F376945

General Info

Members Datasets Scaffolds Average Seq Length
270 186 255 317

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10015875|Ga0157378_100158754
Length 367
Sequence MPFRLHHLHENSDSAPETLAQGRDAAQCCSTPVIARRMSAPNTPPFAGLSPDIIIKAVESLGIVCDGRVLALNSYENRVYRLGREDAAPLVVKFYRPNRWSDAAILEDHAFGAELRAAELSVVAPLDIAGRTLHHSEGFRFSLFPMQGGRAPEPGDKETLIHIGRALGRMHSVGAAGVFRHRPVLSVRAYAEEPVDYLLEAGWLPPELEENFLELGELSIHAIERAFALAGQLQTLRLHGDCHPGNLLWRDDTVHFVDLDDTLTGPAMQDLWMLLSGDRPARAQQLGWLLEGYEIFRPFDRAELHLIEALRAMRLLHYHAWIARRWHDPAFPAAFPWFESPRHWEAVITQLQEQLATMAEPVLDLLR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
7 2734482264 Dyella sp. AD052 Isolate Unclassified
8 2738543009 Luteibacter sp. OK325 Isolate Unclassified
9 2739367700 Dyella sp. YR388 Isolate Unclassified
10 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
11 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
12 2884411467 Dyella sp. AD56 Isolate Rhizosphere
13 2919085039 Luteibacter sp. 1214 Isolate Unclassified
14 2919404418 Luteibacter sp. 3190 Isolate Unclassified
15 2928963466 Dyella japonica 1073 Isolate Unclassified
16 2941471342 Luteibacter sp. 621 Isolate Unclassified
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
71 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
185 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
186 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 0.74
Isolates 5.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.56
Nodule 0
Rhizoplane 3.7
Rhizosphere 65.19
Stem 0
Stem Tuber 0
Unclassified 15.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2001396 2162886007 Bacteria 1638
2 JGI25162J39368_1000147 3300002737 Bacteria 76626
3 JGI25162J39368_1002571 3300002737 Bacteria 6873
4 JGI25154J39366_1006186 3300002738 Bacteria 1788
5 JGI25157J39369_1000093 3300002741 Bacteria 76626
6 JGI25157J39369_1000818 3300002741 Bacteria 15526
7 JGI25163J39215_1000328 3300002771 Bacteria 15770
8 JGI25163J39215_1000500 3300002771 Bacteria 11663
9 JGI25164J39214_1000118 3300002772 Bacteria 76626
10 JGI25165J46597_1000236 3300003214 Bacteria 76626
11 rootH1_10008997 3300003316 Bacteria 3253
12 Ga0055538_1001354 3300003751 Bacteria 4845
13 Ga0055535_1000138 3300003761 Bacteria 76626
14 Ga0055542_1000186 3300003762 Bacteria 76626
15 Ga0055542_1000247 3300003762 Bacteria 62095
16 Ga0055529_1000226 3300003763 Bacteria 71685
17 Ga0055529_1000396 3300003763 Bacteria 46326
18 Ga0070680_100041772 3300005336 Bacteria 3719
19 Ga0070689_100006866 3300005340 Bacteria 7917
20 Ga0070661_100029118 3300005344 Bacteria 3985
21 Ga0070661_100045305 3300005344 Bacteria 3215
22 Ga0070675_100036448 3300005354 Bacteria 4002
23 Ga0070675_100212832 3300005354 Bacteria 1681
24 Ga0070673_100208902 3300005364 Bacteria 1685
25 Ga0070667_100089719 3300005367 Bacteria 2641
26 Ga0070713_100000090 3300005436 Bacteria 57703
27 Ga0070711_100077816 3300005439 Bacteria 2355
28 Ga0070663_100042756 3300005455 Bacteria 3185
29 Ga0070681_10000008 3300005458 Bacteria 151355
30 Ga0070685_10044917 3300005466 Bacteria 2531
31 Ga0068853_100048342 3300005539 Bacteria 3654
32 Ga0068853_100059625 3300005539 Bacteria 3297
33 Ga0070696_100007799 3300005546 Bacteria 7145
34 Ga0070696_100244229 3300005546 Bacteria 1355
35 Ga0068855_100018763 3300005563 Bacteria 8316
36 Ga0068855_100173957 3300005563 Bacteria 2437
37 Ga0068857_100285692 3300005577 Bacteria 1518
38 Ga0068854_100048632 3300005578 Bacteria 3026
39 Ga0068856_100000676 3300005614 Bacteria 36917
40 Ga0068860_100064818 3300005843 Bacteria 3469
41 Ga0068862_100031871 3300005844 Bacteria 4453
42 Ga0075369_10019528 3300006186 Bacteria 2768
43 Ga0099794_10004440 3300007265 Bacteria 5515
44 Ga0099795_10007094 3300007788 Bacteria 3103
45 Ga0105240_10111342 3300009093 Bacteria 3312
46 Ga0105247_10001155 3300009101 Bacteria 19591
47 Ga0105237_10000036 3300009545 Bacteria 191142
48 Ga0105238_10145909 3300009551 Bacteria 2343
49 Ga0099796_10000269 3300010159 Bacteria 8239
