F376939

General Info

Members Datasets Scaffolds Average Seq Length
270 143 540 68

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_11120859|Ga0157370_111208591
Length 80
Sequence VEILWILPSDHTAGMDWPAPLTAREVAAELGCSVDDVRALIREGELQTVSCGIRPGLIPRHIVDAYLRRLEHRRRSSATH

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
68 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 2.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.63
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 25.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_11120859 3300013104 Unclassified 711
2 Ga0070683_100243103 3300005329 Bacteria 1712
3 Ga0070683_101306700 3300005329 Bacteria 697
4 Ga0070680_100023440 3300005336 Bacteria 4923
5 Ga0070680_100184985 3300005336 Bacteria 1755
6 Ga0070691_10072593 3300005341 Bacteria 1672
7 Ga0070673_101614075 3300005364 Bacteria 613
8 Ga0070659_101855661 3300005366 Unclassified 540
9 Ga0070709_10016028 3300005434 Bacteria 4271
10 Ga0070714_100045268 3300005435 Bacteria 3729
11 Ga0070714_100259542 3300005435 Bacteria 1609
12 Ga0070714_101013282 3300005435 Bacteria 808
13 Ga0070714_101085800 3300005435 Unclassified 780
14 Ga0070713_100017890 3300005436 Bacteria 5376
15 Ga0070713_101109083 3300005436 Bacteria 765
16 Ga0070710_10001892 3300005437 Bacteria 9901
17 Ga0070710_10186484 3300005437 Unclassified 1302
18 Ga0070711_100021211 3300005439 Bacteria 4196
19 Ga0070705_100434537 3300005440 Bacteria 981
20 Ga0070694_100156389 3300005444 Bacteria 1669
21 Ga0070663_101106760 3300005455 Unclassified 693
22 Ga0070681_10034546 3300005458 Bacteria 5076
23 Ga0070681_10096036 3300005458 Bacteria 2912
24 Ga0070681_10293482 3300005458 Bacteria 1536
25 Ga0068867_101833968 3300005459 Unclassified 571
26 Ga0070679_100014539 3300005530 Bacteria 7561
27 Ga0070679_100019606 3300005530 Bacteria 6581
28 Ga0070679_100105826 3300005530 Bacteria 2799
29 Ga0070679_100113248 3300005530 Bacteria 2698
30 Ga0070679_100249139 3300005530 Unclassified 1733
31 Ga0070679_100319963 3300005530 Bacteria 1501
32 Ga0070679_100334383 3300005530 Bacteria 1463
33 Ga0070679_100619256 3300005530 Bacteria 1026
34 Ga0070684_100054191 3300005535 Bacteria 3494
35 Ga0070684_100106693 3300005535 Bacteria 2508
36 Ga0068853_100796660 3300005539 Unclassified 905
37 Ga0068853_100981322 3300005539 Unclassified 813
38 Ga0068853_101421435 3300005539 Unclassified 671
39 Ga0070672_101766364 3300005543 Archaea 556
40 Ga0070686_100106964 3300005544 Bacteria 1899
41 Ga0070696_100856952 3300005546 Unclassified 751
42 Ga0070693_100023252 3300005547 Bacteria 3310
43 Ga0070665_101779696 3300005548 Unclassified 623
44 Ga0068855_100649126 3300005563 Bacteria 1133
45 Ga0068855_100795308 3300005563 Bacteria 1006
46 Ga0068855_100815980 3300005563 Bacteria 991
47 Ga0068856_102405031 3300005614 Unclassified 534
48 Ga0068852_100121474 3300005616 Bacteria 2392
49 Ga0068852_100589664 3300005616 Bacteria 1115
50 Ga0070717_10018502 3300006028 Bacteria 5440
51 Ga0070717_10070117 3300006028 Bacteria 2920
