F376945
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 270 | 186 | 255 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10015875|Ga0157378_100158754 |
| Length | 367 |
| Sequence | MPFRLHHLHENSDSAPETLAQGRDAAQCCSTPVIARRMSAPNTPPFAGLSPDIIIKAVESLGIVCDGRVLALNSYENRVYRLGREDAAPLVVKFYRPNRWSDAAILEDHAFGAELRAAELSVVAPLDIAGRTLHHSEGFRFSLFPMQGGRAPEPGDKETLIHIGRALGRMHSVGAAGVFRHRPVLSVRAYAEEPVDYLLEAGWLPPELEENFLELGELSIHAIERAFALAGQLQTLRLHGDCHPGNLLWRDDTVHFVDLDDTLTGPAMQDLWMLLSGDRPARAQQLGWLLEGYEIFRPFDRAELHLIEALRAMRLLHYHAWIARRWHDPAFPAAFPWFESPRHWEAVITQLQEQLATMAEPVLDLLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 4 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 5 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 6 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 7 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 8 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 9 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 10 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 11 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 12 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 13 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 14 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 15 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 16 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 17 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 18 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 19 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 20 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 21 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 23 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 24 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 105 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 106 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 108 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 111 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 113 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 115 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 116 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 117 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 118 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 119 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 122 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 123 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 124 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 157 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 164 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 165 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 166 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 167 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 168 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 182 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 184 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 185 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 186 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.7 |
| Metatranscriptomes | 0.74 |
| Isolates | 5.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.56 |
| Nodule | 0 |
| Rhizoplane | 3.7 |
| Rhizosphere | 65.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2001396 | 2162886007 | Bacteria | 1638 |
| 2 | JGI25162J39368_1000147 | 3300002737 | Bacteria | 76626 |
| 3 | JGI25162J39368_1002571 | 3300002737 | Bacteria | 6873 |
| 4 | JGI25154J39366_1006186 | 3300002738 | Bacteria | 1788 |
| 5 | JGI25157J39369_1000093 | 3300002741 | Bacteria | 76626 |
| 6 | JGI25157J39369_1000818 | 3300002741 | Bacteria | 15526 |
| 7 | JGI25163J39215_1000328 | 3300002771 | Bacteria | 15770 |
| 8 | JGI25163J39215_1000500 | 3300002771 | Bacteria | 11663 |
| 9 | JGI25164J39214_1000118 | 3300002772 | Bacteria | 76626 |
| 10 | JGI25165J46597_1000236 | 3300003214 | Bacteria | 76626 |
| 11 | rootH1_10008997 | 3300003316 | Bacteria | 3253 |
| 12 | Ga0055538_1001354 | 3300003751 | Bacteria | 4845 |
| 13 | Ga0055535_1000138 | 3300003761 | Bacteria | 76626 |
| 14 | Ga0055542_1000186 | 3300003762 | Bacteria | 76626 |
| 15 | Ga0055542_1000247 | 3300003762 | Bacteria | 62095 |
| 16 | Ga0055529_1000226 | 3300003763 | Bacteria | 71685 |
| 17 | Ga0055529_1000396 | 3300003763 | Bacteria | 46326 |
| 18 | Ga0070680_100041772 | 3300005336 | Bacteria | 3719 |
| 19 | Ga0070689_100006866 | 3300005340 | Bacteria | 7917 |
| 20 | Ga0070661_100029118 | 3300005344 | Bacteria | 3985 |
| 21 | Ga0070661_100045305 | 3300005344 | Bacteria | 3215 |
| 22 | Ga0070675_100036448 | 3300005354 | Bacteria | 4002 |
| 23 | Ga0070675_100212832 | 3300005354 | Bacteria | 1681 |
| 24 | Ga0070673_100208902 | 3300005364 | Bacteria | 1685 |
| 25 | Ga0070667_100089719 | 3300005367 | Bacteria | 2641 |
| 26 | Ga0070713_100000090 | 3300005436 | Bacteria | 57703 |
| 27 | Ga0070711_100077816 | 3300005439 | Bacteria | 2355 |
