F376958

General Info

Members Datasets Scaffolds Average Seq Length
270 140 270 110

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_11776058|Ga0157375_117760582
Length 101
Sequence MITNFDEFWDFYVQEHSKPMTRFLHFIGTSLGIIFLIYFXXXGRPILGYAFAWFAHFVVEKNKPASFKYPVWSFISDFKMMWFMITGRMRHEVERVMRQVQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
129 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
130 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
131 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
132 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
133 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
134 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
135 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
136 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
137 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
138 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.37
Rhizosphere 98.89
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4873538 2162886012 Unclassified 1050
2 Ga0065712_10079344 3300005290 Unclassified 3227
3 Ga0065715_10001820 3300005293 Bacteria 6373
4 Ga0065715_10298134 3300005293 Bacteria 1047
5 Ga0065715_10652423 3300005293 Unclassified 678
6 Ga0070676_10077680 3300005328 Bacteria 2007
7 Ga0070676_10344283 3300005328 Unclassified 1023
8 Ga0070690_100788804 3300005330 Unclassified 736
9 Ga0070670_100024073 3300005331 Bacteria 5237
10 Ga0070670_100155767 3300005331 Bacteria 1978
11 Ga0070670_100416781 3300005331 Unclassified 1187
12 Ga0070670_100481704 3300005331 Bacteria 1102
13 Ga0068869_100109473 3300005334 Bacteria 2100
14 Ga0070689_100076603 3300005340 Bacteria 2620
15 Ga0070689_100260949 3300005340 Bacteria 1432
16 Ga0070668_100096223 3300005347 Unclassified 2340
17 Ga0070668_100117699 3300005347 Unclassified 2120
18 Ga0070675_100071477 3300005354 Bacteria 2879
19 Ga0070675_100855695 3300005354 Unclassified 832
20 Ga0070671_100044647 3300005355 Bacteria 3683
21 Ga0070671_100239389 3300005355 Bacteria 1540
22 Ga0070674_100010490 3300005356 Bacteria 5604
23 Ga0070674_100512689 3300005356 Bacteria 1001
24 Ga0070673_100095317 3300005364 Unclassified 2441
25 Ga0070688_100253922 3300005365 Bacteria 1253
26 Ga0070659_101047836 3300005366 Unclassified 717
27 Ga0070667_100188825 3300005367 Bacteria 1825
28 Ga0070663_102160049 3300005455 Unclassified 502
29 Ga0070678_101657222 3300005456 Unclassified 601
30 Ga0070662_100161449 3300005457 Unclassified 1753
31 Ga0070681_10457999 3300005458 Bacteria 1188
32 Ga0068867_100612405 3300005459 Bacteria 951
33 Ga0068867_101602134 3300005459 Unclassified 608
34 Ga0070685_10630942 3300005466 Unclassified 774
35 Ga0070707_100529515 3300005468 Unclassified 1140
36 Ga0070679_101899217 3300005530 Unclassified 544
37 Ga0070672_100062691 3300005543 Unclassified 2935
38 Ga0070695_100923001 3300005545 Unclassified 706
39 Ga0070665_102028384 3300005548 Bacteria 580
40 Ga0068855_100117965 3300005563 Bacteria 3040
41 Ga0070664_100118826 3300005564 Unclassified 2313
42 Ga0070664_100453424 3300005564 Bacteria 1178
43 Ga0070664_101489662 3300005564 Bacteria 640
44 Ga0070664_101976684 3300005564 Unclassified 553
45 Ga0068857_100427101 3300005577 Bacteria 1236
46 Ga0068857_101757169 3300005577 Bacteria 607
47 Ga0068854_100343656 3300005578 Bacteria 1219
48 Ga0068854_100363800 3300005578 Bacteria 1187
49 Ga0068852_100188873 3300005616 Bacteria 1942
50 Ga0068859_100027855 3300005617 Bacteria 5666
51 Ga0068859_100053328 3300005617 Unclassified 4067
52 Ga0068859_100187902 3300005617 Unclassified 2150
53 Ga0068859_100672958 3300005617 Bacteria 1126
54 Ga0068859_101335041 3300005617 Unclassified 790
55 Ga0068864_100052640 3300005618 Bacteria 3509
56 Ga0068864_100518800 3300005618 Unclassified 1148
57 Ga0068864_101065576 3300005618 Bacteria 803
58 Ga0068866_10011985 3300005718 Unclassified 3770
59 Ga0068861_100146691 3300005719 Unclassified 1932
60 Ga0068861_100578804 3300005719 Unclassified 1027