52 Ga0070717_10126116 3300006028 Bacteria 2198
53 Ga0070715_10000853 3300006163 Bacteria 8390
54 Ga0070716_100006789 3300006173 Bacteria 5609
55 Ga0070712_100043649 3300006175 Bacteria 3087
56 Ga0070712_100110789 3300006175 Bacteria 2048
57 Ga0097621_101730276 3300006237 Unclassified 595
58 Ga0105240_10282567 3300009093 Bacteria 1906
59 Ga0105240_10793587 3300009093 Bacteria 1026
60 Ga0105241_10075862 3300009174 Bacteria 2620
61 Ga0157373_10327871 3300013100 Unclassified 1090
62 Ga0157370_10169892 3300013104 Bacteria 2027
63 Ga0157370_11444657 3300013104 Unclassified 619
64 Ga0157369_10002320 3300013105 Bacteria 22898
65 Ga0157369_10142011 3300013105 Bacteria 2540
66 Ga0157369_10338249 3300013105 Bacteria 1564
67 Ga0157369_10795607 3300013105 Bacteria 972
68 Ga0157369_12556824 3300013105 Unclassified 517
69 Ga0157372_10839300 3300013307 Bacteria 1067
70 Ga0157372_10918242 3300013307 Bacteria 1015
71 Ga0157372_11131192 3300013307 Unclassified 906
72 Ga0182008_10009960 3300014497 Bacteria 5107
73 Ga0182007_10018643 3300015262 Bacteria 2511
74 Ga0206356_10516071 3300020070 Bacteria 820
75 Ga0206356_10813453 3300020070 Bacteria 1256
76 Ga0206356_11720951 3300020070 Bacteria 1674
77 Ga0206352_11325572 3300020078 Unclassified 699
78 Ga0206354_10139990 3300020081 Archaea 2500
79 Ga0206353_11136636 3300020082 Bacteria 4942
80 Ga0206353_11411515 3300020082 Bacteria 3130
81 Ga0206353_11584358 3300020082 Bacteria 1066
82 Ga0207692_10013720 3300025898 Bacteria 3522
83 Ga0207692_10187048 3300025898 Unclassified 1210
84 Ga0207692_11112692 3300025898 Unclassified 523
85 Ga0207685_10003702 3300025905 Bacteria 3763
86 Ga0207699_10046406 3300025906 Bacteria 2541
87 Ga0207705_10454674 3300025909 Bacteria 993
88 Ga0207654_10100737 3300025911 Bacteria 1779
89 Ga0207707_10318306 3300025912 Bacteria 1344
90 Ga0207693_10000686 3300025915 Bacteria 30354
91 Ga0207663_10019308 3300025916 Bacteria 3836
92 Ga0207663_11164957 3300025916 Unclassified 620
93 Ga0207660_10419331 3300025917 Unclassified 1079
94 Ga0207660_11333989 3300025917 Unclassified 582
95 Ga0207657_10834601 3300025919 Bacteria 712
96 Ga0207652_10222720 3300025921 Unclassified 1700
97 Ga0207652_10409408 3300025921 Bacteria 1223
98 Ga0207652_10538275 3300025921 Unclassified 1050
99 Ga0207652_10758355 3300025921 Bacteria 863
100 Ga0207646_10879320 3300025922 Bacteria 796
101 Ga0207700_10028544 3300025928 Bacteria 3924
102 Ga0207700_10183135 3300025928 Bacteria 1755
103 Ga0207664_10003122 3300025929 Bacteria 11003
104 Ga0207664_10040444 3300025929 Bacteria 3626
105 Ga0207644_11012884 3300025931 Unclassified 697
106 Ga0207665_10000521 3300025939 Bacteria 26018
107 Ga0207661_10053907 3300025944 Bacteria 3220
108 Ga0207661_10117791 3300025944 Bacteria 2257
109 Ga0207661_10452664 3300025944 Unclassified 1169
110 Ga0207667_11094413 3300025949 Bacteria 780
111 Ga0207667_11139953 3300025949 Unclassified 761
112 Ga0207639_10612729 3300026041 Unclassified 1005
113 Ga0207648_11036524 3300026089 Unclassified 769
