F376414

General Info

Members Datasets Scaffolds Average Seq Length
269 182 538 296

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0117956|Ga0466967_0117956_240_1274
Length 344
Sequence MRTSRFSSSATDAGASPKVKVKHAFPVPRPIVSLALDRTLDRTLIDPSYDRESAVPRIALATYDPGTEPSKDTDLPVLVRALTDAGARAEARYWDDPDADWAGYDLVVIRSTWDYSWRAAEFVAWLERVGKAARVANPADVVRWNTDKRYLGELAAAGVPTVPTRYIAPGEPAGLPDGHEYVIKPTSGAGARFAARYTPADHDTAVRHLERMHAEGFTAMVQPYLAGIDVTGERALQFFGGRLLHASRKGAVLSPGTPYDADKVAHPGLVPWRPTDAELAVAEKALAAVPGSAELLYARVDLADGEDGAPRLMELELIEPNLFLSLHPDSVPHVTEAILAAAEG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
15 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
24 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
25 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
26 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
27 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
30 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
31 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
32 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
33 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
34 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
35 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
36 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
37 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
38 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
39 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
40 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
41 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
42 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
43 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
44 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
50 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
51 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
52 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
53 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
54 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
58 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
59 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
60 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
65 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
66 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
67 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
68 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
69 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
72 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
73 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
74 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
78 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
98 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
109 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
136 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
137 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
140 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
141 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
142 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
143 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
144 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
145 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
146 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
147 2643221647 Streptomyces sp. Root369 Isolate Unclassified
148 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
149 2643221714 Streptomyces sp. Root264 Isolate Unclassified
150 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