50 Ga0105239_10075496 3300010375 Bacteria 3706
51 Ga0157373_10188224 3300013100 Bacteria 1454
52 Ga0157370_10018468 3300013104 Bacteria 7011
53 Ga0157369_10016495 3300013105 Bacteria 8308
54 Ga0157378_10015875 3300013297 Bacteria 6594
55 Ga0163162_10202123 3300013306 Bacteria 2116
56 Ga0157372_10072242 3300013307 Bacteria 3888
57 Ga0182008_10077107 3300014497 Bacteria 1640
58 Ga0182008_10161955 3300014497 Bacteria 1126
59 Ga0157376_10013121 3300014969 Bacteria 6172
60 Ga0182006_1000185 3300015261 Bacteria 64803
61 Ga0182006_1016880 3300015261 Bacteria 3110
62 Ga0182007_10005469 3300015262 Bacteria 5576
63 Ga0182007_10010065 3300015262 Bacteria 3762
64 Ga0182005_1001773 3300015265 Bacteria 8305
65 Ga0182005_1025505 3300015265 Bacteria 1613
66 Ga0163161_10000436 3300017792 Bacteria 34952
67 Ga0163161_10165471 3300017792 Bacteria 1688
68 Ga0206356_10082985 3300020070 Bacteria 2959
69 Ga0206353_11142836 3300020082 Bacteria 4823
70 Ga0209435_106992 3300025206 Bacteria 1251
71 Ga0209760_100571 3300025207 Bacteria 6595
72 Ga0209784_100094 3300025224 Bacteria 113434
73 Ga0209566_102797 3300025225 Bacteria 2992
74 Ga0209674_101763 3300025226 Bacteria 5253
75 Ga0209672_100407 3300025228 Bacteria 25502
76 Ga0209147_104140 3300025229 Bacteria 2508
77 Ga0207427_100100 3300025231 Bacteria 121264
78 Ga0207427_103267 3300025231 Bacteria 3528
79 Ga0209437_100059 3300025233 Bacteria 355048
80 Ga0209437_100382 3300025233 Bacteria 43727
81 Ga0209437_101296 3300025233 Bacteria 6708
82 Ga0209258_100034 3300025242 Bacteria 437372
83 Ga0209258_100738 3300025242 Bacteria 21171
84 Ga0209258_102718 3300025242 Bacteria 4300
85 Ga0209646_1002679 3300025246 Bacteria 3818
86 Ga0209026_1000119 3300025250 Bacteria 130220
87 Ga0209026_1000161 3300025250 Bacteria 102959
88 Ga0209026_1000206 3300025250 Bacteria 81686
89 Ga0209026_1004776 3300025250 Bacteria 3882
90 Ga0209148_1000001 3300025254 Bacteria 2545271
91 Ga0209148_1000055 3300025254 Bacteria 367500
92 Ga0209759_1000467 3300025256 Bacteria 45696
93 Ga0209759_1001926 3300025256 Bacteria 10141
94 Ga0209759_1009613 3300025256 Bacteria 2908
95 Ga0209129_1000455 3300025258 Bacteria 30337
96 Ga0209233_1000002 3300025261 Bacteria 2501366
97 Ga0209233_1020339 3300025261 Bacteria 1743
98 Ga0209233_1023614 3300025261 Bacteria 1555
99 Ga0209455_1000054 3300025272 Bacteria 358936
100 Ga0209455_1000318 3300025272 Bacteria 47836
101 Ga0209758_1023720 3300025297 Bacteria 2763
102 Ga0209256_1011333 3300025299 Bacteria 3579
103 Ga0207710_10008240 3300025900 Bacteria 4400
104 Ga0207647_10000013 3300025904 Bacteria 144052
105 Ga0207707_10000442 3300025912 Bacteria 43048
106 Ga0207695_10000938 3300025913 Bacteria 52009
107 Ga0207671_10004404 3300025914 Bacteria 13490
108 Ga0207663_10037328 3300025916 Bacteria 2928
109 Ga0207681_10056628 3300025923 Bacteria 2675
110 Ga0207659_10428379 3300025926 Bacteria 1111
111 Ga0207700_10000065 3300025928 Bacteria 65305
112 Ga0207700_10006574 3300025928 Bacteria 7039
113 Ga0207706_10172424 3300025933 Bacteria 1901
114 Ga0207670_10008701 3300025936 Bacteria 5746
115 Ga0207667_10008815 3300025949 Bacteria 11943
116 Ga0207667_10215497 3300025949 Bacteria 1968
117 Ga0207658_10158380 3300025986 Bacteria 1853
118 Ga0207639_10002808 3300026041 Bacteria 11683
119 Ga0207639_10023333 3300026041 Bacteria 4467
120 Ga0207702_10000661 3300026078 Bacteria 37532
121 Ga0265356_1002071 3300028017 Bacteria 2750
122 Ga0265327_10000348 3300031251 Bacteria 87817
123 Ga0265316_10010846 3300031344 Bacteria 8274
124 Ga0316576_10018262 3300031727 Bacteria 4784
125 Ga0316578_10020597 3300031728 Bacteria 3647
126 Ga0307516_10000530 3300031730 Bacteria 51072
127 Ga0316580_10035870 3300032139 Bacteria 1535
128 Ga0373955_0111694 3300035172 Bacteria 1581
129 Ga0436361_0378193 3300039447 Bacteria 1911
130 Ga0451789_0781782 3300041443 Bacteria 1088
131 Ga0451793_0776588 3300041452 Bacteria 2152
132 Ga0450908_000006 3300042184 Bacteria 56117