| 28 | Ga0070663_100042756 | 3300005455 | Bacteria | 3185 |
| 29 | Ga0070681_10000008 | 3300005458 | Bacteria | 151355 |
| 30 | Ga0070685_10044917 | 3300005466 | Bacteria | 2531 |
| 31 | Ga0068853_100048342 | 3300005539 | Bacteria | 3654 |
| 32 | Ga0068853_100059625 | 3300005539 | Bacteria | 3297 |
| 33 | Ga0070696_100007799 | 3300005546 | Bacteria | 7145 |
| 34 | Ga0070696_100244229 | 3300005546 | Bacteria | 1355 |
| 35 | Ga0068855_100018763 | 3300005563 | Bacteria | 8316 |
| 36 | Ga0068855_100173957 | 3300005563 | Bacteria | 2437 |
| 37 | Ga0068857_100285692 | 3300005577 | Bacteria | 1518 |
| 38 | Ga0068854_100048632 | 3300005578 | Bacteria | 3026 |
| 39 | Ga0068856_100000676 | 3300005614 | Bacteria | 36917 |
| 40 | Ga0068860_100064818 | 3300005843 | Bacteria | 3469 |
| 41 | Ga0068862_100031871 | 3300005844 | Bacteria | 4453 |
| 42 | Ga0075369_10019528 | 3300006186 | Bacteria | 2768 |
| 43 | Ga0099794_10004440 | 3300007265 | Bacteria | 5515 |
| 44 | Ga0099795_10007094 | 3300007788 | Bacteria | 3103 |
| 45 | Ga0105240_10111342 | 3300009093 | Bacteria | 3312 |
| 46 | Ga0105247_10001155 | 3300009101 | Bacteria | 19591 |
| 47 | Ga0105237_10000036 | 3300009545 | Bacteria | 191142 |
| 48 | Ga0105238_10145909 | 3300009551 | Bacteria | 2343 |
| 49 | Ga0099796_10000269 | 3300010159 | Bacteria | 8239 |
| 50 | Ga0105239_10075496 | 3300010375 | Bacteria | 3706 |
| 51 | Ga0157373_10188224 | 3300013100 | Bacteria | 1454 |
| 52 | Ga0157370_10018468 | 3300013104 | Bacteria | 7011 |
| 53 | Ga0157369_10016495 | 3300013105 | Bacteria | 8308 |
| 54 | Ga0157378_10015875 | 3300013297 | Bacteria | 6594 |
| 55 | Ga0163162_10202123 | 3300013306 | Bacteria | 2116 |
| 56 | Ga0157372_10072242 | 3300013307 | Bacteria | 3888 |
| 57 | Ga0182008_10077107 | 3300014497 | Bacteria | 1640 |
| 58 | Ga0182008_10161955 | 3300014497 | Bacteria | 1126 |
| 59 | Ga0157376_10013121 | 3300014969 | Bacteria | 6172 |
| 60 | Ga0182006_1000185 | 3300015261 | Bacteria | 64803 |
| 61 | Ga0182006_1016880 | 3300015261 | Bacteria | 3110 |
| 62 | Ga0182007_10005469 | 3300015262 | Bacteria | 5576 |
| 63 | Ga0182007_10010065 | 3300015262 | Bacteria | 3762 |
| 64 | Ga0182005_1001773 | 3300015265 | Bacteria | 8305 |
| 65 | Ga0182005_1025505 | 3300015265 | Bacteria | 1613 |
| 66 | Ga0163161_10000436 | 3300017792 | Bacteria | 34952 |
| 67 | Ga0163161_10165471 | 3300017792 | Bacteria | 1688 |
| 68 | Ga0206356_10082985 | 3300020070 | Bacteria | 2959 |
| 69 | Ga0206353_11142836 | 3300020082 | Bacteria | 4823 |
| 70 | Ga0209435_106992 | 3300025206 | Bacteria | 1251 |
| 71 | Ga0209760_100571 | 3300025207 | Bacteria | 6595 |
| 72 | Ga0209784_100094 | 3300025224 | Bacteria | 113434 |
| 73 | Ga0209566_102797 | 3300025225 | Bacteria | 2992 |
| 74 | Ga0209674_101763 | 3300025226 | Bacteria | 5253 |
| 75 | Ga0209672_100407 | 3300025228 | Bacteria | 25502 |
| 76 | Ga0209147_104140 | 3300025229 | Bacteria | 2508 |
| 77 | Ga0207427_100100 | 3300025231 | Bacteria | 121264 |
| 78 | Ga0207427_103267 | 3300025231 | Bacteria | 3528 |
| 79 | Ga0209437_100059 | 3300025233 | Bacteria | 355048 |
| 80 | Ga0209437_100382 | 3300025233 | Bacteria | 43727 |
| 81 | Ga0209437_101296 | 3300025233 | Bacteria | 6708 |
| 82 | Ga0209258_100034 | 3300025242 | Bacteria | 437372 |
| 83 | Ga0209258_100738 | 3300025242 | Bacteria | 21171 |
| 84 | Ga0209258_102718 | 3300025242 | Bacteria | 4300 |
| 85 | Ga0209646_1002679 | 3300025246 | Bacteria | 3818 |
| 86 | Ga0209026_1000119 | 3300025250 | Bacteria | 130220 |
| 87 | Ga0209026_1000161 | 3300025250 | Bacteria | 102959 |
| 88 | Ga0209026_1000206 | 3300025250 | Bacteria | 81686 |
| 89 | Ga0209026_1004776 | 3300025250 | Bacteria | 3882 |
| 90 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 91 | Ga0209148_1000055 | 3300025254 | Bacteria | 367500 |
| 92 | Ga0209759_1000467 | 3300025256 | Bacteria | 45696 |
| 93 | Ga0209759_1001926 | 3300025256 | Bacteria | 10141 |
| 94 | Ga0209759_1009613 | 3300025256 | Bacteria | 2908 |
| 95 | Ga0209129_1000455 | 3300025258 | Bacteria | 30337 |
| 96 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 97 | Ga0209233_1020339 | 3300025261 | Bacteria | 1743 |
| 98 | Ga0209233_1023614 | 3300025261 | Bacteria | 1555 |
| 99 | Ga0209455_1000054 | 3300025272 | Bacteria | 358936 |
| 100 | Ga0209455_1000318 | 3300025272 | Bacteria | 47836 |
| 101 | Ga0209758_1023720 | 3300025297 | Bacteria | 2763 |
| 102 | Ga0209256_1011333 | 3300025299 | Bacteria | 3579 |
| 103 | Ga0207710_10008240 | 3300025900 | Bacteria | 4400 |
| 104 | Ga0207647_10000013 | 3300025904 | Bacteria | 144052 |
| 105 | Ga0207707_10000442 | 3300025912 | Bacteria | 43048 |
| 106 | Ga0207695_10000938 | 3300025913 | Bacteria | 52009 |
| 107 | Ga0207671_10004404 | 3300025914 | Bacteria | 13490 |
| 108 | Ga0207663_10037328 | 3300025916 | Bacteria | 2928 |
| 109 | Ga0207681_10056628 | 3300025923 | Bacteria | 2675 |
| 110 | Ga0207659_10428379 | 3300025926 | Bacteria | 1111 |