151 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
152 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
153 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
154 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
155 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
156 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
157 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
158 2862574272 Streptomyces sp. AcE210 Isolate Nodule
159 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
160 2867428634 Streptomyces sp. RP5T Isolate Unclassified
161 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
162 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
163 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
164 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
165 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
166 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
167 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
168 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
169 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
170 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
171 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
172 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
173 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
174 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
175 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
176 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
177 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
178 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
179 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
180 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
181 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
182 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.9
Metatranscriptomes 0.74
Isolates 16.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 1.12
Rhizoplane 0.37
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0117956 3300045976 Bacteria 2447
2 rootH1_10000574 3300003316 Bacteria 12509
3 rootH2_10027226 3300003320 Bacteria 7050
4 rootH1_10005192 3300003323 Bacteria 3967
5 Ga0006562J51391_1071110 3300003578 Bacteria 3118
6 Ga0006562J51391_1071111 3300003578 Bacteria 2820
7 Ga0070681_10413280 3300005458 Bacteria 1261
8 Ga0068853_100033163 3300005539 Bacteria 4379
9 Ga0075365_10258965 3300006038 Bacteria 1223
10 Ga0075363_100044610 3300006048 Bacteria 2349
11 Ga0075370_10040283 3300006353 Bacteria 2635
12 Ga0105244_10046659 3300009036 Bacteria 2225
13 Ga0105238_10438771 3300009551 Bacteria 1302
14 Ga0105246_10058769 3300011119 Bacteria 2665
15 Ga0182006_1011939 3300015261 Bacteria 3803
16 Ga0207702_10063636 3300026078 Bacteria 3155
17 Ga0307517_10016170 3300028786 Bacteria 9827
18 Ga0307515_10000262 3300028794 Bacteria 130525
19 Ga0307515_10058435 3300028794 Bacteria 5554
20 Ga0307511_10000371 3300030521 Bacteria 47779
21 Ga0307511_10061974 3300030521 Bacteria 2844
22 Ga0307512_10021303 3300030522 Bacteria 5848
23 Ga0307513_10011380 3300031456 Bacteria 11061
24 Ga0307513_10054258 3300031456 Bacteria 4299
25 Ga0307509_10014940 3300031507 Bacteria 9093
26 Ga0307509_10032904 3300031507 Bacteria 5711
27 Ga0307509_10080775 3300031507 Bacteria 3361
28 Ga0307508_10007274 3300031616 Bacteria 10309
29 Ga0307514_10007286 3300031649 Bacteria 9537
30 Ga0307514_10061680 3300031649 Bacteria 2854
31 Ga0307514_10150963 3300031649 Bacteria 1559
32 Ga0307516_10016127 3300031730 Bacteria 7828
33 Ga0307516_10100963 3300031730 Bacteria 2701
34 Ga0307518_10093511 3300031838 Bacteria 2160