133 Ga0439459_0000749 3300042438 Bacteria 4459
134 Ga0451577_0008296 3300042876 Bacteria 10108
135 Ga0451577_0036489 3300042876 Bacteria 4424
136 Ga0466982_0000015 3300044672 Bacteria 131281
137 Ga0466982_0000027 3300044672 Bacteria 62332
138 Ga0453683_0153344 3300044673 Bacteria 1456
139 Ga0453683_0245356 3300044673 Bacteria 1141
140 Ga0453684_0000615 3300044712 Bacteria 130336
141 Ga0453684_0000833 3300044712 Bacteria 104091
142 Ga0453684_0033909 3300044712 Bacteria 7101
143 Ga0453684_0118165 3300044712 Bacteria 3207
144 Ga0453684_0143854 3300044712 Bacteria 2843
145 Ga0466968_0012250 3300044735 Bacteria 3352
146 Ga0466957_0049386 3300044842 Bacteria 2558
147 Ga0451576_0000201 3300045051 Bacteria 150175
148 Ga0451576_0037205 3300045051 Bacteria 5155
149 Ga0495617_000058 3300046452 Bacteria 100393
150 Ga0495638_0000090 3300046460 Bacteria 148040
151 Ga0495638_0000458 3300046460 Bacteria 48869
152 Ga0495638_0000536 3300046460 Bacteria 43871
153 Ga0495638_0000576 3300046460 Bacteria 41440
154 Ga0495638_0006634 3300046460 Bacteria 8405
155 Ga0495650_0000092 3300046471 Bacteria 224681
156 Ga0495650_0005112 3300046471 Bacteria 8668
157 Ga0495650_0010898 3300046471 Bacteria 5033
158 Ga0495584_0008164 3300046491 Bacteria 5437
159 Ga0495585_0000683 3300046492 Bacteria 30903
160 Ga0495585_0000999 3300046492 Bacteria 23656
161 Ga0495607_0000038 3300046501 Bacteria 134124
162 Ga0495607_0000196 3300046501 Bacteria 63991
163 Ga0495607_0010187 3300046501 Bacteria 6324
164 Ga0495606_0000222 3300046507 Bacteria 100766
165 Ga0495606_0000923 3300046507 Bacteria 43313
166 Ga0495606_0001488 3300046507 Bacteria 31138
167 Ga0495606_0004160 3300046507 Bacteria 14665
168 Ga0495606_0067430 3300046507 Bacteria 2265
169 Ga0495610_0074725 3300046512 Bacteria 1571
170 Ga0495616_0000056 3300046513 Bacteria 101901
171 Ga0495616_0015371 3300046513 Bacteria 4256
172 Ga0495620_0000479 3300046515 Bacteria 25982
173 Ga0495620_0001818 3300046515 Bacteria 12549
174 Ga0495631_0000120 3300046518 Bacteria 52656
175 Ga0495631_0000595 3300046518 Bacteria 23959
176 Ga0495632_0075747 3300046519 Bacteria 1610
177 Ga0495632_0140974 3300046519 Bacteria 1118
178 Ga0495637_0010001 3300046520 Bacteria 4608
179 Ga0495648_0001431 3300046524 Bacteria 23362
180 Ga0495648_0001523 3300046524 Bacteria 22661
181 Ga0495609_0007485 3300046538 Bacteria 5445
182 Ga0495622_0012896 3300046557 Bacteria 3876
183 Ga0495668_0001983 3300046616 Bacteria 17927
184 Ga0495668_0074430 3300046616 Bacteria 1865
185 Ga0495611_0000034 3300046648 Bacteria 103287
186 Ga0495611_0000078 3300046648 Bacteria 68937
187 Ga0495625_0000002 3300046660 Bacteria 813323
188 Ga0495625_0046953 3300046660 Bacteria 3114
189 Ga0495625_0132658 3300046660 Bacteria 1686
190 Ga0495661_0001142 3300046665 Bacteria 23194
191 Ga0495661_0225333 3300046665 Bacteria 969
192 Ga0495670_0003624 3300046691 Bacteria 7588
193 Ga0495670_0008323 3300046691 Bacteria 5098
194 Ga0495671_0001575 3300046692 Bacteria 15099
195 Ga0495649_0109463 3300046694 Bacteria 1465
196 Ga0495589_0000192 3300046794 Bacteria 53416
197 Ga0495660_0000156 3300046810 Bacteria 74271
198 Ga0495660_0000273 3300046810 Bacteria 48544
199 Ga0495683_0001655 3300047323 Bacteria 14236
200 Ga0495679_000003 3300047446 Bacteria 787868
201 Ga0495673_0000004 3300047469 Bacteria 1354526
202 Ga0495673_0000127 3300047469 Bacteria 140402
203 Ga0495673_0001542 3300047469 Bacteria 18120
204 Ga0495686_0000024 3300047472 Bacteria 400343
205 Ga0495686_0000375 3300047472 Bacteria 71924
206 Ga0495686_0104863 3300047472 Bacteria 1701
207 Ga0496100_0003924 3300048903 Bacteria 7816
208 Ga0496101_0000359 3300048904 Bacteria 30569
209 Ga0496104_0011953 3300048907 Bacteria 7788
210 Ga0496105_0005024 3300048908 Bacteria 10014
211 Ga0496106_0000807 3300048909 Bacteria 22662
212 Ga0496114_0002014 3300048917 Bacteria 15457
213 Ga0496115_0001580 3300048918 Bacteria 16359
214 Ga0496115_0077462 3300048918 Bacteria 2703