61 Ga0068851_10104720 3300005834 Unclassified 1504
62 Ga0068870_10203409 3300005840 Bacteria 1202
63 Ga0068870_10309374 3300005840 Bacteria 1000
64 Ga0068863_100007427 3300005841 Bacteria 10726
65 Ga0068863_100111168 3300005841 Unclassified 2610
66 Ga0068858_100214369 3300005842 Unclassified 1822
67 Ga0068858_100235231 3300005842 Unclassified 1737
68 Ga0068858_100255881 3300005842 Bacteria 1664
69 Ga0068860_100269157 3300005843 Bacteria 1662
70 Ga0068860_100278024 3300005843 Bacteria 1635
71 Ga0068860_100393246 3300005843 Bacteria 1370
72 Ga0068862_100084678 3300005844 Bacteria 2755
73 Ga0068862_100392274 3300005844 Unclassified 1297
74 Ga0068862_101238137 3300005844 Bacteria 746
75 Ga0097621_100647277 3300006237 Unclassified 969
76 Ga0068871_101948929 3300006358 Unclassified 559
77 Ga0068865_100567436 3300006881 Unclassified 955
78 Ga0097620_100027859 3300006931 Bacteria 5666
79 Ga0097620_100053329 3300006931 Unclassified 4067
80 Ga0097620_100187903 3300006931 Unclassified 2150
81 Ga0097620_100672991 3300006931 Bacteria 1126
82 Ga0097620_101335049 3300006931 Unclassified 790
83 Ga0105250_10226894 3300009092 Bacteria 793
84 Ga0105240_10388201 3300009093 Unclassified 1575
85 Ga0111539_10234492 3300009094 Unclassified 2136
86 Ga0105245_10184336 3300009098 Bacteria 1996
87 Ga0105247_10157281 3300009101 Bacteria 1502
88 Ga0114129_11561158 3300009147 Bacteria 809
89 Ga0105241_10012487 3300009174 Bacteria 6228
90 Ga0105242_11359399 3300009176 Unclassified 736
91 Ga0105242_12110981 3300009176 Unclassified 607
92 Ga0105248_10162939 3300009177 Bacteria 2514
93 Ga0105248_10698398 3300009177 Unclassified 1145
94 Ga0105248_12361444 3300009177 Unclassified 606
95 Ga0105237_10984391 3300009545 Bacteria 850
96 Ga0105249_10031913 3300009553 Bacteria 4765
97 Ga0105249_10039632 3300009553 Unclassified 4278
98 Ga0105249_10082302 3300009553 Bacteria 2995
99 Ga0105249_10210185 3300009553 Bacteria 1909
100 Ga0105249_12045378 3300009553 Unclassified 645
101 Ga0105249_12648281 3300009553 Unclassified 574
102 Ga0105239_11505192 3300010375 Unclassified 778
103 Ga0105246_11297181 3300011119 Unclassified 675
104 Ga0105246_11672965 3300011119 Unclassified 604
105 Ga0157369_10234566 3300013105 Bacteria 1918
106 Ga0157374_10208255 3300013296 Bacteria 1917
107 Ga0157374_11558207 3300013296 Bacteria 684
108 Ga0157378_10423038 3300013297 Unclassified 1317
109 Ga0157378_11504887 3300013297 Bacteria 718
110 Ga0163162_10048441 3300013306 Bacteria 4258
111 Ga0163162_10050793 3300013306 Bacteria 4159
112 Ga0163162_10066404 3300013306 Unclassified 3656
113 Ga0163162_10259941 3300013306 Unclassified 1868
114 Ga0163162_10652132 3300013306 Unclassified 1176
115 Ga0163162_11076926 3300013306 Unclassified 910
116 Ga0157372_10605051 3300013307 Bacteria 1277
117 Ga0157375_10123785 3300013308 Bacteria 2698
118 Ga0157375_10189167 3300013308 Unclassified 2213
119 Ga0157375_10247582 3300013308 Unclassified 1943
120 Ga0157375_10507637 3300013308 Bacteria 1370
121 Ga0157375_10940013 3300013308 Unclassified 1007
122 Ga0157375_11069390 3300013308 Bacteria 944
123 Ga0157375_11776058 3300013308 Unclassified 731
124 Ga0157375_11998150 3300013308 Bacteria 689
125 Ga0163163_10076415 3300014325 Unclassified 3343
126 Ga0163163_10192854 3300014325 Unclassified 2086
127 Ga0163163_10381003 3300014325 Bacteria 1468
128 Ga0163163_10478978 3300014325 Bacteria 1305
129 Ga0163163_11566759 3300014325 Bacteria 720
130 Ga0163163_11805294 3300014325 Bacteria 672
131 Ga0157380_10077795 3300014326 Unclassified 2704
132 Ga0157380_11298131 3300014326 Bacteria 775
133 Ga0157380_11886608 3300014326 Unclassified 658
134 Ga0157376_12358531 3300014969 Unclassified 571
135 Ga0163161_10012961 3300017792 Bacteria 5792
136 Ga0207697_10209098 3300025315 Unclassified 859
137 Ga0207656_10377495 3300025321 Unclassified 710
138 Ga0207710_10068720 3300025900 Bacteria 1620
139 Ga0207710_10100171 3300025900 Unclassified 1365
140 Ga0207647_10270503 3300025904 Unclassified 971