35 Ga0307507_10032140 3300033179 Bacteria 5488
36 Ga0307507_10048273 3300033179 Bacteria 4144
37 Ga0307510_10006445 3300033180 Bacteria 13991
38 Ga0307510_10035256 3300033180 Bacteria 5591
39 Ga0307510_10139069 3300033180 Bacteria 2077
40 Ga0395898_0007296 3300037466 Bacteria 11736
41 Ga0395898_0011971 3300037466 Bacteria 8979
42 Ga0395898_0039408 3300037466 Bacteria 4677
43 Ga0395901_0018978 3300038443 Bacteria 7031
44 Ga0439439_0003349 3300041406 Bacteria 3525
45 Ga0451853_0742859 3300041512 Bacteria 2696
46 Ga0439433_0003313 3300041999 Bacteria 3453
47 Ga0439449_0007844 3300042007 Bacteria 4053
48 Ga0439449_0027892 3300042007 Bacteria 2106
49 Ga0439457_001808 3300042014 Bacteria 6313
50 Ga0439457_013400 3300042014 Bacteria 1843
51 Ga0439462_0002034 3300042015 Bacteria 4637
52 Ga0450894_001140 3300042131 Bacteria 3978
53 Ga0450896_001608 3300042133 Bacteria 2811
54 Ga0450898_000163 3300042134 Bacteria 6897
55 Ga0450899_000434 3300042135 Bacteria 4670
56 Ga0450900_011336 3300042136 Bacteria 1157
57 Ga0450906_000467 3300042145 Bacteria 8486
58 Ga0439458_0003911 3300042157 Bacteria 3443
59 Ga0466972_0007829 3300044658 Bacteria 5360
60 Ga0466972_0038566 3300044658 Bacteria 2333
61 Ga0466972_0043066 3300044658 Bacteria 2193
62 Ga0466965_0000395 3300044683 Bacteria 14933
63 Ga0466965_0008939 3300044683 Bacteria 4645
64 Ga0466965_0029868 3300044683 Bacteria 2654
65 Ga0466966_0033114 3300044684 Bacteria 3346
66 Ga0466966_0041232 3300044684 Bacteria 2966
67 Ga0466961_0001902 3300044693 Bacteria 13009
68 Ga0466963_0003136 3300044694 Bacteria 9374
69 Ga0466963_0010296 3300044694 Bacteria 5658
70 Ga0466963_0018361 3300044694 Bacteria 4372
71 Ga0466971_0000739 3300044719 Bacteria 13092
72 Ga0466971_0064895 3300044719 Bacteria 1653
73 Ga0466971_0067659 3300044719 Bacteria 1619
74 Ga0466970_0000812 3300044765 Bacteria 15029
75 Ga0466970_0001472 3300044765 Bacteria 11372
76 Ga0466957_0001794 3300044842 Bacteria 11302
77 Ga0466957_0323746 3300044842 Bacteria 1041
78 Ga0466960_0034770 3300044901 Bacteria 2351
79 Ga0466959_0000872 3300045049 Bacteria 17781
80 Ga0466959_0185563 3300045049 Bacteria 1453
81 Ga0466958_0031637 3300045836 Bacteria 3145
82 Ga0466967_0022894 3300045976 Bacteria 5108
83 Ga0466967_0085739 3300045976 Bacteria 2852
84 Ga0466967_0483613 3300045976 Bacteria 1213
85 Ga0495592_0044023 3300046454 Bacteria 3337
86 Ga0495603_0019533 3300046455 Bacteria 4100
87 Ga0495629_0003665 3300046459 Bacteria 11612
88 Ga0495629_0040208 3300046459 Bacteria 3289
89 Ga0495629_0044867 3300046459 Bacteria 3102
90 Ga0495651_0002295 3300046462 Bacteria 14753
91 Ga0495651_0052462 3300046462 Bacteria 3141
92 Ga0495582_0009431 3300046473 Bacteria 5376
93 Ga0495582_0130974 3300046473 Bacteria 1417
94 Ga0495662_0002066 3300046476 Bacteria 10067
95 Ga0495664_0000991 3300046477 Bacteria 14616
96 Ga0495594_0022588 3300046499 Bacteria 3365
97 Ga0495594_0022612 3300046499 Bacteria 3363
98 Ga0495583_0101649 3300046506 Bacteria 1226
99 Ga0495606_0012934 3300046507 Bacteria 6642
100 Ga0495608_0049271 3300046511 Bacteria 2797
101 Ga0495618_0008359 3300046514 Bacteria 6264
102 Ga0495618_0064464 3300046514 Bacteria 2328
103 Ga0495620_0026440 3300046515 Bacteria 2729
104 Ga0495628_0033380 3300046516 Bacteria 4149
105 Ga0495630_0003823 3300046517 Bacteria 10511
106 Ga0495631_0009464 3300046518 Bacteria 4867
107 Ga0495643_0001553 3300046522 Bacteria 20482
108 Ga0495648_0012909 3300046524 Bacteria 6204
109 Ga0495666_0032372 3300046526 Bacteria 2559
110 Ga0495652_0017993 3300046529 Bacteria 6305
111 Ga0495652_0128149 3300046529 Bacteria 2013