| 111 | Ga0207700_10000065 | 3300025928 | Bacteria | 65305 |
| 112 | Ga0207700_10006574 | 3300025928 | Bacteria | 7039 |
| 113 | Ga0207706_10172424 | 3300025933 | Bacteria | 1901 |
| 114 | Ga0207670_10008701 | 3300025936 | Bacteria | 5746 |
| 115 | Ga0207667_10008815 | 3300025949 | Bacteria | 11943 |
| 116 | Ga0207667_10215497 | 3300025949 | Bacteria | 1968 |
| 117 | Ga0207658_10158380 | 3300025986 | Bacteria | 1853 |
| 118 | Ga0207639_10002808 | 3300026041 | Bacteria | 11683 |
| 119 | Ga0207639_10023333 | 3300026041 | Bacteria | 4467 |
| 120 | Ga0207702_10000661 | 3300026078 | Bacteria | 37532 |
| 121 | Ga0265356_1002071 | 3300028017 | Bacteria | 2750 |
| 122 | Ga0265327_10000348 | 3300031251 | Bacteria | 87817 |
| 123 | Ga0265316_10010846 | 3300031344 | Bacteria | 8274 |
| 124 | Ga0316576_10018262 | 3300031727 | Bacteria | 4784 |
| 125 | Ga0316578_10020597 | 3300031728 | Bacteria | 3647 |
| 126 | Ga0307516_10000530 | 3300031730 | Bacteria | 51072 |
| 127 | Ga0316580_10035870 | 3300032139 | Bacteria | 1535 |
| 128 | Ga0373955_0111694 | 3300035172 | Bacteria | 1581 |
| 129 | Ga0436361_0378193 | 3300039447 | Bacteria | 1911 |
| 130 | Ga0451789_0781782 | 3300041443 | Bacteria | 1088 |
| 131 | Ga0451793_0776588 | 3300041452 | Bacteria | 2152 |
| 132 | Ga0450908_000006 | 3300042184 | Bacteria | 56117 |
| 133 | Ga0439459_0000749 | 3300042438 | Bacteria | 4459 |
| 134 | Ga0451577_0008296 | 3300042876 | Bacteria | 10108 |
| 135 | Ga0451577_0036489 | 3300042876 | Bacteria | 4424 |
| 136 | Ga0466982_0000015 | 3300044672 | Bacteria | 131281 |
| 137 | Ga0466982_0000027 | 3300044672 | Bacteria | 62332 |
| 138 | Ga0453683_0153344 | 3300044673 | Bacteria | 1456 |
| 139 | Ga0453683_0245356 | 3300044673 | Bacteria | 1141 |
| 140 | Ga0453684_0000615 | 3300044712 | Bacteria | 130336 |
| 141 | Ga0453684_0000833 | 3300044712 | Bacteria | 104091 |
| 142 | Ga0453684_0033909 | 3300044712 | Bacteria | 7101 |
| 143 | Ga0453684_0118165 | 3300044712 | Bacteria | 3207 |
| 144 | Ga0453684_0143854 | 3300044712 | Bacteria | 2843 |
| 145 | Ga0466968_0012250 | 3300044735 | Bacteria | 3352 |
| 146 | Ga0466957_0049386 | 3300044842 | Bacteria | 2558 |
| 147 | Ga0451576_0000201 | 3300045051 | Bacteria | 150175 |
| 148 | Ga0451576_0037205 | 3300045051 | Bacteria | 5155 |
| 149 | Ga0495617_000058 | 3300046452 | Bacteria | 100393 |
| 150 | Ga0495638_0000090 | 3300046460 | Bacteria | 148040 |
| 151 | Ga0495638_0000458 | 3300046460 | Bacteria | 48869 |
| 152 | Ga0495638_0000536 | 3300046460 | Bacteria | 43871 |
| 153 | Ga0495638_0000576 | 3300046460 | Bacteria | 41440 |
| 154 | Ga0495638_0006634 | 3300046460 | Bacteria | 8405 |
| 155 | Ga0495650_0000092 | 3300046471 | Bacteria | 224681 |
| 156 | Ga0495650_0005112 | 3300046471 | Bacteria | 8668 |
| 157 | Ga0495650_0010898 | 3300046471 | Bacteria | 5033 |
| 158 | Ga0495584_0008164 | 3300046491 | Bacteria | 5437 |
| 159 | Ga0495585_0000683 | 3300046492 | Bacteria | 30903 |
| 160 | Ga0495585_0000999 | 3300046492 | Bacteria | 23656 |
| 161 | Ga0495607_0000038 | 3300046501 | Bacteria | 134124 |
| 162 | Ga0495607_0000196 | 3300046501 | Bacteria | 63991 |
| 163 | Ga0495607_0010187 | 3300046501 | Bacteria | 6324 |
| 164 | Ga0495606_0000222 | 3300046507 | Bacteria | 100766 |
| 165 | Ga0495606_0000923 | 3300046507 | Bacteria | 43313 |
| 166 | Ga0495606_0001488 | 3300046507 | Bacteria | 31138 |
| 167 | Ga0495606_0004160 | 3300046507 | Bacteria | 14665 |
| 168 | Ga0495606_0067430 | 3300046507 | Bacteria | 2265 |
| 169 | Ga0495610_0074725 | 3300046512 | Bacteria | 1571 |
| 170 | Ga0495616_0000056 | 3300046513 | Bacteria | 101901 |
| 171 | Ga0495616_0015371 | 3300046513 | Bacteria | 4256 |
| 172 | Ga0495620_0000479 | 3300046515 | Bacteria | 25982 |
| 173 | Ga0495620_0001818 | 3300046515 | Bacteria | 12549 |
| 174 | Ga0495631_0000120 | 3300046518 | Bacteria | 52656 |
| 175 | Ga0495631_0000595 | 3300046518 | Bacteria | 23959 |
| 176 | Ga0495632_0075747 | 3300046519 | Bacteria | 1610 |
| 177 | Ga0495632_0140974 | 3300046519 | Bacteria | 1118 |
| 178 | Ga0495637_0010001 | 3300046520 | Bacteria | 4608 |
| 179 | Ga0495648_0001431 | 3300046524 | Bacteria | 23362 |
| 180 | Ga0495648_0001523 | 3300046524 | Bacteria | 22661 |
| 181 | Ga0495609_0007485 | 3300046538 | Bacteria | 5445 |
| 182 | Ga0495622_0012896 | 3300046557 | Bacteria | 3876 |
| 183 | Ga0495668_0001983 | 3300046616 | Bacteria | 17927 |
| 184 | Ga0495668_0074430 | 3300046616 | Bacteria | 1865 |
| 185 | Ga0495611_0000034 | 3300046648 | Bacteria | 103287 |
| 186 | Ga0495611_0000078 | 3300046648 | Bacteria | 68937 |
| 187 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 188 | Ga0495625_0046953 | 3300046660 | Bacteria | 3114 |
| 189 | Ga0495625_0132658 | 3300046660 | Bacteria | 1686 |
| 190 | Ga0495661_0001142 | 3300046665 | Bacteria | 23194 |
| 191 | Ga0495661_0225333 | 3300046665 | Bacteria | 969 |
| 192 | Ga0495670_0003624 | 3300046691 | Bacteria | 7588 |
| 193 | Ga0495670_0008323 | 3300046691 | Bacteria | 5098 |