141 Ga0207645_10093119 3300025907 Unclassified 1939
142 Ga0207643_10331666 3300025908 Bacteria 952
143 Ga0207654_10120855 3300025911 Bacteria 1644
144 Ga0207695_10530337 3300025913 Unclassified 1059
145 Ga0207649_10529004 3300025920 Bacteria 900
146 Ga0207652_11479759 3300025921 Unclassified 583
147 Ga0207650_10295190 3300025925 Unclassified 1322
148 Ga0207650_10375013 3300025925 Bacteria 1174
149 Ga0207650_10473088 3300025925 Bacteria 1045
150 Ga0207650_10568956 3300025925 Unclassified 951
151 Ga0207650_10836094 3300025925 Unclassified 781
152 Ga0207659_10107731 3300025926 Unclassified 2112
153 Ga0207644_10207413 3300025931 Unclassified 1548
154 Ga0207690_11614289 3300025932 Unclassified 542
155 Ga0207709_10605696 3300025935 Bacteria 868
156 Ga0207670_10038667 3300025936 Bacteria 3118
157 Ga0207670_10276412 3300025936 Bacteria 1307
158 Ga0207669_10186454 3300025937 Unclassified 1492
159 Ga0207669_10866000 3300025937 Unclassified 753
160 Ga0207704_10741390 3300025938 Bacteria 816
161 Ga0207691_10084454 3300025940 Unclassified 2850
162 Ga0207691_10237287 3300025940 Unclassified 1577
163 Ga0207689_10074810 3300025942 Bacteria 2783
164 Ga0207689_10140965 3300025942 Bacteria 1986
165 Ga0207661_10284460 3300025944 Bacteria 1479
166 Ga0207679_10425058 3300025945 Bacteria 1173
167 Ga0207679_11084797 3300025945 Unclassified 734
168 Ga0207667_10167079 3300025949 Bacteria 2262
169 Ga0207651_10059447 3300025960 Unclassified 2648
170 Ga0207712_10006382 3300025961 Bacteria 7440
171 Ga0207712_10068339 3300025961 Bacteria 2546
172 Ga0207712_10144367 3300025961 Unclassified 1830
173 Ga0207712_10312343 3300025961 Bacteria 1294
174 Ga0207668_10156460 3300025972 Unclassified 1771
175 Ga0207668_10521353 3300025972 Unclassified 1025
176 Ga0207640_10291103 3300025981 Unclassified 1287
177 Ga0207640_10884162 3300025981 Bacteria 779
178 Ga0207640_10919188 3300025981 Unclassified 765
179 Ga0207658_10228503 3300025986 Unclassified 1569
180 Ga0207703_10114945 3300026035 Bacteria 2302
181 Ga0207703_10185130 3300026035 Unclassified 1840
182 Ga0207703_10197418 3300026035 Unclassified 1786
183 Ga0207639_10861162 3300026041 Unclassified 846
184 Ga0207641_10205849 3300026088 Bacteria 1817
185 Ga0207641_11641439 3300026088 Unclassified 645
186 Ga0207641_12150864 3300026088 Unclassified 558
187 Ga0207648_10050009 3300026089 Unclassified 3656
188 Ga0207648_10780686 3300026089 Unclassified 888
189 Ga0207676_10609494 3300026095 Unclassified 1049
190 Ga0207676_10735314 3300026095 Unclassified 958
191 Ga0207676_11334322 3300026095 Bacteria 712
192 Ga0207676_11989230 3300026095 Unclassified 580
193 Ga0207676_12542865 3300026095 Unclassified 508
194 Ga0207674_10436802 3300026116 Unclassified 1265
195 Ga0207675_100059321 3300026118 Unclassified 3570
196 Ga0207675_100131723 3300026118 Bacteria 2371
197 Ga0207675_100588901 3300026118 Bacteria 1114
198 Ga0207698_10435348 3300026142 Bacteria 1262
199 Ga0207698_11172701 3300026142 Unclassified 782
200 Ga0210002_1008674 3300027617 Unclassified 1549
201 Ga0268265_10006208 3300028380 Bacteria 8097
202 Ga0268265_10085484 3300028380 Bacteria 2504
203 Ga0268265_10535620 3300028380 Bacteria 1109
204 Ga0268264_10216056 3300028381 Bacteria 1763
205 Ga0268264_10634070 3300028381 Bacteria 1056
206 Ga0316182_1336108 3300030745 Bacteria 889
207 Ga0307408_100055857 3300031548 Bacteria 2861
208 Ga0307408_101760234 3300031548 Unclassified 591
209 Ga0307405_10385000 3300031731 Bacteria 1093
210 Ga0307413_10021750 3300031824 Unclassified 3441
211 Ga0307413_10024489 3300031824 Bacteria 3291
212 Ga0307410_10012408 3300031852 Bacteria 4927
213 Ga0307410_10013899 3300031852 Bacteria 4715
214 Ga0307410_10031258 3300031852 Unclassified 3414
215 Ga0307410_10109209 3300031852 Bacteria 1999
216 Ga0307410_10190749 3300031852 Bacteria 1558
217 Ga0307410_10319162 3300031852 Bacteria 1232
218 Ga0307406_10017626 3300031901 Bacteria 4161
219 Ga0307406_10036385 3300031901 Bacteria 3033
