414 Ga0307413_11278799
415 Ga0307410_10285829
416 Ga0307410_11380051
417 Ga0307406_10476877
418 Ga0307409_100924114
419 Ga0307409_101440164
420 Ga0307415_100333454
421 Ga0307507_10022295
422 Ga0373935_0045265
423 Ga0436364_1285376
424 Ga0395901_0167651
425 Ga0395901_0218483
426 Ga0395901_0225578
427 Ga0395901_0253186
428 Ga0436363_0312312
429 Ga0451806_683992
430 Ga0451833_0062549
431 Ga0451835_0363723
432 Ga0451837_1402040
433 Ga0451847_0893063
434 Ga0451843_0318403
435 Ga0451853_1454728
436 Ga0451853_1688701
437 Ga0439458_0005988
438 Ga0439459_0010440
439 Ga0439459_0047228
440 Ga0466969_0028874
441 Ga0466966_0042329
442 Ga0466966_0385387
443 Ga0466966_0517140
444 Ga0466961_0090224
445 Ga0466961_0372426
446 Ga0466961_0691391
447 Ga0466971_0681802
448 Ga0466968_0661188
449 Ga0466970_0771908
450 Ga0466960_0188843
451 Ga0466959_0013535
452 Ga0466959_0842934
453 Ga0466958_0030423
454 Ga0466967_0083426
455 Ga0495653_0563351
456 Ga0495664_0571761
457 Ga0495664_0887509
458 Ga0495632_0084050
459 Ga0495645_0209176
460 Ga0495600_0906811
461 Ga0496100_1455687
462 Ga0496101_0059858
463 Ga0496101_0301017
464 Ga0496102_0139105
465 Ga0496102_1620787
466 Ga0496102_1692847
467 Ga0496103_0393814
468 Ga0496104_0025790
469 Ga0496104_0620286
470 Ga0496105_0012876
471 Ga0496105_0038723
472 Ga0496105_0469136
473 Ga0496105_0745021
474 Ga0496106_0248497
475 Ga0496106_0642913
476 Ga0496107_0287927
477 Ga0496108_0104134
478 Ga0496108_1480673
479 Ga0496109_0145149
480 Ga0496109_0250524
481 Ga0496110_0040719
482 Ga0496110_0088875
483 Ga0496111_0036008
484 Ga0496111_0086623
485 Ga0496111_0146411
486 Ga0496112_0272132
487 Ga0496112_0470648
488 Ga0496112_0779112
489 Ga0496113_0097919
490 Ga0496114_0137590
491 Ga0496114_0403814
492 Ga0496115_0898897
493 Ga0496115_1215043
494 Ga0496115_1345562
495 Ga0496126_0629582
496 Ga0501031_0118869
497 Ga0501032_0377041
498 Ga0501034_0065978
499 Ga0501034_0150960
500 Ga0501034_0247003
501 Ga0501034_0629018
502 Ga0501036_0018075
503 Ga0501036_0453221
504 Ga0501037_0011351
505 Ga0501038_0434058
506 Ga0501039_0223911
507 Ga0501039_0909326
508 Ga0501039_1039712
509 Ga0501041_0348863
510 Ga0501041_1030169
511 Ga0501043_0120455
512 Ga0501046_0056924
513 Ga0501047_0005954
514 Ga0501047_0595515
515 Ga0501048_0663003
516 Ga0501068_0013680
517 Ga0501069_0023732
518 Ga0501069_0855184
519 Ga0501070_0005033
520 Ga0501070_0336880
521 Ga0501070_0785392
522 Ga0501071_0186534
523 Ga0501073_0001230
524 Ga0501074_0000590
525 Ga0501076_0080662
526 Ga0501076_1318337
527 Ga0501079_0787122
528 Ga0501080_0007318
529 Ga0501044_0093377
530 Ga0501045_1414084
531 nmdc:mga00v17_64143_c1
532 nmdc:mga0yw44_1149699_c1
533 nmdc:mga0yw44_405429_c1
534 nmdc:mga0n895_346668_c1
535 Ga0495619_0604752
536 Ga0500583_0112859
537 Ga0500628_000127
538 Ga0500616_0026933
539 Ga0466962_0084281
540 2753268802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iqv-assembly1.cif.gz_C crystal structure of cell surface glyceraldehyde-3-phosphate dehydrogenase complexed with hg2+ from lactobacillus plantarum 0.5868 14 34
8da3-assembly1.cif.gz_B coevolved affibody-z domain pair ll1.c1 0.5337 46 77
2e9x-assembly1.cif.gz_D the crystal structure of human gins core complex 0.4559 24 72
4oyd-assembly2.cif.gz_D crystal structure of a computationally designed inhibitor of an epstein-barr viral bcl-2 protein 0.4447 25 73
7ug7-assembly1.cif.gz_Lc 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.4179 5 74
ID Description Score Start End Superfamily
af_Q57930_48_179_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.8241 16 40 3.30.310.10
4hnvB01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.6354 2 35 3.30.470.20
af_P64540_3_87_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.631 18 51 1.10.225.10
af_Q4D4Z3_37_291_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6158 15 45 3.40.50.300
af_Q9NRC6_2574_2681_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5228 26 75 1.20.58.60
ID Description Score Start End GO Terms
AF-A0A495NQ97-F1-model_v4 deleted 1.009 1 78
AF-A0A420XQS2-F1-model_v4 Uncharacterized protein DUF1059 1.007 1 78
AF-A0A512D0F6-F1-model_v4 DUF1059 domain-containing protein 1.007 2 78
AF-A0A4R6HH17-F1-model_v4 deleted 1.005 1 78
AF-A0A6P0EUQ4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 1.005 2 78 GO:0003677
GO:0006352
GO:0016987

Map