| 194 | Ga0495671_0001575 | 3300046692 | Bacteria | 15099 |
| 195 | Ga0495649_0109463 | 3300046694 | Bacteria | 1465 |
| 196 | Ga0495589_0000192 | 3300046794 | Bacteria | 53416 |
| 197 | Ga0495660_0000156 | 3300046810 | Bacteria | 74271 |
| 198 | Ga0495660_0000273 | 3300046810 | Bacteria | 48544 |
| 199 | Ga0495683_0001655 | 3300047323 | Bacteria | 14236 |
| 200 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 201 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 202 | Ga0495673_0000127 | 3300047469 | Bacteria | 140402 |
| 203 | Ga0495673_0001542 | 3300047469 | Bacteria | 18120 |
| 204 | Ga0495686_0000024 | 3300047472 | Bacteria | 400343 |
| 205 | Ga0495686_0000375 | 3300047472 | Bacteria | 71924 |
| 206 | Ga0495686_0104863 | 3300047472 | Bacteria | 1701 |
| 207 | Ga0496100_0003924 | 3300048903 | Bacteria | 7816 |
| 208 | Ga0496101_0000359 | 3300048904 | Bacteria | 30569 |
| 209 | Ga0496104_0011953 | 3300048907 | Bacteria | 7788 |
| 210 | Ga0496105_0005024 | 3300048908 | Bacteria | 10014 |
| 211 | Ga0496106_0000807 | 3300048909 | Bacteria | 22662 |
| 212 | Ga0496114_0002014 | 3300048917 | Bacteria | 15457 |
| 213 | Ga0496115_0001580 | 3300048918 | Bacteria | 16359 |
| 214 | Ga0496115_0077462 | 3300048918 | Bacteria | 2703 |
| 215 | Ga0496116_0175442 | 3300048919 | Bacteria | 1155 |
| 216 | Ga0496117_0007810 | 3300048920 | Bacteria | 10306 |
| 217 | Ga0496118_0000714 | 3300048921 | Bacteria | 53628 |
| 218 | Ga0496118_0003985 | 3300048921 | Bacteria | 18002 |
| 219 | Ga0496118_0223701 | 3300048921 | Bacteria | 1093 |
| 220 | Ga0496121_0000829 | 3300048924 | Bacteria | 56313 |
| 221 | Ga0496121_0001307 | 3300048924 | Bacteria | 42738 |
| 222 | Ga0496121_0001580 | 3300048924 | Bacteria | 37914 |
| 223 | Ga0496121_0098983 | 3300048924 | Bacteria | 2255 |
| 224 | Ga0496122_0005001 | 3300048925 | Bacteria | 16035 |
| 225 | Ga0496123_0005702 | 3300048926 | Bacteria | 12415 |
| 226 | Ga0496123_0031147 | 3300048926 | Bacteria | 3885 |
| 227 | Ga0496123_0100356 | 3300048926 | Bacteria | 1686 |
| 228 | Ga0496125_0002397 | 3300048928 | Bacteria | 24412 |
| 229 | Ga0496125_0003619 | 3300048928 | Bacteria | 18554 |
| 230 | Ga0496126_0085834 | 3300048929 | Bacteria | 2774 |
| 231 | Ga0496126_0186768 | 3300048929 | Bacteria | 1757 |
| 232 | Ga0495678_000026 | 3300049459 | Bacteria | 226978 |
| 233 | Ga0495678_022531 | 3300049459 | Bacteria | 2752 |
| 234 | Ga0495682_0009997 | 3300049460 | Bacteria | 3690 |
| 235 | Ga0495682_0010675 | 3300049460 | Bacteria | 3548 |
| 236 | Ga0501031_0076003 | 3300049568 | Bacteria | 2187 |
| 237 | Ga0501033_0078521 | 3300049570 | Bacteria | 2422 |
| 238 | Ga0501034_0007072 | 3300049571 | Bacteria | 11967 |
| 239 | Ga0501036_0271327 | 3300049572 | Bacteria | 1420 |
| 240 | Ga0501037_0007967 | 3300049573 | Bacteria | 7765 |
| 241 | Ga0501043_0013549 | 3300049579 | Bacteria | 6380 |
| 242 | Ga0501046_0018316 | 3300049580 | Bacteria | 5829 |
| 243 | Ga0501070_0015983 | 3300049586 | Bacteria | 6308 |
| 244 | Ga0501080_0087028 | 3300049742 | Bacteria | 2903 |
| 245 | Ga0501035_0004859 | 3300049822 | Bacteria | 12747 |
| 246 | Ga0501035_0038906 | 3300049822 | Bacteria | 4306 |
| 247 | Ga0501035_0054578 | 3300049822 | Bacteria | 3570 |
| 248 | Ga0501044_0025524 | 3300049823 | Bacteria | 6264 |
| 249 | Ga0501044_0027291 | 3300049823 | Bacteria | 6036 |
| 250 | nmdc:mga0sz30_112410_c1 | 3300050516 | Bacteria | 1194 |
| 251 | Ga0495619_0118961 | 3300053085 | Bacteria | 1811 |
| 252 | Ga0500643_000138 | 3300053087 | Bacteria | 73474 |
| 253 | Ga0500555_000108 | 3300053103 | Bacteria | 39384 |
| 254 | Ga0500633_0080410 | 3300053160 | Bacteria | 1178 |
| 255 | Ga0500645_002528 | 3300053730 | Bacteria | 8073 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0054578 | Ga0501035_0054578_2730_3560 | 276 |
| 2 | 3300046492 | Ga0495585_0000999 | Ga0495585_0000999_1809_2753 | 285 |
| 3 | 3300046518 | Ga0495631_0000595 | Ga0495631_0000595_20849_21793 | 285 |
| 4 | 3300046524 | Ga0495648_0001431 | Ga0495648_0001431_1778_2722 | 285 |
| 5 | 3300046665 | Ga0495661_0001142 | Ga0495661_0001142_20479_21423 | 285 |
| 6 | 3300049460 | Ga0495682_0009997 | Ga0495682_0009997_1096_2040 | 285 |
| 7 | 3300053730 | Ga0500645_002528 | Ga0500645_002528_5380_6324 | 285 |
| 8 | 3300046665 | Ga0495661_0225333 | Ga0495661_0225333_68_958 | 296 |
| 9 | 3300005354 | Ga0070675_100036448 | Ga0070675_1000364483 | 302 |
| 10 | 3300005364 | Ga0070673_100208902 | Ga0070673_1002089022 | 302 |
| 11 | 3300025933 | Ga0207706_10172424 | Ga0207706_101724242 | 302 |
| 12 | 3300005466 | Ga0070685_10044917 | Ga0070685_100449172 | 304 |
| 13 | 3300049742 | Ga0501080_0087028 | Ga0501080_0087028_510_1424 | 304 |
| 14 | 3300046501 | Ga0495607_0010187 | Ga0495607_0010187_1324_2268 | 305 |
| 15 | 3300046460 | Ga0495638_0000576 | Ga0495638_0000576_35521_36468 | 307 |
| 16 | 3300046471 | Ga0495650_0000092 | Ga0495650_0000092_86912_87859 | 307 |