220 Ga0307406_10124839 3300031901 Bacteria 1796
221 Ga0307406_10307245 3300031901 Bacteria 1221
222 Ga0307406_10880689 3300031901 Bacteria 761
223 Ga0307407_10031633 3300031903 Bacteria 2868
224 Ga0307407_10039590 3300031903 Bacteria 2622
225 Ga0307407_10153574 3300031903 Bacteria 1499
226 Ga0307407_10206394 3300031903 Unclassified 1320
227 Ga0307407_10920013 3300031903 Bacteria 672
228 Ga0307412_10043090 3300031911 Unclassified 2937
229 Ga0307412_10056926 3300031911 Bacteria 2608
230 Ga0307412_11650838 3300031911 Bacteria 586
231 Ga0307409_100073127 3300031995 Bacteria 2733
232 Ga0307409_100093998 3300031995 Bacteria 2465
233 Ga0307409_100131516 3300031995 Bacteria 2139
234 Ga0307409_100310268 3300031995 Bacteria 1472
235 Ga0307409_100775446 3300031995 Unclassified 964
236 Ga0307409_102375277 3300031995 Unclassified 559
237 Ga0307409_102396755 3300031995 Unclassified 557
238 Ga0307409_102516193 3300031995 Unclassified 543
239 Ga0307416_100038094 3300032002 Bacteria 3706
240 Ga0307416_100435900 3300032002 Unclassified 1359
241 Ga0307414_10149654 3300032004 Bacteria 1840
242 Ga0307414_10512682 3300032004 Bacteria 1063
243 Ga0307414_10591503 3300032004 Unclassified 994
244 Ga0307414_10875392 3300032004 Unclassified 822
245 Ga0307411_10052952 3300032005 Bacteria 2656
246 Ga0307411_10094451 3300032005 Bacteria 2096
247 Ga0307411_10362370 3300032005 Bacteria 1186
248 Ga0307411_10598414 3300032005 Bacteria 948
249 Ga0307415_100093076 3300032126 Bacteria 2188
250 Ga0307415_100212375 3300032126 Bacteria 1545
251 Ga0307415_100553175 3300032126 Bacteria 1016
252 Ga0395901_1471051 3300038443 Bacteria 638
253 Ga0439453_0124878 3300041408 Bacteria 593
254 Ga0439465_0214775 3300041413 Unclassified 704
255 Ga0451849_1159835 3300041505 Bacteria 827
256 Ga0451843_0443930 3300041509 Unclassified 578
257 Ga0496109_1244444 3300048912 Unclassified 681
258 Ga0501292_023067 3300049515 Unclassified 1016
259 Ga0501296_057564 3300049519 Unclassified 582
260 Ga0501202_156358 3300049652 Unclassified 600
261 Ga0501217_237535 3300049661 Unclassified 582
262 Ga0501235_166487 3300049669 Unclassified 580
263 Ga0501247_008042 3300049677 Bacteria 1224
264 Ga0501249_069673 3300049679 Unclassified 821
265 Ga0501252_033334 3300049682 Unclassified 722
266 Ga0501257_115411 3300049686 Unclassified 715
267 Ga0501258_059366 3300049687 Unclassified 550
268 Ga0501221_257633 3300049704 Unclassified 503
269 Ga0501225_0097012 3300049705 Bacteria 858
270 nmdc:mga08y16_692327_c1 3300050511 Unclassified 1020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_11297181 Ga0105246_112971812 97
2 3300014325 Ga0163163_10076415 Ga0163163_100764153 97
3 3300013308 Ga0157375_11776058 Ga0157375_117760582 101
4 3300031548 Ga0307408_100055857 Ga0307408_1000558571 105
5 3300031824 Ga0307413_10024489 Ga0307413_100244893 105
6 3300031852 Ga0307410_10013899 Ga0307410_100138991 105
7 3300031901 Ga0307406_10036385 Ga0307406_100363851 105
8 3300031903 Ga0307407_10031633 Ga0307407_100316333 105
9 3300031911 Ga0307412_10043090 Ga0307412_100430903 105
10 3300031995 Ga0307409_100073127 Ga0307409_1000731273 105
11 3300032002 Ga0307416_100038094 Ga0307416_1000380943 105
12 3300032005 Ga0307411_10052952 Ga0307411_100529523 105
13 3300005290 Ga0065712_10079344 Ga0065712_100793444 106
14 3300005293 Ga0065715_10001820 Ga0065715_100018204 106
15 3300005328 Ga0070676_10077680 Ga0070676_100776802 106
16 3300005328 Ga0070676_10344283 Ga0070676_103442832 106
17 3300005331 Ga0070670_100024073 Ga0070670_1000240737 106
18 3300005331 Ga0070670_100416781 Ga0070670_1004167813 106
19 3300005340 Ga0070689_100076603 Ga0070689_1000766033 106
20 3300005347 Ga0070668_100096223 Ga0070668_1000962234 106
21 3300005354 Ga0070675_100071477 Ga0070675_1000714774 106
22 3300005355 Ga0070671_100044647 Ga0070671_1000446475 106
23 3300005356 Ga0070674_100010490 Ga0070674_1000104908 106
24 3300005364 Ga0070673_100095317 Ga0070673_1000953173 106
25 3300005456 Ga0070678_101657222 Ga0070678_1016572221 106