215 Ga0496116_0175442 3300048919 Bacteria 1155
216 Ga0496117_0007810 3300048920 Bacteria 10306
217 Ga0496118_0000714 3300048921 Bacteria 53628
218 Ga0496118_0003985 3300048921 Bacteria 18002
219 Ga0496118_0223701 3300048921 Bacteria 1093
220 Ga0496121_0000829 3300048924 Bacteria 56313
221 Ga0496121_0001307 3300048924 Bacteria 42738
222 Ga0496121_0001580 3300048924 Bacteria 37914
223 Ga0496121_0098983 3300048924 Bacteria 2255
224 Ga0496122_0005001 3300048925 Bacteria 16035
225 Ga0496123_0005702 3300048926 Bacteria 12415
226 Ga0496123_0031147 3300048926 Bacteria 3885
227 Ga0496123_0100356 3300048926 Bacteria 1686
228 Ga0496125_0002397 3300048928 Bacteria 24412
229 Ga0496125_0003619 3300048928 Bacteria 18554
230 Ga0496126_0085834 3300048929 Bacteria 2774
231 Ga0496126_0186768 3300048929 Bacteria 1757
232 Ga0495678_000026 3300049459 Bacteria 226978
233 Ga0495678_022531 3300049459 Bacteria 2752
234 Ga0495682_0009997 3300049460 Bacteria 3690
235 Ga0495682_0010675 3300049460 Bacteria 3548
236 Ga0501031_0076003 3300049568 Bacteria 2187
237 Ga0501033_0078521 3300049570 Bacteria 2422
238 Ga0501034_0007072 3300049571 Bacteria 11967
239 Ga0501036_0271327 3300049572 Bacteria 1420
240 Ga0501037_0007967 3300049573 Bacteria 7765
241 Ga0501043_0013549 3300049579 Bacteria 6380
242 Ga0501046_0018316 3300049580 Bacteria 5829
243 Ga0501070_0015983 3300049586 Bacteria 6308
244 Ga0501080_0087028 3300049742 Bacteria 2903
245 Ga0501035_0004859 3300049822 Bacteria 12747
246 Ga0501035_0038906 3300049822 Bacteria 4306
247 Ga0501035_0054578 3300049822 Bacteria 3570
248 Ga0501044_0025524 3300049823 Bacteria 6264
249 Ga0501044_0027291 3300049823 Bacteria 6036
250 nmdc:mga0sz30_112410_c1 3300050516 Bacteria 1194
251 Ga0495619_0118961 3300053085 Bacteria 1811
252 Ga0500643_000138 3300053087 Bacteria 73474
253 Ga0500555_000108 3300053103 Bacteria 39384
254 Ga0500633_0080410 3300053160 Bacteria 1178
255 Ga0500645_002528 3300053730 Bacteria 8073

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0054578 Ga0501035_0054578_2730_3560 276
2 3300046492 Ga0495585_0000999 Ga0495585_0000999_1809_2753 285
3 3300046518 Ga0495631_0000595 Ga0495631_0000595_20849_21793 285
4 3300046524 Ga0495648_0001431 Ga0495648_0001431_1778_2722 285
5 3300046665 Ga0495661_0001142 Ga0495661_0001142_20479_21423 285
6 3300049460 Ga0495682_0009997 Ga0495682_0009997_1096_2040 285
7 3300053730 Ga0500645_002528 Ga0500645_002528_5380_6324 285
8 3300046665 Ga0495661_0225333 Ga0495661_0225333_68_958 296
9 3300005354 Ga0070675_100036448 Ga0070675_1000364483 302
10 3300005364 Ga0070673_100208902 Ga0070673_1002089022 302
11 3300025933 Ga0207706_10172424 Ga0207706_101724242 302
12 3300005466 Ga0070685_10044917 Ga0070685_100449172 304
13 3300049742 Ga0501080_0087028 Ga0501080_0087028_510_1424 304
14 3300046501 Ga0495607_0010187 Ga0495607_0010187_1324_2268 305
15 3300046460 Ga0495638_0000576 Ga0495638_0000576_35521_36468 307
16 3300046471 Ga0495650_0000092 Ga0495650_0000092_86912_87859 307
17 iso_pu_bacteria 2593339239 2595452809 310
18 iso_pu_bacteria 2718218334 2721025744 310
19 iso_pu_bacteria 2734482264 2735834284 310
20 iso_pu_bacteria 2738543009 2739225703 310
21 iso_pu_bacteria 2884338543 2884339071 310
22 iso_pu_bacteria 2919085039 2919086244 310
23 iso_pu_bacteria 2919404418 2919407842 310
24 iso_pu_bacteria 2941471342 2941473398 310
25 3300005439 Ga0070711_100077816 Ga0070711_1000778163 311
26 3300035172 Ga0373955_0111694 Ga0373955_0111694_581_1522 311
27 3300048907 Ga0496104_0011953 Ga0496104_0011953_3217_4158 311
28 3300048908 Ga0496105_0005024 Ga0496105_0005024_4054_4995 311
29 3300048917 Ga0496114_0002014 Ga0496114_0002014_7527_8468 311
30 3300048918 Ga0496115_0077462 Ga0496115_0077462_1260_2201 311
31 3300053085 Ga0495619_0118961 Ga0495619_0118961_308_1252 311
32 iso_pu_bacteria 2593339238 2595449060 311
33 iso_pu_bacteria 2739367700 2739733741 311
34 iso_pu_bacteria 2884411467 2884411733 311