| 17 | iso_pu_bacteria | 2593339239 | 2595452809 | 310 |
| 18 | iso_pu_bacteria | 2718218334 | 2721025744 | 310 |
| 19 | iso_pu_bacteria | 2734482264 | 2735834284 | 310 |
| 20 | iso_pu_bacteria | 2738543009 | 2739225703 | 310 |
| 21 | iso_pu_bacteria | 2884338543 | 2884339071 | 310 |
| 22 | iso_pu_bacteria | 2919085039 | 2919086244 | 310 |
| 23 | iso_pu_bacteria | 2919404418 | 2919407842 | 310 |
| 24 | iso_pu_bacteria | 2941471342 | 2941473398 | 310 |
| 25 | 3300005439 | Ga0070711_100077816 | Ga0070711_1000778163 | 311 |
| 26 | 3300035172 | Ga0373955_0111694 | Ga0373955_0111694_581_1522 | 311 |
| 27 | 3300048907 | Ga0496104_0011953 | Ga0496104_0011953_3217_4158 | 311 |
| 28 | 3300048908 | Ga0496105_0005024 | Ga0496105_0005024_4054_4995 | 311 |
| 29 | 3300048917 | Ga0496114_0002014 | Ga0496114_0002014_7527_8468 | 311 |
| 30 | 3300048918 | Ga0496115_0077462 | Ga0496115_0077462_1260_2201 | 311 |
| 31 | 3300053085 | Ga0495619_0118961 | Ga0495619_0118961_308_1252 | 311 |
| 32 | iso_pu_bacteria | 2593339238 | 2595449060 | 311 |
| 33 | iso_pu_bacteria | 2739367700 | 2739733741 | 311 |
| 34 | iso_pu_bacteria | 2884411467 | 2884411733 | 311 |
| 35 | iso_pu_bacteria | 2928963466 | 2928966589 | 311 |
| 36 | 3300044672 | Ga0466982_0000015 | Ga0466982_0000015_126635_127576 | 313 |
| 37 | 3300002737 | JGI25162J39368_1000147 | JGI25162J39368_100014729 | 314 |
| 38 | 3300002738 | JGI25154J39366_1006186 | JGI25154J39366_10061862 | 314 |
| 39 | 3300002741 | JGI25157J39369_1000093 | JGI25157J39369_100009336 | 314 |
| 40 | 3300002771 | JGI25163J39215_1000328 | JGI25163J39215_10003284 | 314 |
| 41 | 3300002771 | JGI25163J39215_1000500 | JGI25163J39215_100050012 | 314 |
| 42 | 3300002772 | JGI25164J39214_1000118 | JGI25164J39214_100011829 | 314 |
| 43 | 3300003214 | JGI25165J46597_1000236 | JGI25165J46597_100023629 | 314 |
| 44 | 3300003316 | rootH1_10008997 | rootH1_100089972 | 314 |
| 45 | 3300003751 | Ga0055538_1001354 | Ga0055538_10013542 | 314 |
| 46 | 3300003761 | Ga0055535_1000138 | Ga0055535_100013829 | 314 |
| 47 | 3300003762 | Ga0055542_1000186 | Ga0055542_100018629 | 314 |
| 48 | 3300003763 | Ga0055529_1000226 | Ga0055529_100022636 | 314 |
| 49 | 3300003763 | Ga0055529_1000396 | Ga0055529_100039612 | 314 |
| 50 | 3300005344 | Ga0070661_100029118 | Ga0070661_1000291183 | 314 |
| 51 | 3300005563 | Ga0068855_100018763 | Ga0068855_10001876310 | 314 |
| 52 | 3300005614 | Ga0068856_100000676 | Ga0068856_1000006765 | 314 |
| 53 | 3300006186 | Ga0075369_10019528 | Ga0075369_100195283 | 314 |
| 54 | 3300009101 | Ga0105247_10001155 | Ga0105247_1000115512 | 314 |
| 55 | 3300010375 | Ga0105239_10075496 | Ga0105239_100754963 | 314 |
| 56 | 3300013104 | Ga0157370_10018468 | Ga0157370_100184685 | 314 |
| 57 | 3300013105 | Ga0157369_10016495 | Ga0157369_100164958 | 314 |
| 58 | 3300013307 | Ga0157372_10072242 | Ga0157372_100722423 | 314 |
| 59 | 3300015261 | Ga0182006_1000185 | Ga0182006_100018528 | 314 |
| 60 | 3300015262 | Ga0182007_10010065 | Ga0182007_100100653 | 314 |
| 61 | 3300015265 | Ga0182005_1001773 | Ga0182005_10017738 | 314 |
| 62 | 3300015265 | Ga0182005_1025505 | Ga0182005_10255052 | 314 |
| 63 | 3300017792 | Ga0163161_10000436 | Ga0163161_1000043638 | 314 |
| 64 | 3300017792 | Ga0163161_10165471 | Ga0163161_101654712 | 314 |
| 65 | 3300025206 | Ga0209435_106992 | Ga0209435_1069922 | 314 |
| 66 | 3300025207 | Ga0209760_100571 | Ga0209760_1005715 | 314 |
| 67 | 3300025224 | Ga0209784_100094 | Ga0209784_10009428 | 314 |
| 68 | 3300025229 | Ga0209147_104140 | Ga0209147_1041401 | 314 |
| 69 | 3300025231 | Ga0207427_100100 | Ga0207427_10010028 | 314 |
| 70 | 3300025233 | Ga0209437_100059 | Ga0209437_100059228 | 314 |
| 71 | 3300025242 | Ga0209258_100034 | Ga0209258_100034115 | 314 |
| 72 | 3300025242 | Ga0209258_100738 | Ga0209258_10073816 | 314 |
| 73 | 3300025246 | Ga0209646_1002679 | Ga0209646_10026792 | 314 |
| 74 | 3300025250 | Ga0209026_1000161 | Ga0209026_100016161 | 314 |
| 75 | 3300025254 | Ga0209148_1000001 | Ga0209148_1000001589 | 314 |
| 76 | 3300025256 | Ga0209759_1000467 | Ga0209759_100046735 | 314 |
| 77 | 3300025258 | Ga0209129_1000455 | Ga0209129_100045527 | 314 |
| 78 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021642 | 314 |
| 79 | 3300025272 | Ga0209455_1000054 | Ga0209455_100005484 | 314 |
| 80 | 3300025297 | Ga0209758_1023720 | Ga0209758_10237202 | 314 |
| 81 | 3300025299 | Ga0209256_1011333 | Ga0209256_10113333 | 314 |
| 82 | 3300025900 | Ga0207710_10008240 | Ga0207710_100082402 | 314 |
| 83 | 3300025904 | Ga0207647_10000013 | Ga0207647_1000001342 | 314 |
| 84 | 3300026041 | Ga0207639_10023333 | Ga0207639_100233333 | 314 |
| 85 | 3300026078 | Ga0207702_10000661 | Ga0207702_100006615 | 314 |
| 86 | 3300042184 | Ga0450908_000006 | Ga0450908_000006_30630_31574 | 314 |
| 87 | 3300044735 | Ga0466968_0012250 | Ga0466968_0012250_965_1909 | 314 |
| 88 | 3300046452 | Ga0495617_000058 | Ga0495617_000058_86777_87721 | 314 |