26 3300005457 Ga0070662_100161449 Ga0070662_1001614493 106
27 3300005466 Ga0070685_10630942 Ga0070685_106309421 106
28 3300005530 Ga0070679_101899217 Ga0070679_1018992171 106
29 3300005543 Ga0070672_100062691 Ga0070672_1000626913 106
30 3300005548 Ga0070665_102028384 Ga0070665_1020283841 106
31 3300005563 Ga0068855_100117965 Ga0068855_1001179653 106
32 3300005578 Ga0068854_100343656 Ga0068854_1003436562 106
33 3300005616 Ga0068852_100188873 Ga0068852_1001888732 106
34 3300005718 Ga0068866_10011985 Ga0068866_100119856 106
35 3300005719 Ga0068861_100146691 Ga0068861_1001466913 106
36 3300009093 Ga0105240_10388201 Ga0105240_103882012 106
37 3300009098 Ga0105245_10184336 Ga0105245_101843362 106
38 3300009177 Ga0105248_10698398 Ga0105248_106983982 106
39 3300013105 Ga0157369_10234566 Ga0157369_102345663 106
40 3300013296 Ga0157374_10208255 Ga0157374_102082553 106
41 3300013296 Ga0157374_11558207 Ga0157374_115582071 106
42 3300013297 Ga0157378_10423038 Ga0157378_104230383 106
43 3300013297 Ga0157378_11504887 Ga0157378_115048871 106
44 3300013306 Ga0163162_10048441 Ga0163162_100484417 106
45 3300013306 Ga0163162_10050793 Ga0163162_100507936 106
46 3300013307 Ga0157372_10605051 Ga0157372_106050512 106
47 3300013308 Ga0157375_10189167 Ga0157375_101891672 106
48 3300013308 Ga0157375_10940013 Ga0157375_109400132 106
49 3300014325 Ga0163163_10381003 Ga0163163_103810032 106
50 3300014325 Ga0163163_11566759 Ga0163163_115667592 106
51 3300014326 Ga0157380_10077795 Ga0157380_100777953 106
52 3300014326 Ga0157380_11298131 Ga0157380_112981312 106
53 3300017792 Ga0163161_10012961 Ga0163161_100129616 106
54 3300025315 Ga0207697_10209098 Ga0207697_102090982 106
55 3300025907 Ga0207645_10093119 Ga0207645_100931192 106
56 3300025913 Ga0207695_10530337 Ga0207695_105303372 106
57 3300025921 Ga0207652_11479759 Ga0207652_114797591 106
58 3300025925 Ga0207650_10375013 Ga0207650_103750132 106
59 3300025926 Ga0207659_10107731 Ga0207659_101077313 106
60 3300025936 Ga0207670_10038667 Ga0207670_100386673 106
61 3300025937 Ga0207669_10186454 Ga0207669_101864543 106
62 3300025937 Ga0207669_10866000 Ga0207669_108660002 106
63 3300025938 Ga0207704_10741390 Ga0207704_107413902 106
64 3300025940 Ga0207691_10237287 Ga0207691_102372872 106
65 3300025949 Ga0207667_10167079 Ga0207667_101670792 106
66 3300025960 Ga0207651_10059447 Ga0207651_100594473 106
67 3300025972 Ga0207668_10521353 Ga0207668_105213533 106
68 3300025981 Ga0207640_10884162 Ga0207640_108841622 106
69 3300026118 Ga0207675_100059321 Ga0207675_1000593213 106
70 3300027617 Ga0210002_1008674 Ga0210002_10086742 106
71 3300030745 Ga0316182_1336108 Ga0316182_13361082 106
72 3300031824 Ga0307413_10021750 Ga0307413_100217506 106
73 3300031852 Ga0307410_10031258 Ga0307410_100312581 106
74 3300031901 Ga0307406_10017626 Ga0307406_100176263 106
75 3300031901 Ga0307406_10124839 Ga0307406_101248392 106
76 3300031903 Ga0307407_10039590 Ga0307407_100395903 106
77 3300031911 Ga0307412_10056926 Ga0307412_100569264 106
78 3300031995 Ga0307409_100093998 Ga0307409_1000939984 106
79 3300031995 Ga0307409_102375277 Ga0307409_1023752771 106
80 3300031995 Ga0307409_102396755 Ga0307409_1023967552 106
81 3300032004 Ga0307414_10875392 Ga0307414_108753922 106
82 3300032005 Ga0307411_10094451 Ga0307411_100944513 106
83 3300032126 Ga0307415_100212375 Ga0307415_1002123753 106
84 3300041413 Ga0439465_0214775 Ga0439465_0214775_301_621 106
85 3300041505 Ga0451849_1159835 Ga0451849_1159835_403_735 106
86 3300048912 Ga0496109_1244444 Ga0496109_1244444_290_634 106
87 3300049519 Ga0501296_057564 Ga0501296_057564_209_529 106
88 3300049652 Ga0501202_156358 Ga0501202_156358_183_524 106
89 3300049661 Ga0501217_237535 Ga0501217_237535_75_395 106
90 3300049669 Ga0501235_166487 Ga0501235_166487_45_386 106
91 3300049677 Ga0501247_008042 Ga0501247_008042_280_600 106
92 3300049679 Ga0501249_069673 Ga0501249_069673_139_459 106
93 3300049682 Ga0501252_033334 Ga0501252_033334_188_529 106