112 Ga0495654_0026749 3300046530 Bacteria 2963
113 Ga0495640_0040140 3300046533 Bacteria 3278
114 Ga0495640_0110263 3300046533 Bacteria 1799
115 Ga0495586_0033921 3300046535 Bacteria 2740
116 Ga0495586_0113737 3300046535 Bacteria 1508
117 Ga0495587_0062922 3300046536 Bacteria 2171
118 Ga0495597_0015609 3300046542 Bacteria 3593
119 Ga0495597_0040696 3300046542 Bacteria 2077
120 Ga0495645_0055215 3300046543 Bacteria 2884
121 Ga0495622_0013835 3300046557 Bacteria 3743
122 Ga0495622_0017657 3300046557 Bacteria 3322
123 Ga0495667_0176023 3300046559 Bacteria 1374
124 Ga0495668_0204510 3300046616 Bacteria 1081
125 Ga0495634_0000690 3300046642 Bacteria 32844
126 Ga0495634_0106212 3300046642 Bacteria 1809
127 Ga0495611_0033593 3300046648 Bacteria 2264
128 Ga0495625_0101967 3300046660 Bacteria 1970
129 Ga0495635_0005326 3300046663 Bacteria 8956
130 Ga0495635_0009933 3300046663 Bacteria 6653
131 Ga0495661_0203855 3300046665 Bacteria 1034
132 Ga0495588_0013402 3300046674 Bacteria 3906
133 Ga0495657_0001393 3300046675 Bacteria 20949
134 Ga0495657_0037998 3300046675 Bacteria 3314
135 Ga0495599_0050797 3300046678 Bacteria 2598
136 Ga0495599_0078086 3300046678 Bacteria 2067
137 Ga0495646_0012438 3300046680 Bacteria 5411
138 Ga0495658_0033457 3300046683 Bacteria 2815
139 Ga0495613_0006199 3300046689 Bacteria 8947
140 Ga0495613_0037454 3300046689 Bacteria 3595
141 Ga0495624_0107271 3300046690 Bacteria 1718
142 Ga0495670_0068009 3300046691 Bacteria 1799
143 Ga0495671_0030457 3300046692 Bacteria 2763
144 Ga0495649_0021386 3300046694 Bacteria 3624
145 Ga0495649_0034077 3300046694 Bacteria 2802
146 Ga0495589_0012293 3300046794 Bacteria 4437
147 Ga0495589_0015752 3300046794 Bacteria 3886
148 Ga0495600_0051600 3300046809 Bacteria 2685
149 Ga0495581_0000355 3300047315 Bacteria 22906
150 Ga0495604_0001109 3300047317 Bacteria 22337
151 Ga0495604_0028093 3300047317 Bacteria 4475
152 Ga0495604_0034038 3300047317 Bacteria 4031
153 Ga0495636_0014257 3300047318 Bacteria 3159
154 Ga0495636_0042521 3300047318 Bacteria 1888
155 Ga0495674_0027821 3300047319 Bacteria 5163
156 Ga0495672_0085526 3300047320 Bacteria 1747
157 Ga0495676_0007282 3300047321 Bacteria 10150
158 Ga0495676_0038367 3300047321 Bacteria 3978
159 Ga0495680_0038008 3300047322 Bacteria 3851
160 Ga0495683_0051741 3300047323 Bacteria 2052
161 Ga0495687_005360 3300047443 Bacteria 8199
162 Ga0495687_005809 3300047443 Bacteria 7736
163 Ga0495687_011973 3300047443 Bacteria 4622
164 Ga0495687_018303 3300047443 Bacteria 3465
165 Ga0495685_000707 3300047447 Bacteria 10227
166 Ga0495685_002996 3300047447 Bacteria 5345
167 Ga0495685_011417 3300047447 Bacteria 2995
168 Ga0495685_034976 3300047447 Bacteria 1726
169 Ga0495685_039267 3300047447 Bacteria 1620
170 Ga0495685_068245 3300047447 Bacteria 1193
171 Ga0495684_0039048 3300047471 Bacteria 3639
172 Ga0495686_0086096 3300047472 Bacteria 1912
173 Ga0495593_0001756 3300047673 Bacteria 12829
174 Ga0495593_0041209 3300047673 Bacteria 2483
175 Ga0495593_0067659 3300047673 Bacteria 1859
176 Ga0495602_0031170 3300048088 Bacteria 5045
177 Ga0495614_0000370 3300048089 Bacteria 18106
178 Ga0495614_0003355 3300048089 Bacteria 7157
179 Ga0495614_0020035 3300048089 Bacteria 2893
180 Ga0496110_0383521 3300048913 Bacteria 1281
181 Ga0501032_0005424 3300049569 Bacteria 9478
182 Ga0501032_0054554 3300049569 Bacteria 2690
183 Ga0501033_0002390 3300049570 Bacteria 15983
184 Ga0501033_0018624 3300049570 Bacteria 5247
185 Ga0501033_0020598 3300049570 Bacteria 4983
186 Ga0501033_0358596 3300049570 Bacteria 1020
187 Ga0501034_0026737 3300049571 Bacteria 5871