35 iso_pu_bacteria 2928963466 2928966589 311
36 3300044672 Ga0466982_0000015 Ga0466982_0000015_126635_127576 313
37 3300002737 JGI25162J39368_1000147 JGI25162J39368_100014729 314
38 3300002738 JGI25154J39366_1006186 JGI25154J39366_10061862 314
39 3300002741 JGI25157J39369_1000093 JGI25157J39369_100009336 314
40 3300002771 JGI25163J39215_1000328 JGI25163J39215_10003284 314
41 3300002771 JGI25163J39215_1000500 JGI25163J39215_100050012 314
42 3300002772 JGI25164J39214_1000118 JGI25164J39214_100011829 314
43 3300003214 JGI25165J46597_1000236 JGI25165J46597_100023629 314
44 3300003316 rootH1_10008997 rootH1_100089972 314
45 3300003751 Ga0055538_1001354 Ga0055538_10013542 314
46 3300003761 Ga0055535_1000138 Ga0055535_100013829 314
47 3300003762 Ga0055542_1000186 Ga0055542_100018629 314
48 3300003763 Ga0055529_1000226 Ga0055529_100022636 314
49 3300003763 Ga0055529_1000396 Ga0055529_100039612 314
50 3300005344 Ga0070661_100029118 Ga0070661_1000291183 314
51 3300005563 Ga0068855_100018763 Ga0068855_10001876310 314
52 3300005614 Ga0068856_100000676 Ga0068856_1000006765 314
53 3300006186 Ga0075369_10019528 Ga0075369_100195283 314
54 3300009101 Ga0105247_10001155 Ga0105247_1000115512 314
55 3300010375 Ga0105239_10075496 Ga0105239_100754963 314
56 3300013104 Ga0157370_10018468 Ga0157370_100184685 314
57 3300013105 Ga0157369_10016495 Ga0157369_100164958 314
58 3300013307 Ga0157372_10072242 Ga0157372_100722423 314
59 3300015261 Ga0182006_1000185 Ga0182006_100018528 314
60 3300015262 Ga0182007_10010065 Ga0182007_100100653 314
61 3300015265 Ga0182005_1001773 Ga0182005_10017738 314
62 3300015265 Ga0182005_1025505 Ga0182005_10255052 314
63 3300017792 Ga0163161_10000436 Ga0163161_1000043638 314
64 3300017792 Ga0163161_10165471 Ga0163161_101654712 314
65 3300025206 Ga0209435_106992 Ga0209435_1069922 314
66 3300025207 Ga0209760_100571 Ga0209760_1005715 314
67 3300025224 Ga0209784_100094 Ga0209784_10009428 314
68 3300025229 Ga0209147_104140 Ga0209147_1041401 314
69 3300025231 Ga0207427_100100 Ga0207427_10010028 314
70 3300025233 Ga0209437_100059 Ga0209437_100059228 314
71 3300025242 Ga0209258_100034 Ga0209258_100034115 314
72 3300025242 Ga0209258_100738 Ga0209258_10073816 314
73 3300025246 Ga0209646_1002679 Ga0209646_10026792 314
74 3300025250 Ga0209026_1000161 Ga0209026_100016161 314
75 3300025254 Ga0209148_1000001 Ga0209148_1000001589 314
76 3300025256 Ga0209759_1000467 Ga0209759_100046735 314
77 3300025258 Ga0209129_1000455 Ga0209129_100045527 314
78 3300025261 Ga0209233_1000002 Ga0209233_10000021642 314
79 3300025272 Ga0209455_1000054 Ga0209455_100005484 314
80 3300025297 Ga0209758_1023720 Ga0209758_10237202 314
81 3300025299 Ga0209256_1011333 Ga0209256_10113333 314
82 3300025900 Ga0207710_10008240 Ga0207710_100082402 314
83 3300025904 Ga0207647_10000013 Ga0207647_1000001342 314
84 3300026041 Ga0207639_10023333 Ga0207639_100233333 314
85 3300026078 Ga0207702_10000661 Ga0207702_100006615 314
86 3300042184 Ga0450908_000006 Ga0450908_000006_30630_31574 314
87 3300044735 Ga0466968_0012250 Ga0466968_0012250_965_1909 314
88 3300046452 Ga0495617_000058 Ga0495617_000058_86777_87721 314
89 3300046460 Ga0495638_0000536 Ga0495638_0000536_41134_42078 314
90 3300046460 Ga0495638_0006634 Ga0495638_0006634_2418_3362 314
91 3300046471 Ga0495650_0005112 Ga0495650_0005112_3064_4008 314
92 3300046471 Ga0495650_0010898 Ga0495650_0010898_4035_4979 314
93 3300046491 Ga0495584_0008164 Ga0495584_0008164_448_1392 314
94 3300046492 Ga0495585_0000683 Ga0495585_0000683_12617_13561 314
95 3300046501 Ga0495607_0000038 Ga0495607_0000038_34582_35526 314
96 3300046501 Ga0495607_0000196 Ga0495607_0000196_61226_62170 314
97 3300046507 Ga0495606_0000222 Ga0495606_0000222_68720_69664 314
98 3300046507 Ga0495606_0001488 Ga0495606_0001488_4995_5939 314
99 3300046507 Ga0495606_0004160 Ga0495606_0004160_182_1126 314
100 3300046507 Ga0495606_0067430 Ga0495606_0067430_389_1333 314
101 3300046512 Ga0495610_0074725 Ga0495610_0074725_389_1333 314