94 3300049687 Ga0501258_059366 Ga0501258_059366_193_513 106
95 3300049704 Ga0501221_257633 Ga0501221_257633_126_446 106
96 3300049705 Ga0501225_0097012 Ga0501225_0097012_87_407 106
97 3300005293 Ga0065715_10298134 Ga0065715_102981341 107
98 3300005331 Ga0070670_100155767 Ga0070670_1001557673 107
99 3300005331 Ga0070670_100481704 Ga0070670_1004817042 107
100 3300005340 Ga0070689_100260949 Ga0070689_1002609492 107
101 3300005365 Ga0070688_100253922 Ga0070688_1002539222 107
102 3300005577 Ga0068857_100427101 Ga0068857_1004271012 107
103 3300005577 Ga0068857_101757169 Ga0068857_1017571691 107
104 3300005617 Ga0068859_101335041 Ga0068859_1013350411 107
105 3300005618 Ga0068864_100052640 Ga0068864_1000526404 107
106 3300005840 Ga0068870_10203409 Ga0068870_102034093 107
107 3300005841 Ga0068863_100007427 Ga0068863_1000074278 107
108 3300005842 Ga0068858_100255881 Ga0068858_1002558812 107
109 3300006931 Ga0097620_101335049 Ga0097620_1013350492 107
110 3300009553 Ga0105249_10031913 Ga0105249_100319137 107
111 3300009553 Ga0105249_10210185 Ga0105249_102101853 107
112 3300013306 Ga0163162_11076926 Ga0163162_110769261 107
113 3300014325 Ga0163163_11805294 Ga0163163_118052942 107
114 3300014326 Ga0157380_11886608 Ga0157380_118866082 107
115 3300014969 Ga0157376_12358531 Ga0157376_123585311 107
116 3300025908 Ga0207643_10331666 Ga0207643_103316662 107
117 3300025925 Ga0207650_10473088 Ga0207650_104730882 107
118 3300025925 Ga0207650_10568956 Ga0207650_105689562 107
119 3300025935 Ga0207709_10605696 Ga0207709_106056961 107
120 3300025936 Ga0207670_10276412 Ga0207670_102764122 107
121 3300025942 Ga0207689_10074810 Ga0207689_100748104 107
122 3300026035 Ga0207703_10114945 Ga0207703_101149453 107
123 3300026088 Ga0207641_10205849 Ga0207641_102058492 107
124 3300026088 Ga0207641_11641439 Ga0207641_116414391 107
125 3300026095 Ga0207676_10735314 Ga0207676_107353142 107
126 3300026116 Ga0207674_10436802 Ga0207674_104368022 107
127 3300026118 Ga0207675_100588901 Ga0207675_1005889011 107
128 3300028380 Ga0268265_10085484 Ga0268265_100854842 107
129 3300031852 Ga0307410_10012408 Ga0307410_100124085 107
130 3300031852 Ga0307410_10190749 Ga0307410_101907493 107
131 3300031852 Ga0307410_10319162 Ga0307410_103191623 107
132 3300031901 Ga0307406_10307245 Ga0307406_103072452 107
133 3300031901 Ga0307406_10880689 Ga0307406_108806892 107
134 3300031903 Ga0307407_10153574 Ga0307407_101535743 107
135 3300031903 Ga0307407_10920013 Ga0307407_109200132 107
136 3300031911 Ga0307412_11650838 Ga0307412_116508382 107
137 3300031995 Ga0307409_100131516 Ga0307409_1001315163 107
138 3300031995 Ga0307409_100775446 Ga0307409_1007754462 107
139 3300031995 Ga0307409_102516193 Ga0307409_1025161931 107
140 3300032002 Ga0307416_100435900 Ga0307416_1004359003 107
141 3300032004 Ga0307414_10149654 Ga0307414_101496543 107
142 3300032004 Ga0307414_10591503 Ga0307414_105915032 107
143 3300032005 Ga0307411_10362370 Ga0307411_103623703 107
144 3300041408 Ga0439453_0124878 Ga0439453_0124878_18_359 107
145 3300049515 Ga0501292_023067 Ga0501292_023067_538_861 107
146 3300005356 Ga0070674_100512689 Ga0070674_1005126892 108
147 3300005366 Ga0070659_101047836 Ga0070659_1010478362 108
148 3300005455 Ga0070663_102160049 Ga0070663_1021600491 108
149 3300005564 Ga0070664_100453424 Ga0070664_1004534242 108
150 3300005578 Ga0068854_100363800 Ga0068854_1003638002 108
151 3300005617 Ga0068859_100187902 Ga0068859_1001879023 108
152 3300005842 Ga0068858_100235231 Ga0068858_1002352312 108
153 3300005843 Ga0068860_100393246 Ga0068860_1003932463 108
154 3300005844 Ga0068862_100392274 Ga0068862_1003922742 108
155 3300005844 Ga0068862_101238137 Ga0068862_1012381372 108
156 3300006931 Ga0097620_100187903 Ga0097620_1001879033 108
157 3300009094 Ga0111539_10234492 Ga0111539_102344924 108
158 3300009545 Ga0105237_10984391 Ga0105237_109843912 108
159 3300013308 Ga0157375_11069390 Ga0157375_110693902 108
160 3300025925 Ga0207650_10295190 Ga0207650_102951901 108