114 Ga0207698_10216116 3300026142 Unclassified 1729
115 Ga0268266_11181458 3300028379 Unclassified 740
116 Ga0265338_10001558 3300028800 Bacteria 37008
117 Ga0265338_10011492 3300028800 Bacteria 10221
118 Ga0373951_0200312 3300035091 Unclassified 581
119 Ga0373939_0267528 3300035114 Unclassified 671
120 Ga0373953_0105851 3300035117 Bacteria 1187
121 Ga0373954_0143091 3300035118 Bacteria 1167
122 Ga0373955_0248431 3300035172 Bacteria 1066
123 Ga0373931_0129428 3300035691 Bacteria 1451
124 Ga0373933_0274712 3300035724 Bacteria 1088
125 Ga0373937_0171895 3300036401 Bacteria 2033
126 Ga0395899_0739177 3300037312 Unclassified 613
127 Ga0395899_0859679 3300037312 Bacteria 556
128 Ga0395900_0167015 3300037418 Bacteria 2242
129 Ga0395900_0357909 3300037418 Unclassified 1431
130 Ga0395900_1554805 3300037418 Bacteria 573
131 Ga0395898_0119694 3300037466 Bacteria 2522
132 Ga0395898_0291662 3300037466 Bacteria 1556
133 Ga0395898_0348257 3300037466 Bacteria 1413
134 Ga0395898_0435584 3300037466 Bacteria 1249
135 Ga0395898_0754909 3300037466 Unclassified 914
136 Ga0395905_0020592 3300037471 Bacteria 6245
137 Ga0395905_0527415 3300037471 Bacteria 1081
138 Ga0395905_0757051 3300037471 Unclassified 874
139 Ga0395901_0172156 3300038443 Bacteria 2271
140 Ga0395901_0313116 3300038443 Bacteria 1625
141 Ga0395901_0530766 3300038443 Bacteria 1195
142 Ga0466965_0462074 3300044683 Bacteria 708
143 Ga0466961_0066499 3300044693 Bacteria 2290
144 Ga0466961_0459711 3300044693 Bacteria 770
145 Ga0466963_0038827 3300044694 Unclassified 3116
146 Ga0466964_0106489 3300044706 Bacteria 1244
147 Ga0466964_0163320 3300044706 Bacteria 1043
148 Ga0466964_0175476 3300044706 Unclassified 1012
149 Ga0466964_0376223 3300044706 Bacteria 736
150 Ga0466971_0018993 3300044719 Bacteria 3050
151 Ga0466968_0414356 3300044735 Bacteria 662
152 Ga0466957_0014996 3300044842 Bacteria 4522
153 Ga0466957_0175330 3300044842 Bacteria 1398
154 Ga0466960_1008584 3300044901 Bacteria 512
155 Ga0466959_0013155 3300045049 Bacteria 5994
156 Ga0466959_0237204 3300045049 Bacteria 1261
157 Ga0466959_0293110 3300045049 Bacteria 1115
158 Ga0466958_0008040 3300045836 Bacteria 5832
159 Ga0466958_0014931 3300045836 Bacteria 4441
160 Ga0466958_0048763 3300045836 Bacteria 2561
161 Ga0466958_0430511 3300045836 Bacteria 853
162 Ga0466958_0832046 3300045836 Bacteria 602
163 Ga0466967_0002544 3300045976 Bacteria 11425
164 Ga0466967_0009791 3300045976 Bacteria 7147
165 Ga0466967_0009823 3300045976 Bacteria 7138
166 Ga0466967_0013566 3300045976 Bacteria 6303
167 Ga0466967_0017976 3300045976 Bacteria 5636
168 Ga0466967_0041095 3300045976 Bacteria 3984
169 Ga0466967_0065640 3300045976 Bacteria 3231
170 Ga0466967_0189177 3300045976 Bacteria 1945
171 Ga0466967_0227520 3300045976 Unclassified 1775
172 Ga0466967_0262095 3300045976 Bacteria 1654
173 Ga0466967_0352849 3300045976 Unclassified 1424
174 Ga0466967_0418960 3300045976 Unclassified 1305
175 Ga0466967_0817799 3300045976 Bacteria 925
176 Ga0466967_1367718 3300045976 Bacteria 705
177 Ga0495592_0079492 3300046454 Bacteria 2374