102 3300046513 Ga0495616_0000056 Ga0495616_0000056_31403_32347 314
103 3300046513 Ga0495616_0015371 Ga0495616_0015371_1517_2461 314
104 3300046515 Ga0495620_0000479 Ga0495620_0000479_23724_24668 314
105 3300046515 Ga0495620_0001818 Ga0495620_0001818_8415_9359 314
106 3300046518 Ga0495631_0000120 Ga0495631_0000120_23988_24932 314
107 3300046519 Ga0495632_0075747 Ga0495632_0075747_64_1008 314
108 3300046519 Ga0495632_0140974 Ga0495632_0140974_53_997 314
109 3300046520 Ga0495637_0010001 Ga0495637_0010001_3334_4278 314
110 3300046524 Ga0495648_0001523 Ga0495648_0001523_14786_15730 314
111 3300046538 Ga0495609_0007485 Ga0495609_0007485_2669_3613 314
112 3300046616 Ga0495668_0001983 Ga0495668_0001983_14069_15013 314
113 3300046616 Ga0495668_0074430 Ga0495668_0074430_772_1716 314
114 3300046648 Ga0495611_0000034 Ga0495611_0000034_87694_88638 314
115 3300046648 Ga0495611_0000078 Ga0495611_0000078_27745_28689 314
116 3300046660 Ga0495625_0000002 Ga0495625_0000002_797730_798674 314
117 3300046660 Ga0495625_0046953 Ga0495625_0046953_1586_2530 314
118 3300046691 Ga0495670_0003624 Ga0495670_0003624_1594_2538 314
119 3300046691 Ga0495670_0008323 Ga0495670_0008323_2389_3333 314
120 3300046692 Ga0495671_0001575 Ga0495671_0001575_1821_2765 314
121 3300046794 Ga0495589_0000192 Ga0495589_0000192_1818_2762 314
122 3300046810 Ga0495660_0000156 Ga0495660_0000156_58680_59624 314
123 3300046810 Ga0495660_0000273 Ga0495660_0000273_23452_24396 314
124 3300047323 Ga0495683_0001655 Ga0495683_0001655_13002_13946 314
125 3300047446 Ga0495679_000003 Ga0495679_000003_1772_2716 314
126 3300047469 Ga0495673_0000004 Ga0495673_0000004_976216_977160 314
127 3300047469 Ga0495673_0000127 Ga0495673_0000127_107605_108549 314
128 3300047469 Ga0495673_0001542 Ga0495673_0001542_1780_2724 314
129 3300047472 Ga0495686_0000024 Ga0495686_0000024_240471_241415 314
130 3300047472 Ga0495686_0000375 Ga0495686_0000375_29914_30858 314
131 3300047472 Ga0495686_0104863 Ga0495686_0104863_369_1313 314
132 3300048903 Ga0496100_0003924 Ga0496100_0003924_2027_2971 314
133 3300048904 Ga0496101_0000359 Ga0496101_0000359_13850_14794 314
134 3300048909 Ga0496106_0000807 Ga0496106_0000807_16493_17437 314
135 3300048919 Ga0496116_0175442 Ga0496116_0175442_23_967 314
136 3300048920 Ga0496117_0007810 Ga0496117_0007810_2392_3336 314
137 3300048921 Ga0496118_0000714 Ga0496118_0000714_13161_14105 314
138 3300048921 Ga0496118_0003985 Ga0496118_0003985_2969_3913 314
139 3300048924 Ga0496121_0000829 Ga0496121_0000829_42196_43140 314
140 3300048924 Ga0496121_0001307 Ga0496121_0001307_13429_14373 314
141 3300048924 Ga0496121_0001580 Ga0496121_0001580_5254_6198 314
142 3300048924 Ga0496121_0098983 Ga0496121_0098983_76_1020 314
143 3300048925 Ga0496122_0005001 Ga0496122_0005001_8609_9553 314
144 3300048926 Ga0496123_0005702 Ga0496123_0005702_6755_7699 314
145 3300048926 Ga0496123_0031147 Ga0496123_0031147_2922_3866 314
146 3300048926 Ga0496123_0100356 Ga0496123_0100356_146_1090 314
147 3300048928 Ga0496125_0002397 Ga0496125_0002397_12440_13384 314
148 3300048929 Ga0496126_0186768 Ga0496126_0186768_642_1586 314
149 3300049459 Ga0495678_000026 Ga0495678_000026_224241_225185 314
150 3300049460 Ga0495682_0010675 Ga0495682_0010675_1794_2738 314
151 3300049568 Ga0501031_0076003 Ga0501031_0076003_103_1047 314
152 3300050516 nmdc:mga0sz30_112410_c1 nmdc:mga0sz30_112410_c1_220_1164 314
153 3300053087 Ga0500643_000138 Ga0500643_000138_12737_13681 314
154 3300053103 Ga0500555_000108 Ga0500555_000108_17448_18392 314
155 3300053160 Ga0500633_0080410 Ga0500633_0080410_76_1020 314
156 3300002737 JGI25162J39368_1002571 JGI25162J39368_10025714 315
157 3300002741 JGI25157J39369_1000818 JGI25157J39369_10008187 315
158 3300003762 Ga0055542_1000247 Ga0055542_10002474 315
159 3300005336 Ga0070680_100041772 Ga0070680_1000417721 315
160 3300005340 Ga0070689_100006866 Ga0070689_1000068666 315
161 3300005344 Ga0070661_100045305 Ga0070661_1000453053 315