161 3300025932 Ga0207690_11614289 Ga0207690_116142892 108
162 3300025945 Ga0207679_11084797 Ga0207679_110847972 108
163 3300025981 Ga0207640_10919188 Ga0207640_109191882 108
164 3300026035 Ga0207703_10197418 Ga0207703_101974182 108
165 3300041509 Ga0451843_0443930 Ga0451843_0443930_108_434 108
166 3300050511 nmdc:mga08y16_692327_c1 nmdc:mga08y16_692327_c1_552_878 108
167 3300005458 Ga0070681_10457999 Ga0070681_104579992 109
168 3300005459 Ga0068867_100612405 Ga0068867_1006124051 109
169 3300005545 Ga0070695_100923001 Ga0070695_1009230012 109
170 3300005564 Ga0070664_101489662 Ga0070664_1014896622 109
171 3300005840 Ga0068870_10309374 Ga0068870_103093742 109
172 3300009147 Ga0114129_11561158 Ga0114129_115611582 109
173 3300009553 Ga0105249_10082302 Ga0105249_100823024 109
174 3300025961 Ga0207712_10312343 Ga0207712_103123431 109
175 3300026089 Ga0207648_10780686 Ga0207648_107806862 109
176 3300026118 Ga0207675_100131723 Ga0207675_1001317232 109
177 3300031731 Ga0307405_10385000 Ga0307405_103850002 109
178 3300031852 Ga0307410_10109209 Ga0307410_101092092 109
179 3300031903 Ga0307407_10206394 Ga0307407_102063941 109
180 3300031995 Ga0307409_100310268 Ga0307409_1003102682 109
181 3300032004 Ga0307414_10512682 Ga0307414_105126822 109
182 3300032126 Ga0307415_100093076 Ga0307415_1000930762 109
183 3300038443 Ga0395901_1471051 Ga0395901_1471051_35_379 109
184 3300049686 Ga0501257_115411 Ga0501257_115411_339_674 109
185 2162886012 MBSR1b_contig_4873538 MBSR1b_0118.00001210 110
186 3300005293 Ga0065715_10652423 Ga0065715_106524232 110
187 3300005330 Ga0070690_100788804 Ga0070690_1007888042 110
188 3300005334 Ga0068869_100109473 Ga0068869_1001094732 110
189 3300005347 Ga0070668_100117699 Ga0070668_1001176993 110
190 3300005354 Ga0070675_100855695 Ga0070675_1008556952 110
191 3300005355 Ga0070671_100239389 Ga0070671_1002393892 110
192 3300005367 Ga0070667_100188825 Ga0070667_1001888252 110
193 3300005459 Ga0068867_101602134 Ga0068867_1016021341 110
194 3300005468 Ga0070707_100529515 Ga0070707_1005295152 110
195 3300005564 Ga0070664_100118826 Ga0070664_1001188262 110
196 3300005564 Ga0070664_101976684 Ga0070664_1019766842 110
197 3300005617 Ga0068859_100027855 Ga0068859_1000278553 110
198 3300005617 Ga0068859_100053328 Ga0068859_1000533285 110
199 3300005617 Ga0068859_100672958 Ga0068859_1006729582 110
200 3300005618 Ga0068864_100518800 Ga0068864_1005188002 110
201 3300005618 Ga0068864_101065576 Ga0068864_1010655762 110
202 3300005719 Ga0068861_100578804 Ga0068861_1005788042 110
203 3300005834 Ga0068851_10104720 Ga0068851_101047203 110
204 3300005841 Ga0068863_100111168 Ga0068863_1001111684 110
205 3300005842 Ga0068858_100214369 Ga0068858_1002143693 110
206 3300005843 Ga0068860_100269157 Ga0068860_1002691573 110
207 3300005843 Ga0068860_100278024 Ga0068860_1002780243 110
208 3300005844 Ga0068862_100084678 Ga0068862_1000846782 110
209 3300006237 Ga0097621_100647277 Ga0097621_1006472772 110
210 3300006358 Ga0068871_101948929 Ga0068871_1019489292 110
211 3300006881 Ga0068865_100567436 Ga0068865_1005674362 110
212 3300006931 Ga0097620_100027859 Ga0097620_1000278593 110
213 3300006931 Ga0097620_100053329 Ga0097620_1000533293 110
214 3300006931 Ga0097620_100672991 Ga0097620_1006729912 110
215 3300009092 Ga0105250_10226894 Ga0105250_102268942 110
216 3300009101 Ga0105247_10157281 Ga0105247_101572812 110
217 3300009174 Ga0105241_10012487 Ga0105241_100124879 110
218 3300009176 Ga0105242_11359399 Ga0105242_113593992 110
219 3300009176 Ga0105242_12110981 Ga0105242_121109811 110
220 3300009177 Ga0105248_10162939 Ga0105248_101629394 110
221 3300009177 Ga0105248_12361444 Ga0105248_123614441 110
222 3300009553 Ga0105249_10039632 Ga0105249_100396327 110
223 3300009553 Ga0105249_12045378 Ga0105249_120453782 110
224 3300009553 Ga0105249_12648281 Ga0105249_126482812 110
225 3300010375 Ga0105239_11505192 Ga0105239_115051922 110
226 3300011119 Ga0105246_11672965 Ga0105246_116729652 110