178 Ga0495592_0141903 3300046454 Bacteria 1670
179 Ga0495629_0514797 3300046459 Unclassified 806
180 Ga0495651_0203119 3300046462 Bacteria 1385
181 Ga0495651_0343360 3300046462 Bacteria 988
182 Ga0495651_0782508 3300046462 Bacteria 590
183 Ga0495653_0629694 3300046463 Bacteria 657
184 Ga0495664_0275369 3300046477 Bacteria 1017
185 Ga0495608_0047804 3300046511 Bacteria 2843
186 Ga0495618_0031761 3300046514 Unclassified 3306
187 Ga0495628_0170613 3300046516 Bacteria 1650
188 Ga0495652_0076874 3300046529 Bacteria 2768
189 Ga0495652_0361380 3300046529 Unclassified 1037
190 Ga0495652_0453407 3300046529 Unclassified 897
191 Ga0495587_0041217 3300046536 Bacteria 2755
192 Ga0495587_0298001 3300046536 Bacteria 902
193 Ga0495587_0638794 3300046536 Unclassified 585
194 Ga0495645_0473611 3300046543 Bacteria 786
195 Ga0495667_0167670 3300046559 Bacteria 1411
196 Ga0495667_0572848 3300046559 Bacteria 704
197 Ga0495634_0299174 3300046642 Bacteria 973
198 Ga0495635_0876540 3300046663 Unclassified 576
199 Ga0495657_0521110 3300046675 Unclassified 692
200 Ga0495657_0660170 3300046675 Bacteria 603
201 Ga0495657_0786681 3300046675 Unclassified 544
202 Ga0495657_0845465 3300046675 Bacteria 522
203 Ga0495599_0083316 3300046678 Bacteria 1997
204 Ga0495599_0332217 3300046678 Bacteria 913
205 Ga0495599_0494195 3300046678 Bacteria 721
206 Ga0495599_0643296 3300046678 Unclassified 615
207 Ga0495623_0191127 3300046679 Unclassified 1183
208 Ga0495646_0037626 3300046680 Bacteria 2992
209 Ga0495646_0678631 3300046680 Bacteria 519
210 Ga0495613_0736472 3300046689 Unclassified 647
211 Ga0495624_0035267 3300046690 Bacteria 3230
212 Ga0495624_0374591 3300046690 Bacteria 856
213 Ga0495600_0338607 3300046809 Bacteria 943
214 Ga0495604_0021252 3300047317 Bacteria 5181
215 Ga0495604_0374295 3300047317 Bacteria 942
216 Ga0495674_0717025 3300047319 Bacteria 784
217 Ga0495674_0821284 3300047319 Unclassified 722
218 Ga0495680_0090871 3300047322 Bacteria 2289
219 Ga0495680_0120269 3300047322 Bacteria 1939
220 Ga0495680_0453875 3300047322 Bacteria 877
221 Ga0495680_0709465 3300047322 Unclassified 664
222 Ga0495675_0121074 3300047444 Bacteria 1630
223 Ga0495684_0115069 3300047471 Bacteria 2028
224 Ga0495684_0223232 3300047471 Bacteria 1381
225 Ga0495602_0054890 3300048088 Bacteria 3513
226 Ga0496100_0182422 3300048903 Bacteria 1518
227 Ga0496101_0043306 3300048904 Bacteria 3217
228 Ga0496102_0020161 3300048905 Bacteria 5887
229 Ga0496102_0247538 3300048905 Bacteria 1680
230 Ga0496103_0026847 3300048906 Bacteria 3485
231 Ga0496103_0040707 3300048906 Bacteria 2855
232 Ga0496103_0411220 3300048906 Unclassified 869
233 Ga0496105_0081464 3300048908 Bacteria 2673
234 Ga0496106_0177210 3300048909 Bacteria 1691
235 Ga0496107_0149939 3300048910 Bacteria 1724
236 Ga0496107_0835815 3300048910 Unclassified 673
237 Ga0496108_0041965 3300048911 Bacteria 3818
238 Ga0496108_1408725 3300048911 Unclassified 583
239 Ga0496109_0088203 3300048912 Bacteria 2866
240 Ga0496109_0398061 3300048912 Bacteria 1301