| 89 | 3300046460 | Ga0495638_0000536 | Ga0495638_0000536_41134_42078 | 314 |
| 90 | 3300046460 | Ga0495638_0006634 | Ga0495638_0006634_2418_3362 | 314 |
| 91 | 3300046471 | Ga0495650_0005112 | Ga0495650_0005112_3064_4008 | 314 |
| 92 | 3300046471 | Ga0495650_0010898 | Ga0495650_0010898_4035_4979 | 314 |
| 93 | 3300046491 | Ga0495584_0008164 | Ga0495584_0008164_448_1392 | 314 |
| 94 | 3300046492 | Ga0495585_0000683 | Ga0495585_0000683_12617_13561 | 314 |
| 95 | 3300046501 | Ga0495607_0000038 | Ga0495607_0000038_34582_35526 | 314 |
| 96 | 3300046501 | Ga0495607_0000196 | Ga0495607_0000196_61226_62170 | 314 |
| 97 | 3300046507 | Ga0495606_0000222 | Ga0495606_0000222_68720_69664 | 314 |
| 98 | 3300046507 | Ga0495606_0001488 | Ga0495606_0001488_4995_5939 | 314 |
| 99 | 3300046507 | Ga0495606_0004160 | Ga0495606_0004160_182_1126 | 314 |
| 100 | 3300046507 | Ga0495606_0067430 | Ga0495606_0067430_389_1333 | 314 |
| 101 | 3300046512 | Ga0495610_0074725 | Ga0495610_0074725_389_1333 | 314 |
| 102 | 3300046513 | Ga0495616_0000056 | Ga0495616_0000056_31403_32347 | 314 |
| 103 | 3300046513 | Ga0495616_0015371 | Ga0495616_0015371_1517_2461 | 314 |
| 104 | 3300046515 | Ga0495620_0000479 | Ga0495620_0000479_23724_24668 | 314 |
| 105 | 3300046515 | Ga0495620_0001818 | Ga0495620_0001818_8415_9359 | 314 |
| 106 | 3300046518 | Ga0495631_0000120 | Ga0495631_0000120_23988_24932 | 314 |
| 107 | 3300046519 | Ga0495632_0075747 | Ga0495632_0075747_64_1008 | 314 |
| 108 | 3300046519 | Ga0495632_0140974 | Ga0495632_0140974_53_997 | 314 |
| 109 | 3300046520 | Ga0495637_0010001 | Ga0495637_0010001_3334_4278 | 314 |
| 110 | 3300046524 | Ga0495648_0001523 | Ga0495648_0001523_14786_15730 | 314 |
| 111 | 3300046538 | Ga0495609_0007485 | Ga0495609_0007485_2669_3613 | 314 |
| 112 | 3300046616 | Ga0495668_0001983 | Ga0495668_0001983_14069_15013 | 314 |
| 113 | 3300046616 | Ga0495668_0074430 | Ga0495668_0074430_772_1716 | 314 |
| 114 | 3300046648 | Ga0495611_0000034 | Ga0495611_0000034_87694_88638 | 314 |
| 115 | 3300046648 | Ga0495611_0000078 | Ga0495611_0000078_27745_28689 | 314 |
| 116 | 3300046660 | Ga0495625_0000002 | Ga0495625_0000002_797730_798674 | 314 |
| 117 | 3300046660 | Ga0495625_0046953 | Ga0495625_0046953_1586_2530 | 314 |
| 118 | 3300046691 | Ga0495670_0003624 | Ga0495670_0003624_1594_2538 | 314 |
| 119 | 3300046691 | Ga0495670_0008323 | Ga0495670_0008323_2389_3333 | 314 |
| 120 | 3300046692 | Ga0495671_0001575 | Ga0495671_0001575_1821_2765 | 314 |
| 121 | 3300046794 | Ga0495589_0000192 | Ga0495589_0000192_1818_2762 | 314 |
| 122 | 3300046810 | Ga0495660_0000156 | Ga0495660_0000156_58680_59624 | 314 |
| 123 | 3300046810 | Ga0495660_0000273 | Ga0495660_0000273_23452_24396 | 314 |
| 124 | 3300047323 | Ga0495683_0001655 | Ga0495683_0001655_13002_13946 | 314 |
| 125 | 3300047446 | Ga0495679_000003 | Ga0495679_000003_1772_2716 | 314 |
| 126 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_976216_977160 | 314 |
| 127 | 3300047469 | Ga0495673_0000127 | Ga0495673_0000127_107605_108549 | 314 |
| 128 | 3300047469 | Ga0495673_0001542 | Ga0495673_0001542_1780_2724 | 314 |
| 129 | 3300047472 | Ga0495686_0000024 | Ga0495686_0000024_240471_241415 | 314 |
| 130 | 3300047472 | Ga0495686_0000375 | Ga0495686_0000375_29914_30858 | 314 |
| 131 | 3300047472 | Ga0495686_0104863 | Ga0495686_0104863_369_1313 | 314 |
| 132 | 3300048903 | Ga0496100_0003924 | Ga0496100_0003924_2027_2971 | 314 |
| 133 | 3300048904 | Ga0496101_0000359 | Ga0496101_0000359_13850_14794 | 314 |
| 134 | 3300048909 | Ga0496106_0000807 | Ga0496106_0000807_16493_17437 | 314 |
| 135 | 3300048919 | Ga0496116_0175442 | Ga0496116_0175442_23_967 | 314 |
| 136 | 3300048920 | Ga0496117_0007810 | Ga0496117_0007810_2392_3336 | 314 |
| 137 | 3300048921 | Ga0496118_0000714 | Ga0496118_0000714_13161_14105 | 314 |
| 138 | 3300048921 | Ga0496118_0003985 | Ga0496118_0003985_2969_3913 | 314 |
| 139 | 3300048924 | Ga0496121_0000829 | Ga0496121_0000829_42196_43140 | 314 |
| 140 | 3300048924 | Ga0496121_0001307 | Ga0496121_0001307_13429_14373 | 314 |
| 141 | 3300048924 | Ga0496121_0001580 | Ga0496121_0001580_5254_6198 | 314 |
| 142 | 3300048924 | Ga0496121_0098983 | Ga0496121_0098983_76_1020 | 314 |
| 143 | 3300048925 | Ga0496122_0005001 | Ga0496122_0005001_8609_9553 | 314 |
| 144 | 3300048926 | Ga0496123_0005702 | Ga0496123_0005702_6755_7699 | 314 |
| 145 | 3300048926 | Ga0496123_0031147 | Ga0496123_0031147_2922_3866 | 314 |
| 146 | 3300048926 | Ga0496123_0100356 | Ga0496123_0100356_146_1090 | 314 |
| 147 | 3300048928 | Ga0496125_0002397 | Ga0496125_0002397_12440_13384 | 314 |
| 148 | 3300048929 | Ga0496126_0186768 | Ga0496126_0186768_642_1586 | 314 |
| 149 | 3300049459 | Ga0495678_000026 | Ga0495678_000026_224241_225185 | 314 |
| 150 | 3300049460 | Ga0495682_0010675 | Ga0495682_0010675_1794_2738 | 314 |
| 151 | 3300049568 | Ga0501031_0076003 | Ga0501031_0076003_103_1047 | 314 |
| 152 | 3300050516 | nmdc:mga0sz30_112410_c1 | nmdc:mga0sz30_112410_c1_220_1164 | 314 |