188 Ga0501034_0059989 3300049571 Bacteria 3821
189 Ga0501036_0000116 3300049572 Bacteria 49710
190 Ga0501036_0005199 3300049572 Bacteria 10525
191 Ga0501036_0012819 3300049572 Bacteria 6956
192 Ga0501037_0000879 3300049573 Bacteria 22442
193 Ga0501038_0007914 3300049574 Bacteria 9800
194 Ga0501038_0054400 3300049574 Bacteria 3443
195 Ga0501038_0108016 3300049574 Bacteria 2308
196 Ga0501039_0029113 3300049575 Bacteria 4253
197 Ga0501039_0309499 3300049575 Bacteria 1242
198 Ga0501043_0000737 3300049579 Bacteria 29002
199 Ga0501043_0172348 3300049579 Bacteria 1688
200 Ga0501043_0178647 3300049579 Bacteria 1654
201 Ga0501046_0008268 3300049580 Bacteria 9085
202 Ga0501046_0026975 3300049580 Bacteria 4690
203 Ga0501047_0010242 3300049581 Bacteria 8867
204 Ga0501047_0057896 3300049581 Bacteria 3746
205 Ga0501047_0303145 3300049581 Bacteria 1439
206 Ga0501048_0006891 3300049582 Bacteria 8635
207 Ga0501068_0029748 3300049584 Bacteria 3237
208 Ga0501070_0000283 3300049586 Bacteria 47512
209 Ga0501070_0114025 3300049586 Bacteria 2233
210 Ga0501074_0001758 3300049590 Bacteria 14801
211 Ga0501080_0103725 3300049742 Bacteria 2637
212 Ga0501035_0008742 3300049822 Bacteria 9426
213 Ga0501035_0372319 3300049822 Bacteria 1192
214 Ga0501044_0005337 3300049823 Bacteria 14287
215 Ga0501044_0022638 3300049823 Bacteria 6692
216 Ga0501044_0024190 3300049823 Bacteria 6453
217 Ga0501044_0101820 3300049823 Bacteria 2889
218 Ga0501044_0178911 3300049823 Bacteria 2088
219 Ga0501045_0049510 3300049824 Bacteria 3064
220 Ga0495619_0032665 3300053085 Bacteria 3378
221 Ga0500640_004601 3300053095 Bacteria 5034
222 Ga0500573_0095143 3300053140 Bacteria 1679
223 Ga0500624_009105 3300053157 Bacteria 1404
224 Ga0466962_0004252 3300061719 Bacteria 6862
225 Ga0466962_0040314 3300061719 Bacteria 2236
226 2515495269 2515154088 Bacteria 5526283
227 2515722240 2515154129 Bacteria 5584369
228 2515754779 2515154137 Bacteria 5711575
229 2516085378 2515154202 Bacteria 5471270
230 2516088420 2515154203 Bacteria 5458536
231 2547407843 2547132111 Bacteria 8013147
232 2585305063 2582581313 Bacteria 10042643
233 2585313148 2582581314 Bacteria 11452267
234 2644268973 2643221647 Bacteria 10741251
235 2644436158 2643221678 Bacteria 9540101
236 2644631992 2643221714 Bacteria 9015452
237 2785344553 2784746763 Bacteria 9783172
238 2785368365 2784746768 Bacteria 10036182
239 2786669353 2786546132 Bacteria 10419719
240 2808840986 2808606359 Bacteria 9866990
241 2808919581 2808606375 Bacteria 9466072
242 2812359189 2811994879 Bacteria 9313447
243 2812481376 2811994917 Bacteria 7761064
244 2862384719 2862382967 Bacteria 10317375
245 2862582555 2862574272 Bacteria 10567477
246 2863405808 2863404153 Bacteria 9672205
247 2867436365 2867428634 Bacteria 9590268
248 2877682224 2877676314 Bacteria 9512378
249 2912721103 2912715099 Bacteria 9460473
250 2912725178 2912723979 Bacteria 8557534
251 2919468468 2919468124 Bacteria 9133025
252 2946066688 2946064051 Bacteria 8957905
253 2947230512 2947224130 Bacteria 9938529
254 2954675818 2954673503 Bacteria 9685905
255 2954688446 2954682443 Bacteria 9862841
256 2954698175 2954691527 Bacteria 10720516
257 2954704052 2954701450 Bacteria 10834262
258 2954717212 2954711539 Bacteria 10867210
259 2954727179 2954721474 Bacteria 10456478
260 2954734613 2954731030 Bacteria 10243860
261 2954746084 2954740390 Bacteria 10229294
262 2954753508 2954749733 Bacteria 10366972
263 2954765053 2954759201 Bacteria 9358192
264 3006394985 3006393351 Bacteria 6615579
265 3006501902 3006493962 Bacteria 8825450
266 8008559325 8008558824 Bacteria 10610750
267 8008579779 8008574985 Bacteria 7815457