241 Ga0496109_1684526 3300048912 Bacteria 568
242 Ga0496109_1791655 3300048912 Unclassified 547
243 Ga0496112_0001478 3300048915 Bacteria 18056
244 Ga0496112_0062785 3300048915 Bacteria 3665
245 Ga0496112_0252202 3300048915 Bacteria 1715
246 Ga0496112_1640680 3300048915 Unclassified 556
247 Ga0496113_0040452 3300048916 Bacteria 3436
248 Ga0496114_0035753 3300048917 Bacteria 4103
249 Ga0496114_0294998 3300048917 Unclassified 1431
250 Ga0496115_0098331 3300048918 Bacteria 2396
251 Ga0496115_0207479 3300048918 Bacteria 1618
252 Ga0501047_0885344 3300049581 Bacteria 706
253 Ga0501067_0128102 3300049583 Bacteria 1412
254 Ga0501067_0474091 3300049583 Unclassified 699
255 Ga0501069_0236990 3300049585 Bacteria 1063
256 Ga0501069_0359894 3300049585 Bacteria 858
257 Ga0501073_0308188 3300049589 Bacteria 1092
258 Ga0501074_0363933 3300049590 Unclassified 1026
259 Ga0501035_0347933 3300049822 Unclassified 1241
260 Ga0501044_0243627 3300049823 Bacteria 1741
261 nmdc:mga0n895_1477756_c1 3300050512 Unclassified 646
262 Ga0495601_0040283 3300053077 Bacteria 2926
263 Ga0495601_0041702 3300053077 Bacteria 2878
264 Ga0495601_0780624 3300053077 Unclassified 607
265 Ga0495595_0008177 3300053084 Bacteria 4293
266 Ga0495595_0029190 3300053084 Bacteria 2467
267 Ga0495619_0057275 3300053085 Bacteria 2586
268 Ga0495619_0985044 3300053085 Unclassified 564
269 Ga0466962_0421773 3300061719 Bacteria 670
270 Ga0530510_1052328 3300061734 Bacteria 623
271 Ga0157370_11120859
272 Ga0070683_100243103
273 Ga0070683_101306700
274 Ga0070680_100023440
275 Ga0070680_100184985
276 Ga0070691_10072593
277 Ga0070673_101614075
278 Ga0070659_101855661
279 Ga0070709_10016028
280 Ga0070714_100045268
281 Ga0070714_100259542
282 Ga0070714_101013282
283 Ga0070714_101085800
284 Ga0070713_100017890
285 Ga0070713_101109083
286 Ga0070710_10001892
287 Ga0070710_10186484
288 Ga0070711_100021211
289 Ga0070705_100434537
290 Ga0070694_100156389
291 Ga0070663_101106760
292 Ga0070681_10034546
293 Ga0070681_10096036
294 Ga0070681_10293482
295 Ga0068867_101833968
296 Ga0070679_100014539
297 Ga0070679_100019606
298 Ga0070679_100105826
299 Ga0070679_100113248
300 Ga0070679_100249139
301 Ga0070679_100319963
302 Ga0070679_100334383
303 Ga0070679_100619256
304 Ga0070684_100054191
305 Ga0070684_100106693
306 Ga0068853_100796660
307 Ga0068853_100981322
308 Ga0068853_101421435
309 Ga0070672_101766364
310 Ga0070686_100106964
311 Ga0070696_100856952
312 Ga0070693_100023252
313 Ga0070665_101779696
314 Ga0068855_100649126
315 Ga0068855_100795308
316 Ga0068855_100815980
317 Ga0068856_102405031
318 Ga0068852_100121474
319 Ga0068852_100589664
320 Ga0070717_10018502
321 Ga0070717_10070117
322 Ga0070717_10126116
323 Ga0070715_10000853
324 Ga0070716_100006789
325 Ga0070712_100043649
326 Ga0070712_100110789
327 Ga0097621_101730276
328 Ga0105240_10282567
329 Ga0105240_10793587
330 Ga0105241_10075862
331 Ga0157373_10327871
332 Ga0157370_10169892
333 Ga0157370_11444657
334 Ga0157369_10002320
335 Ga0157369_10142011
336 Ga0157369_10338249