162 3300005539 Ga0068853_100059625 Ga0068853_1000596251 315
163 3300005546 Ga0070696_100244229 Ga0070696_1002442291 315
164 3300005578 Ga0068854_100048632 Ga0068854_1000486323 315
165 3300005843 Ga0068860_100064818 Ga0068860_1000648181 315
166 3300005844 Ga0068862_100031871 Ga0068862_1000318714 315
167 3300009093 Ga0105240_10111342 Ga0105240_101113423 315
168 3300009545 Ga0105237_10000036 Ga0105237_10000036143 315
169 3300009551 Ga0105238_10145909 Ga0105238_101459093 315
170 3300013306 Ga0163162_10202123 Ga0163162_102021231 315
171 3300014497 Ga0182008_10077107 Ga0182008_100771072 315
172 3300014497 Ga0182008_10161955 Ga0182008_101619552 315
173 3300014969 Ga0157376_10013121 Ga0157376_100131215 315
174 3300015261 Ga0182006_1016880 Ga0182006_10168803 315
175 3300015262 Ga0182007_10005469 Ga0182007_100054696 315
176 3300020070 Ga0206356_10082985 Ga0206356_100829853 315
177 3300020082 Ga0206353_11142836 Ga0206353_111428364 315
178 3300025225 Ga0209566_102797 Ga0209566_1027973 315
179 3300025226 Ga0209674_101763 Ga0209674_1017637 315
180 3300025228 Ga0209672_100407 Ga0209672_10040712 315
181 3300025231 Ga0207427_103267 Ga0207427_1032674 315
182 3300025233 Ga0209437_100382 Ga0209437_1003824 315
183 3300025233 Ga0209437_101296 Ga0209437_1012968 315
184 3300025242 Ga0209258_102718 Ga0209258_1027182 315
185 3300025250 Ga0209026_1000119 Ga0209026_100011984 315
186 3300025250 Ga0209026_1000206 Ga0209026_100020669 315
187 3300025250 Ga0209026_1004776 Ga0209026_10047762 315
188 3300025254 Ga0209148_1000055 Ga0209148_1000055241 315
189 3300025256 Ga0209759_1001926 Ga0209759_10019262 315
190 3300025256 Ga0209759_1009613 Ga0209759_10096132 315
191 3300025261 Ga0209233_1020339 Ga0209233_10203392 315
192 3300025261 Ga0209233_1023614 Ga0209233_10236142 315
193 3300025272 Ga0209455_1000318 Ga0209455_100031812 315
194 3300025913 Ga0207695_10000938 Ga0207695_1000093824 315
195 3300025914 Ga0207671_10004404 Ga0207671_1000440413 315
196 3300025936 Ga0207670_10008701 Ga0207670_100087016 315
197 3300025949 Ga0207667_10008815 Ga0207667_100088157 315
198 3300041443 Ga0451789_0781782 Ga0451789_0781782_126_1073 315
199 3300044672 Ga0466982_0000027 Ga0466982_0000027_22981_23928 315
200 3300044842 Ga0466957_0049386 Ga0466957_0049386_1568_2515 315
201 3300046460 Ga0495638_0000458 Ga0495638_0000458_15549_16496 315
202 3300046507 Ga0495606_0000923 Ga0495606_0000923_2741_3742 315
203 3300046557 Ga0495622_0012896 Ga0495622_0012896_253_1254 315
204 3300046660 Ga0495625_0132658 Ga0495625_0132658_261_1208 315
205 3300046694 Ga0495649_0109463 Ga0495649_0109463_306_1253 315
206 3300048918 Ga0496115_0001580 Ga0496115_0001580_2586_3587 315
207 3300048929 Ga0496126_0085834 Ga0496126_0085834_1678_2625 315
208 3300049459 Ga0495678_022531 Ga0495678_022531_1154_2155 315
209 3300049580 Ga0501046_0018316 Ga0501046_0018316_4795_5742 315
210 3300049822 Ga0501035_0004859 Ga0501035_0004859_3227_4186 315
211 3300049823 Ga0501044_0027291 Ga0501044_0027291_2202_3161 315
212 3300005455 Ga0070663_100042756 Ga0070663_1000427563 316
213 3300005458 Ga0070681_10000008 Ga0070681_1000000825 316
214 3300013100 Ga0157373_10188224 Ga0157373_101882242 316
215 3300025912 Ga0207707_10000442 Ga0207707_1000044222 316
216 3300041452 Ga0451793_0776588 Ga0451793_0776588_603_1556 316
217 3300042438 Ga0439459_0000749 Ga0439459_0000749_358_1311 316
218 3300046460 Ga0495638_0000090 Ga0495638_0000090_64630_65583 316
219 3300048921 Ga0496118_0223701 Ga0496118_0223701_98_1051 317
220 3300049570 Ga0501033_0078521 Ga0501033_0078521_1262_2215 317
221 3300049571 Ga0501034_0007072 Ga0501034_0007072_8043_8996 317
222 3300049572 Ga0501036_0271327 Ga0501036_0271327_243_1196 317
223 3300049573 Ga0501037_0007967 Ga0501037_0007967_1791_2744 317
224 3300049579 Ga0501043_0013549 Ga0501043_0013549_2978_3931 317
225 3300049586 Ga0501070_0015983 Ga0501070_0015983_4410_5363 317
226 3300049822 Ga0501035_0038906 Ga0501035_0038906_582_1535 317