268 8048407920 8048406513 Bacteria 8936924
269 8056836765 8056829672 Bacteria 9045328
270 Ga0466967_0117956
271 rootH1_10000574
272 rootH2_10027226
273 rootH1_10005192
274 Ga0006562J51391_1071110
275 Ga0006562J51391_1071111
276 Ga0070681_10413280
277 Ga0068853_100033163
278 Ga0075365_10258965
279 Ga0075363_100044610
280 Ga0075370_10040283
281 Ga0105244_10046659
282 Ga0105238_10438771
283 Ga0105246_10058769
284 Ga0182006_1011939
285 Ga0207702_10063636
286 Ga0307517_10016170
287 Ga0307515_10000262
288 Ga0307515_10058435
289 Ga0307511_10000371
290 Ga0307511_10061974
291 Ga0307512_10021303
292 Ga0307513_10011380
293 Ga0307513_10054258
294 Ga0307509_10014940
295 Ga0307509_10032904
296 Ga0307509_10080775
297 Ga0307508_10007274
298 Ga0307514_10007286
299 Ga0307514_10061680
300 Ga0307514_10150963
301 Ga0307516_10016127
302 Ga0307516_10100963
303 Ga0307518_10093511
304 Ga0307507_10032140
305 Ga0307507_10048273
306 Ga0307510_10006445
307 Ga0307510_10035256
308 Ga0307510_10139069
309 Ga0395898_0007296
310 Ga0395898_0011971
311 Ga0395898_0039408
312 Ga0395901_0018978
313 Ga0439439_0003349
314 Ga0451853_0742859
315 Ga0439433_0003313
316 Ga0439449_0007844
317 Ga0439449_0027892
318 Ga0439457_001808
319 Ga0439457_013400
320 Ga0439462_0002034
321 Ga0450894_001140
322 Ga0450896_001608
323 Ga0450898_000163
324 Ga0450899_000434
325 Ga0450900_011336
326 Ga0450906_000467
327 Ga0439458_0003911
328 Ga0466972_0007829
329 Ga0466972_0038566
330 Ga0466972_0043066
331 Ga0466965_0000395
332 Ga0466965_0008939
333 Ga0466965_0029868
334 Ga0466966_0033114
335 Ga0466966_0041232
336 Ga0466961_0001902
337 Ga0466963_0003136
338 Ga0466963_0010296
339 Ga0466963_0018361
340 Ga0466971_0000739
341 Ga0466971_0064895
342 Ga0466971_0067659
343 Ga0466970_0000812
344 Ga0466970_0001472
345 Ga0466957_0001794
346 Ga0466957_0323746
347 Ga0466960_0034770
348 Ga0466959_0000872
349 Ga0466959_0185563
350 Ga0466958_0031637
351 Ga0466967_0022894
352 Ga0466967_0085739
353 Ga0466967_0483613
354 Ga0495592_0044023
355 Ga0495603_0019533
356 Ga0495629_0003665
357 Ga0495629_0040208
358 Ga0495629_0044867
359 Ga0495651_0002295
360 Ga0495651_0052462
361 Ga0495582_0009431
362 Ga0495582_0130974
363 Ga0495662_0002066
364 Ga0495664_0000991
365 Ga0495594_0022588
366 Ga0495594_0022612
367 Ga0495583_0101649
368 Ga0495606_0012934
369 Ga0495608_0049271
370 Ga0495618_0008359
371 Ga0495618_0064464
372 Ga0495620_0026440
373 Ga0495628_0033380
374 Ga0495630_0003823
375 Ga0495631_0009464
376 Ga0495643_0001553
377 Ga0495648_0012909
378 Ga0495666_0032372
379 Ga0495652_0017993
380 Ga0495652_0128149
381 Ga0495654_0026749
382 Ga0495640_0040140
383 Ga0495640_0110263
384 Ga0495586_0033921
385 Ga0495586_0113737
386 Ga0495587_0062922
387 Ga0495597_0015609
388 Ga0495597_0040696
389 Ga0495645_0055215
390 Ga0495622_0013835
391 Ga0495622_0017657
392 Ga0495667_0176023
393 Ga0495668_0204510
394 Ga0495634_0000690
395 Ga0495634_0106212
396 Ga0495611_0033593
397 Ga0495625_0101967
398 Ga0495635_0005326
399 Ga0495635_0009933
400 Ga0495661_0203855
401 Ga0495588_0013402
402 Ga0495657_0001393
403 Ga0495657_0037998
404 Ga0495599_0050797
405 Ga0495599_0078086
406 Ga0495646_0012438
407 Ga0495658_0033457
408 Ga0495613_0006199
409 Ga0495613_0037454
410 Ga0495624_0107271
411 Ga0495670_0068009
412 Ga0495671_0030457
413 Ga0495649_0021386
414 Ga0495649_0034077
415 Ga0495589_0012293
416 Ga0495589_0015752
417 Ga0495600_0051600
418 Ga0495581_0000355
419 Ga0495604_0001109
420 Ga0495604_0028093
421 Ga0495604_0034038
422 Ga0495636_0014257
423 Ga0495636_0042521
424 Ga0495674_0027821
425 Ga0495672_0085526
426 Ga0495676_0007282