| 153 | 3300053087 | Ga0500643_000138 | Ga0500643_000138_12737_13681 | 314 |
| 154 | 3300053103 | Ga0500555_000108 | Ga0500555_000108_17448_18392 | 314 |
| 155 | 3300053160 | Ga0500633_0080410 | Ga0500633_0080410_76_1020 | 314 |
| 156 | 3300002737 | JGI25162J39368_1002571 | JGI25162J39368_10025714 | 315 |
| 157 | 3300002741 | JGI25157J39369_1000818 | JGI25157J39369_10008187 | 315 |
| 158 | 3300003762 | Ga0055542_1000247 | Ga0055542_10002474 | 315 |
| 159 | 3300005336 | Ga0070680_100041772 | Ga0070680_1000417721 | 315 |
| 160 | 3300005340 | Ga0070689_100006866 | Ga0070689_1000068666 | 315 |
| 161 | 3300005344 | Ga0070661_100045305 | Ga0070661_1000453053 | 315 |
| 162 | 3300005539 | Ga0068853_100059625 | Ga0068853_1000596251 | 315 |
| 163 | 3300005546 | Ga0070696_100244229 | Ga0070696_1002442291 | 315 |
| 164 | 3300005578 | Ga0068854_100048632 | Ga0068854_1000486323 | 315 |
| 165 | 3300005843 | Ga0068860_100064818 | Ga0068860_1000648181 | 315 |
| 166 | 3300005844 | Ga0068862_100031871 | Ga0068862_1000318714 | 315 |
| 167 | 3300009093 | Ga0105240_10111342 | Ga0105240_101113423 | 315 |
| 168 | 3300009545 | Ga0105237_10000036 | Ga0105237_10000036143 | 315 |
| 169 | 3300009551 | Ga0105238_10145909 | Ga0105238_101459093 | 315 |
| 170 | 3300013306 | Ga0163162_10202123 | Ga0163162_102021231 | 315 |
| 171 | 3300014497 | Ga0182008_10077107 | Ga0182008_100771072 | 315 |
| 172 | 3300014497 | Ga0182008_10161955 | Ga0182008_101619552 | 315 |
| 173 | 3300014969 | Ga0157376_10013121 | Ga0157376_100131215 | 315 |
| 174 | 3300015261 | Ga0182006_1016880 | Ga0182006_10168803 | 315 |
| 175 | 3300015262 | Ga0182007_10005469 | Ga0182007_100054696 | 315 |
| 176 | 3300020070 | Ga0206356_10082985 | Ga0206356_100829853 | 315 |
| 177 | 3300020082 | Ga0206353_11142836 | Ga0206353_111428364 | 315 |
| 178 | 3300025225 | Ga0209566_102797 | Ga0209566_1027973 | 315 |
| 179 | 3300025226 | Ga0209674_101763 | Ga0209674_1017637 | 315 |
| 180 | 3300025228 | Ga0209672_100407 | Ga0209672_10040712 | 315 |
| 181 | 3300025231 | Ga0207427_103267 | Ga0207427_1032674 | 315 |
| 182 | 3300025233 | Ga0209437_100382 | Ga0209437_1003824 | 315 |
| 183 | 3300025233 | Ga0209437_101296 | Ga0209437_1012968 | 315 |
| 184 | 3300025242 | Ga0209258_102718 | Ga0209258_1027182 | 315 |
| 185 | 3300025250 | Ga0209026_1000119 | Ga0209026_100011984 | 315 |
| 186 | 3300025250 | Ga0209026_1000206 | Ga0209026_100020669 | 315 |
| 187 | 3300025250 | Ga0209026_1004776 | Ga0209026_10047762 | 315 |
| 188 | 3300025254 | Ga0209148_1000055 | Ga0209148_1000055241 | 315 |
| 189 | 3300025256 | Ga0209759_1001926 | Ga0209759_10019262 | 315 |
| 190 | 3300025256 | Ga0209759_1009613 | Ga0209759_10096132 | 315 |
| 191 | 3300025261 | Ga0209233_1020339 | Ga0209233_10203392 | 315 |
| 192 | 3300025261 | Ga0209233_1023614 | Ga0209233_10236142 | 315 |
| 193 | 3300025272 | Ga0209455_1000318 | Ga0209455_100031812 | 315 |
| 194 | 3300025913 | Ga0207695_10000938 | Ga0207695_1000093824 | 315 |
| 195 | 3300025914 | Ga0207671_10004404 | Ga0207671_1000440413 | 315 |
| 196 | 3300025936 | Ga0207670_10008701 | Ga0207670_100087016 | 315 |
| 197 | 3300025949 | Ga0207667_10008815 | Ga0207667_100088157 | 315 |
| 198 | 3300041443 | Ga0451789_0781782 | Ga0451789_0781782_126_1073 | 315 |
| 199 | 3300044672 | Ga0466982_0000027 | Ga0466982_0000027_22981_23928 | 315 |
| 200 | 3300044842 | Ga0466957_0049386 | Ga0466957_0049386_1568_2515 | 315 |
| 201 | 3300046460 | Ga0495638_0000458 | Ga0495638_0000458_15549_16496 | 315 |
| 202 | 3300046507 | Ga0495606_0000923 | Ga0495606_0000923_2741_3742 | 315 |
| 203 | 3300046557 | Ga0495622_0012896 | Ga0495622_0012896_253_1254 | 315 |
| 204 | 3300046660 | Ga0495625_0132658 | Ga0495625_0132658_261_1208 | 315 |
| 205 | 3300046694 | Ga0495649_0109463 | Ga0495649_0109463_306_1253 | 315 |
| 206 | 3300048918 | Ga0496115_0001580 | Ga0496115_0001580_2586_3587 | 315 |
| 207 | 3300048929 | Ga0496126_0085834 | Ga0496126_0085834_1678_2625 | 315 |
| 208 | 3300049459 | Ga0495678_022531 | Ga0495678_022531_1154_2155 | 315 |
| 209 | 3300049580 | Ga0501046_0018316 | Ga0501046_0018316_4795_5742 | 315 |
| 210 | 3300049822 | Ga0501035_0004859 | Ga0501035_0004859_3227_4186 | 315 |
| 211 | 3300049823 | Ga0501044_0027291 | Ga0501044_0027291_2202_3161 | 315 |
| 212 | 3300005455 | Ga0070663_100042756 | Ga0070663_1000427563 | 316 |
| 213 | 3300005458 | Ga0070681_10000008 | Ga0070681_1000000825 | 316 |
| 214 | 3300013100 | Ga0157373_10188224 | Ga0157373_101882242 | 316 |
| 215 | 3300025912 | Ga0207707_10000442 | Ga0207707_1000044222 | 316 |
| 216 | 3300041452 | Ga0451793_0776588 | Ga0451793_0776588_603_1556 | 316 |
| 217 | 3300042438 | Ga0439459_0000749 | Ga0439459_0000749_358_1311 | 316 |
| 218 | 3300046460 | Ga0495638_0000090 | Ga0495638_0000090_64630_65583 | 316 |
| 219 | 3300048921 | Ga0496118_0223701 | Ga0496118_0223701_98_1051 | 317 |
| 220 | 3300049570 | Ga0501033_0078521 | Ga0501033_0078521_1262_2215 | 317 |