337 Ga0157369_10795607
338 Ga0157369_12556824
339 Ga0157372_10839300
340 Ga0157372_10918242
341 Ga0157372_11131192
342 Ga0182008_10009960
343 Ga0182007_10018643
344 Ga0206356_10516071
345 Ga0206356_10813453
346 Ga0206356_11720951
347 Ga0206352_11325572
348 Ga0206354_10139990
349 Ga0206353_11136636
350 Ga0206353_11411515
351 Ga0206353_11584358
352 Ga0207692_10013720
353 Ga0207692_10187048
354 Ga0207692_11112692
355 Ga0207685_10003702
356 Ga0207699_10046406
357 Ga0207705_10454674
358 Ga0207654_10100737
359 Ga0207707_10318306
360 Ga0207693_10000686
361 Ga0207663_10019308
362 Ga0207663_11164957
363 Ga0207660_10419331
364 Ga0207660_11333989
365 Ga0207657_10834601
366 Ga0207652_10222720
367 Ga0207652_10409408
368 Ga0207652_10538275
369 Ga0207652_10758355
370 Ga0207646_10879320
371 Ga0207700_10028544
372 Ga0207700_10183135
373 Ga0207664_10003122
374 Ga0207664_10040444
375 Ga0207644_11012884
376 Ga0207665_10000521
377 Ga0207661_10053907
378 Ga0207661_10117791
379 Ga0207661_10452664
380 Ga0207667_11094413
381 Ga0207667_11139953
382 Ga0207639_10612729
383 Ga0207648_11036524
384 Ga0207698_10216116
385 Ga0268266_11181458
386 Ga0265338_10001558
387 Ga0265338_10011492
388 Ga0373951_0200312
389 Ga0373939_0267528
390 Ga0373953_0105851
391 Ga0373954_0143091
392 Ga0373955_0248431
393 Ga0373931_0129428
394 Ga0373933_0274712
395 Ga0373937_0171895
396 Ga0395899_0739177
397 Ga0395899_0859679
398 Ga0395900_0167015
399 Ga0395900_0357909
400 Ga0395900_1554805
401 Ga0395898_0119694
402 Ga0395898_0291662
403 Ga0395898_0348257
404 Ga0395898_0435584
405 Ga0395898_0754909
406 Ga0395905_0020592
407 Ga0395905_0527415
408 Ga0395905_0757051
409 Ga0395901_0172156
410 Ga0395901_0313116
411 Ga0395901_0530766
412 Ga0466965_0462074
413 Ga0466961_0066499
414 Ga0466961_0459711
415 Ga0466963_0038827
416 Ga0466964_0106489
417 Ga0466964_0163320
418 Ga0466964_0175476
419 Ga0466964_0376223
420 Ga0466971_0018993
421 Ga0466968_0414356
422 Ga0466957_0014996
423 Ga0466957_0175330
424 Ga0466960_1008584
425 Ga0466959_0013155
426 Ga0466959_0237204
427 Ga0466959_0293110
428 Ga0466958_0008040
429 Ga0466958_0014931
430 Ga0466958_0048763
431 Ga0466958_0430511
432 Ga0466958_0832046
433 Ga0466967_0002544
434 Ga0466967_0009791
435 Ga0466967_0009823
436 Ga0466967_0013566
437 Ga0466967_0017976
438 Ga0466967_0041095
439 Ga0466967_0065640
440 Ga0466967_0189177
441 Ga0466967_0227520
442 Ga0466967_0262095
443 Ga0466967_0352849
444 Ga0466967_0418960
445 Ga0466967_0817799
446 Ga0466967_1367718
447 Ga0495592_0079492
448 Ga0495592_0141903
449 Ga0495629_0514797
450 Ga0495651_0203119
451 Ga0495651_0343360
452 Ga0495651_0782508
453 Ga0495653_0629694
454 Ga0495664_0275369
455 Ga0495608_0047804
456 Ga0495618_0031761
457 Ga0495628_0170613
458 Ga0495652_0076874
459 Ga0495652_0361380
460 Ga0495652_0453407
461 Ga0495587_0041217
462 Ga0495587_0298001
463 Ga0495587_0638794
464 Ga0495645_0473611
465 Ga0495667_0167670
466 Ga0495667_0572848
467 Ga0495634_0299174
468 Ga0495635_0876540
469 Ga0495657_0521110
470 Ga0495657_0660170