227 3300013306 Ga0163162_10066404 Ga0163162_100664043 110
228 3300013306 Ga0163162_10259941 Ga0163162_102599413 110
229 3300013306 Ga0163162_10652132 Ga0163162_106521323 110
230 3300013308 Ga0157375_10123785 Ga0157375_101237853 110
231 3300013308 Ga0157375_10247582 Ga0157375_102475821 110
232 3300013308 Ga0157375_10507637 Ga0157375_105076373 110
233 3300013308 Ga0157375_11998150 Ga0157375_119981501 110
234 3300014325 Ga0163163_10192854 Ga0163163_101928543 110
235 3300014325 Ga0163163_10478978 Ga0163163_104789782 110
236 3300025321 Ga0207656_10377495 Ga0207656_103774952 110
237 3300025900 Ga0207710_10068720 Ga0207710_100687202 110
238 3300025900 Ga0207710_10100171 Ga0207710_101001711 110
239 3300025904 Ga0207647_10270503 Ga0207647_102705031 110
240 3300025911 Ga0207654_10120855 Ga0207654_101208553 110
241 3300025920 Ga0207649_10529004 Ga0207649_105290042 110
242 3300025925 Ga0207650_10836094 Ga0207650_108360942 110
243 3300025931 Ga0207644_10207413 Ga0207644_102074132 110
244 3300025940 Ga0207691_10084454 Ga0207691_100844545 110
245 3300025942 Ga0207689_10140965 Ga0207689_101409653 110
246 3300025944 Ga0207661_10284460 Ga0207661_102844602 110
247 3300025945 Ga0207679_10425058 Ga0207679_104250583 110
248 3300025961 Ga0207712_10006382 Ga0207712_100063822 110
249 3300025961 Ga0207712_10068339 Ga0207712_100683393 110
250 3300025961 Ga0207712_10144367 Ga0207712_101443672 110
251 3300025972 Ga0207668_10156460 Ga0207668_101564602 110
252 3300025981 Ga0207640_10291103 Ga0207640_102911032 110
253 3300025986 Ga0207658_10228503 Ga0207658_102285032 110
254 3300026035 Ga0207703_10185130 Ga0207703_101851303 110
255 3300026041 Ga0207639_10861162 Ga0207639_108611622 110
256 3300026088 Ga0207641_12150864 Ga0207641_121508641 110
257 3300026089 Ga0207648_10050009 Ga0207648_100500093 110
258 3300026095 Ga0207676_10609494 Ga0207676_106094941 110
259 3300026095 Ga0207676_11334322 Ga0207676_113343222 110
260 3300026095 Ga0207676_11989230 Ga0207676_119892302 110
261 3300026095 Ga0207676_12542865 Ga0207676_125428651 110
262 3300026142 Ga0207698_10435348 Ga0207698_104353481 110
263 3300026142 Ga0207698_11172701 Ga0207698_111727012 110
264 3300028380 Ga0268265_10006208 Ga0268265_100062081 110
265 3300028380 Ga0268265_10535620 Ga0268265_105356202 110
266 3300028381 Ga0268264_10216056 Ga0268264_102160563 110
267 3300028381 Ga0268264_10634070 Ga0268264_106340701 110
268 3300031548 Ga0307408_101760234 Ga0307408_1017602342 110
269 3300032005 Ga0307411_10598414 Ga0307411_105984142 110
270 3300032126 Ga0307415_100553175 Ga0307415_1005531752 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

2

89

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e8e-assembly1.cif.gz_C cryoem structure of human kv4.2-dpp6s-kchip1 complex, transmembrane and intracellular region 0.2247 3 109
7e8e-assembly1.cif.gz_C cryoem structure of human kv4.2-dpp6s-kchip1 complex, transmembrane and intracellular region 0.2162 3 109
ID Description Score Start End Superfamily
3ihuA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like 0.3175 2 107 1.20.120.530
3ihuA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like 0.2968 2 107 1.20.120.530
af_A1ZBM8_285_438_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.2827 6 105 1.10.287.70
af_A0A143ZXB9_1_167_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2801 20 103 1.20.140.150
af_Q6P2T9_1_103_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.2751 1 97 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A7V9UTT3-F1-model_v4 DUF962 domain-containing protein 0.9493 1 107 GO:0016020
AF-A0A7Y2GW17-F1-model_v4 DUF962 domain-containing protein 0.9449 1 106 GO:0016020
AF-A0A7W1D8J6-F1-model_v4 DUF962 domain-containing protein 0.9427 1 109 GO:0016020
AF-A0A521TV82-F1-model_v4 DUF962 domain-containing protein 0.9427 2 106
AF-A0A7W1R9K0-F1-model_v4 DUF962 domain-containing protein 0.9388 1 109 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.6 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map