227 3300049823 Ga0501044_0025524 Ga0501044_0025524_235_1188 317
228 3300005563 Ga0068855_100173957 Ga0068855_1001739572 318
229 3300025949 Ga0207667_10215497 Ga0207667_102154972 318
230 3300026041 Ga0207639_10002808 Ga0207639_100028082 318
231 3300048928 Ga0496125_0003619 Ga0496125_0003619_85_1068 319
232 iso_pu_bacteria 2846037992 2846040658 322
233 3300005546 Ga0070696_100007799 Ga0070696_1000077992 324
234 3300028017 Ga0265356_1002071 Ga0265356_10020712 324
235 3300031730 Ga0307516_10000530 Ga0307516_1000053027 324
236 3300042876 Ga0451577_0036489 Ga0451577_0036489_903_1877 324
237 3300044712 Ga0453684_0033909 Ga0453684_0033909_981_1955 324
238 3300045051 Ga0451576_0037205 Ga0451576_0037205_119_1093 324
239 iso_pu_bacteria 2524614729 2525557035 324
240 iso_pu_bacteria 2627854209 2630648631 324
241 3300005367 Ga0070667_100089719 Ga0070667_1000897192 325
242 3300007265 Ga0099794_10004440 Ga0099794_100044403 325
243 3300007788 Ga0099795_10007094 Ga0099795_100070943 325
244 3300010159 Ga0099796_10000269 Ga0099796_100002692 325
245 3300025916 Ga0207663_10037328 Ga0207663_100373283 325
246 3300025928 Ga0207700_10006574 Ga0207700_100065741 325
247 3300025986 Ga0207658_10158380 Ga0207658_101583802 325
248 3300042876 Ga0451577_0008296 Ga0451577_0008296_3405_4388 325
249 3300044673 Ga0453683_0153344 Ga0453683_0153344_456_1439 325
250 3300044712 Ga0453684_0118165 Ga0453684_0118165_483_1466 325
251 3300005354 Ga0070675_100212832 Ga0070675_1002128322 326
252 3300005539 Ga0068853_100048342 Ga0068853_1000483423 326
253 3300005577 Ga0068857_100285692 Ga0068857_1002856922 326
254 3300013297 Ga0157378_10015875 Ga0157378_100158754 326
255 3300025923 Ga0207681_10056628 Ga0207681_100566282 326
256 3300025926 Ga0207659_10428379 Ga0207659_104283791 326
257 3300031727 Ga0316576_10018262 Ga0316576_100182622 326
258 3300031728 Ga0316578_10020597 Ga0316578_100205972 326
259 3300039447 Ga0436361_0378193 Ga0436361_0378193_636_1640 326
260 3300044712 Ga0453684_0000615 Ga0453684_0000615_8304_9293 326
261 3300045051 Ga0451576_0000201 Ga0451576_0000201_8304_9293 326
262 3300005436 Ga0070713_100000090 Ga0070713_10000009037 327
263 3300025928 Ga0207700_10000065 Ga0207700_1000006510 327
264 2162886007 SwRhRL2b_contig_2001396 SwRhRL2b_0998.00004380 328
265 3300031251 Ga0265327_10000348 Ga0265327_1000034870 328
266 3300031344 Ga0265316_10010846 Ga0265316_100108463 328
267 3300032139 Ga0316580_10035870 Ga0316580_100358702 328
268 3300044673 Ga0453683_0245356 Ga0453683_0245356_111_1127 328
269 3300044712 Ga0453684_0000833 Ga0453684_0000833_87725_88723 328
270 3300044712 Ga0453684_0143854 Ga0453684_0143854_179_1177 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

68

307

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zyl-assembly1.cif.gz_A crystal structure of hypothetical protein yihe from escherichia coli 0.9573 7 327
1zyl-assembly1.cif.gz_A crystal structure of hypothetical protein yihe from escherichia coli 0.9344 7 327
6sun-assembly1.cif.gz_A amicoumacin kinase hamin in complex with amp-pnp, ca2+ and ami 0.7573 17 313
6sul-assembly2.cif.gz_D amicoumacin kinase amin in complex with amp-pnp, mg2+ and ami 0.7524 21 328
6sv5-assembly1.cif.gz_A amicoumacin kinase amin in complex with atp 0.7508 21 328
ID Description Score Start End Superfamily
af_P0C0K3_149_318_1.20.1270.170 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.9719 155 324 1.20.1270.170
af_P0C0K3_17_108_3.30.200.70 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.9661 21 111 3.30.200.70
1zylA02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9523 64 264 1.10.510.10
af_P0C0K3_149_318_1.20.1270.170 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.9496 155 324 1.20.1270.170
af_P0C0K3_17_108_3.30.200.70 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.9459 21 111 3.30.200.70

Feature Viewer

pLDDT pTM Quality
93.92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map