427 Ga0495676_0038367
428 Ga0495680_0038008
429 Ga0495683_0051741
430 Ga0495687_005360
431 Ga0495687_005809
432 Ga0495687_011973
433 Ga0495687_018303
434 Ga0495685_000707
435 Ga0495685_002996
436 Ga0495685_011417
437 Ga0495685_034976
438 Ga0495685_039267
439 Ga0495685_068245
440 Ga0495684_0039048
441 Ga0495686_0086096
442 Ga0495593_0001756
443 Ga0495593_0041209
444 Ga0495593_0067659
445 Ga0495602_0031170
446 Ga0495614_0000370
447 Ga0495614_0003355
448 Ga0495614_0020035
449 Ga0496110_0383521
450 Ga0501032_0005424
451 Ga0501032_0054554
452 Ga0501033_0002390
453 Ga0501033_0018624
454 Ga0501033_0020598
455 Ga0501033_0358596
456 Ga0501034_0026737
457 Ga0501034_0059989
458 Ga0501036_0000116
459 Ga0501036_0005199
460 Ga0501036_0012819
461 Ga0501037_0000879
462 Ga0501038_0007914
463 Ga0501038_0054400
464 Ga0501038_0108016
465 Ga0501039_0029113
466 Ga0501039_0309499
467 Ga0501043_0000737
468 Ga0501043_0172348
469 Ga0501043_0178647
470 Ga0501046_0008268
471 Ga0501046_0026975
472 Ga0501047_0010242
473 Ga0501047_0057896
474 Ga0501047_0303145
475 Ga0501048_0006891
476 Ga0501068_0029748
477 Ga0501070_0000283
478 Ga0501070_0114025
479 Ga0501074_0001758
480 Ga0501080_0103725
481 Ga0501035_0008742
482 Ga0501035_0372319
483 Ga0501044_0005337
484 Ga0501044_0022638
485 Ga0501044_0024190
486 Ga0501044_0101820
487 Ga0501044_0178911
488 Ga0501045_0049510
489 Ga0495619_0032665
490 Ga0500640_004601
491 Ga0500573_0095143
492 Ga0500624_009105
493 Ga0466962_0004252
494 Ga0466962_0040314
495 2515495269
496 2515722240
497 2515754779
498 2516085378
499 2516088420
500 2547407843
501 2585305063
502 2585313148
503 2644268973
504 2644436158
505 2644631992
506 2785344553
507 2785368365
508 2786669353
509 2808840986
510 2808919581
511 2812359189
512 2812481376
513 2862384719
514 2862582555
515 2863405808
516 2867436365
517 2877682224
518 2912721103
519 2912725178
520 2919468468
521 2946066688
522 2947230512
523 2954675818
524 2954688446
525 2954698175
526 2954704052
527 2954717212
528 2954727179
529 2954734613
530 2954746084
531 2954753508
532 2954765053
533 3006394985
534 3006501902
535 8008559325
536 8008579779
537 8048407920
538 8056836765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jil-assembly1.cif.gz_A crystal structure of d-cycloserine synthetase dcsg 0.8775 15 299
6jil-assembly1.cif.gz_A crystal structure of d-cycloserine synthetase dcsg 0.8409 15 299
3vpc-assembly1.cif.gz_C argx from sulfolobus tokodaii complexed with adp 0.7647 15 298
3vpb-assembly1.cif.gz_D argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate 0.762 15 298
3vpc-assembly1.cif.gz_C argx from sulfolobus tokodaii complexed with adp 0.75 15 298
ID Description Score Start End Superfamily
af_O53147_12_283_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8182 15 299 3.10.310.50
af_O53147_12_283_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7961 15 299 3.10.310.50
af_A0A1D6MHW5_188_409_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7903 256 275 2.130.10.10
3vpcC03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7605 190 298 3.30.470.20
5xy4A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7282 13 67 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A0N0AA38-F1-model_v4 ATP-grasp domain-containing protein 0.9913 33 299
AF-A0A6B3BYK3-F1-model_v4 ATP-grasp domain-containing protein 0.9892 13 299
AF-A0A5P8KHA6-F1-model_v4 ATP-grasp domain-containing protein 0.9884 17 299
AF-A0A7X0GR48-F1-model_v4 ATP-grasp domain-containing protein 0.9884 99 300
AF-A0A0Q6XLL2-F1-model_v4 ATP-grasp domain-containing protein 0.986 13 299 GO:0005524
GO:0046872

Map