471 Ga0495657_0786681
472 Ga0495657_0845465
473 Ga0495599_0083316
474 Ga0495599_0332217
475 Ga0495599_0494195
476 Ga0495599_0643296
477 Ga0495623_0191127
478 Ga0495646_0037626
479 Ga0495646_0678631
480 Ga0495613_0736472
481 Ga0495624_0035267
482 Ga0495624_0374591
483 Ga0495600_0338607
484 Ga0495604_0021252
485 Ga0495604_0374295
486 Ga0495674_0717025
487 Ga0495674_0821284
488 Ga0495680_0090871
489 Ga0495680_0120269
490 Ga0495680_0453875
491 Ga0495680_0709465
492 Ga0495675_0121074
493 Ga0495684_0115069
494 Ga0495684_0223232
495 Ga0495602_0054890
496 Ga0496100_0182422
497 Ga0496101_0043306
498 Ga0496102_0020161
499 Ga0496102_0247538
500 Ga0496103_0026847
501 Ga0496103_0040707
502 Ga0496103_0411220
503 Ga0496105_0081464
504 Ga0496106_0177210
505 Ga0496107_0149939
506 Ga0496107_0835815
507 Ga0496108_0041965
508 Ga0496108_1408725
509 Ga0496109_0088203
510 Ga0496109_0398061
511 Ga0496109_1684526
512 Ga0496109_1791655
513 Ga0496112_0001478
514 Ga0496112_0062785
515 Ga0496112_0252202
516 Ga0496112_1640680
517 Ga0496113_0040452
518 Ga0496114_0035753
519 Ga0496114_0294998
520 Ga0496115_0098331
521 Ga0496115_0207479
522 Ga0501047_0885344
523 Ga0501067_0128102
524 Ga0501067_0474091
525 Ga0501069_0236990
526 Ga0501069_0359894
527 Ga0501073_0308188
528 Ga0501074_0363933
529 Ga0501035_0347933
530 Ga0501044_0243627
531 nmdc:mga0n895_1477756_c1
532 Ga0495601_0040283
533 Ga0495601_0041702
534 Ga0495601_0780624
535 Ga0495595_0008177
536 Ga0495595_0029190
537 Ga0495619_0057275
538 Ga0495619_0985044
539 Ga0466962_0421773
540 Ga0530510_1052328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12728

HTH_17

Helix-turn-helix domain

20

71

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.8775 4 52
6amk-assembly1.cif.gz_A structure of streptomyces venezuelae bldc-whii opt complex 0.8744 4 54
6ama-assembly1.cif.gz_A structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.8608 4 54
6amk-assembly1.cif.gz_A structure of streptomyces venezuelae bldc-whii opt complex 0.8451 4 54
8dgl-assembly1.cif.gz_B crystal structure of the rdfs excisionase 0.8419 4 55
ID Description Score Start End Superfamily
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9275 7 50 1.10.10.10
af_O53807_4_54_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9198 7 55 1.10.10.10
af_O53399_195_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8975 7 56 1.10.10.10
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8809 7 56 1.10.10.10
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.872 7 50 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C5M8A0-F1-model_v4 Helix-turn-helix domain-containing protein 0.946 5 60 GO:0003677
AF-A0A2N5KNJ3-F1-model_v4 DNA-binding protein 0.9398 6 64 GO:0003677
AF-A0A1P8F894-F1-model_v4 DNA binding domain-containing protein, excisionase family 0.9266 6 60 GO:0003677
GO:0006355
AF-A0A1F3RA96-F1-model_v4 Helix-turn-helix domain-containing protein 0.9231 5 57 GO:0003677
AF-I4CDS7-F1-model_v4 DNA-binding protein, excisionase family 0.9149 1 58 GO:0003677

Map