| 221 | 3300049571 | Ga0501034_0007072 | Ga0501034_0007072_8043_8996 | 317 |
| 222 | 3300049572 | Ga0501036_0271327 | Ga0501036_0271327_243_1196 | 317 |
| 223 | 3300049573 | Ga0501037_0007967 | Ga0501037_0007967_1791_2744 | 317 |
| 224 | 3300049579 | Ga0501043_0013549 | Ga0501043_0013549_2978_3931 | 317 |
| 225 | 3300049586 | Ga0501070_0015983 | Ga0501070_0015983_4410_5363 | 317 |
| 226 | 3300049822 | Ga0501035_0038906 | Ga0501035_0038906_582_1535 | 317 |
| 227 | 3300049823 | Ga0501044_0025524 | Ga0501044_0025524_235_1188 | 317 |
| 228 | 3300005563 | Ga0068855_100173957 | Ga0068855_1001739572 | 318 |
| 229 | 3300025949 | Ga0207667_10215497 | Ga0207667_102154972 | 318 |
| 230 | 3300026041 | Ga0207639_10002808 | Ga0207639_100028082 | 318 |
| 231 | 3300048928 | Ga0496125_0003619 | Ga0496125_0003619_85_1068 | 319 |
| 232 | iso_pu_bacteria | 2846037992 | 2846040658 | 322 |
| 233 | 3300005546 | Ga0070696_100007799 | Ga0070696_1000077992 | 324 |
| 234 | 3300028017 | Ga0265356_1002071 | Ga0265356_10020712 | 324 |
| 235 | 3300031730 | Ga0307516_10000530 | Ga0307516_1000053027 | 324 |
| 236 | 3300042876 | Ga0451577_0036489 | Ga0451577_0036489_903_1877 | 324 |
| 237 | 3300044712 | Ga0453684_0033909 | Ga0453684_0033909_981_1955 | 324 |
| 238 | 3300045051 | Ga0451576_0037205 | Ga0451576_0037205_119_1093 | 324 |
| 239 | iso_pu_bacteria | 2524614729 | 2525557035 | 324 |
| 240 | iso_pu_bacteria | 2627854209 | 2630648631 | 324 |
| 241 | 3300005367 | Ga0070667_100089719 | Ga0070667_1000897192 | 325 |
| 242 | 3300007265 | Ga0099794_10004440 | Ga0099794_100044403 | 325 |
| 243 | 3300007788 | Ga0099795_10007094 | Ga0099795_100070943 | 325 |
| 244 | 3300010159 | Ga0099796_10000269 | Ga0099796_100002692 | 325 |
| 245 | 3300025916 | Ga0207663_10037328 | Ga0207663_100373283 | 325 |
| 246 | 3300025928 | Ga0207700_10006574 | Ga0207700_100065741 | 325 |
| 247 | 3300025986 | Ga0207658_10158380 | Ga0207658_101583802 | 325 |
| 248 | 3300042876 | Ga0451577_0008296 | Ga0451577_0008296_3405_4388 | 325 |
| 249 | 3300044673 | Ga0453683_0153344 | Ga0453683_0153344_456_1439 | 325 |
| 250 | 3300044712 | Ga0453684_0118165 | Ga0453684_0118165_483_1466 | 325 |
| 251 | 3300005354 | Ga0070675_100212832 | Ga0070675_1002128322 | 326 |
| 252 | 3300005539 | Ga0068853_100048342 | Ga0068853_1000483423 | 326 |
| 253 | 3300005577 | Ga0068857_100285692 | Ga0068857_1002856922 | 326 |
| 254 | 3300013297 | Ga0157378_10015875 | Ga0157378_100158754 | 326 |
| 255 | 3300025923 | Ga0207681_10056628 | Ga0207681_100566282 | 326 |
| 256 | 3300025926 | Ga0207659_10428379 | Ga0207659_104283791 | 326 |
| 257 | 3300031727 | Ga0316576_10018262 | Ga0316576_100182622 | 326 |
| 258 | 3300031728 | Ga0316578_10020597 | Ga0316578_100205972 | 326 |
| 259 | 3300039447 | Ga0436361_0378193 | Ga0436361_0378193_636_1640 | 326 |
| 260 | 3300044712 | Ga0453684_0000615 | Ga0453684_0000615_8304_9293 | 326 |
| 261 | 3300045051 | Ga0451576_0000201 | Ga0451576_0000201_8304_9293 | 326 |
| 262 | 3300005436 | Ga0070713_100000090 | Ga0070713_10000009037 | 327 |
| 263 | 3300025928 | Ga0207700_10000065 | Ga0207700_1000006510 | 327 |
| 264 | 2162886007 | SwRhRL2b_contig_2001396 | SwRhRL2b_0998.00004380 | 328 |
| 265 | 3300031251 | Ga0265327_10000348 | Ga0265327_1000034870 | 328 |
| 266 | 3300031344 | Ga0265316_10010846 | Ga0265316_100108463 | 328 |
| 267 | 3300032139 | Ga0316580_10035870 | Ga0316580_100358702 | 328 |
| 268 | 3300044673 | Ga0453683_0245356 | Ga0453683_0245356_111_1127 | 328 |
| 269 | 3300044712 | Ga0453684_0000833 | Ga0453684_0000833_87725_88723 | 328 |
| 270 | 3300044712 | Ga0453684_0143854 | Ga0453684_0143854_179_1177 | 328 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zyl-assembly1.cif.gz_A | crystal structure of hypothetical protein yihe from escherichia coli | 0.9573 | 7 | 327 |
| 1zyl-assembly1.cif.gz_A | crystal structure of hypothetical protein yihe from escherichia coli | 0.9344 | 7 | 327 |
| 6sun-assembly1.cif.gz_A | amicoumacin kinase hamin in complex with amp-pnp, ca2+ and ami | 0.7573 | 17 | 313 |
| 6sul-assembly2.cif.gz_D | amicoumacin kinase amin in complex with amp-pnp, mg2+ and ami | 0.7524 | 21 | 328 |
| 6sv5-assembly1.cif.gz_A | amicoumacin kinase amin in complex with atp | 0.7508 | 21 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0C0K3_149_318_1.20.1270.170 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.9719 | 155 | 324 | 1.20.1270.170 |
| af_P0C0K3_17_108_3.30.200.70 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; | 0.9661 | 21 | 111 | 3.30.200.70 |
| 1zylA02 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9523 | 64 | 264 | 1.10.510.10 |
| af_P0C0K3_149_318_1.20.1270.170 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.9496 | 155 | 324 | 1.20.1270.170 |
| af_P0C0K3_17_108_3.30.200.70 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; | 0.9459 | 21 | 111 | 3.30.200.70 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar