F376300

General Info

Members Datasets Scaffolds Average Seq Length
269 217 538 226

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10096901|Ga0265316_100969011
Length 251
Sequence MLAVADPDLDNGPRTEKSATVRMCAVTRQVRPIDELIRFVVAPSGQVIPDLKRKLPGRGLWVSASRAAVAEAVRRHQFSKGFKREVRASATLAADTEALLVRGAIEALAMAAKAGQVVSGFGKVEDALKARQAKGPAQTPVRALIHASDGAADGIRKLDALVRQNAGIDDDSNPFPIVTALTSEQLDLALGRSNVIHAALLAGPASKTFLSRSQILVRYRMADDDKTAGNAAENSPIQTVRQRTTQQDWDC

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
191 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
192 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
193 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
194 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
195 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
198 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
199 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
204 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
205 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
206 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
207 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
208 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
209 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
212 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
216 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
217 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.99
Nodule 0.37
Rhizoplane 4.46
Rhizosphere 72.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10096901 3300031344 Bacteria 2246
2 JGI25406J46586_10000015 3300003203 Bacteria 91406
3 JGI25153J46596_10012347 3300003215 Bacteria 3695
4 Ga0070658_10088188 3300005327 Bacteria 2555
5 Ga0070676_10077298 3300005328 Bacteria 2011
6 Ga0070683_100338488 3300005329 Bacteria 1433
7 Ga0068869_100829349 3300005334 Bacteria 796
8 Ga0070680_100062112 3300005336 Bacteria 3058
9 Ga0070682_100056499 3300005337 Bacteria 2469
10 Ga0068868_100296012 3300005338 Bacteria 1373
11 Ga0070660_100200014 3300005339 Bacteria 1621
12 Ga0070689_100095259 3300005340 Bacteria 2351
13 Ga0070689_100506922 3300005340 Bacteria 1034
14 Ga0070661_100200847 3300005344 Bacteria 1523
15 Ga0070669_100468533 3300005353 Bacteria 1041
16 Ga0070671_100164550 3300005355 Bacteria 1875
17 Ga0070673_100228520 3300005364 Bacteria 1613
18 Ga0070703_10174558 3300005406 Bacteria 826
19 Ga0070714_100503943 3300005435 Bacteria 1155
20 Ga0070713_100300840 3300005436 Bacteria 1477
21 Ga0070713_100352121 3300005436 Bacteria 1366
22 Ga0070710_10000249 3300005437 Bacteria 25360
23 Ga0070711_100014025 3300005439 Bacteria 5042
24 Ga0070700_100075798 3300005441 Bacteria 2158
25 Ga0070663_100099166 3300005455 Bacteria 2171
26 Ga0070663_100180422 3300005455 Bacteria 1637
27 Ga0070662_100240560 3300005457 Bacteria 1451
28 Ga0070681_10005165 3300005458 Bacteria 12597
29 Ga0070681_10023620 3300005458 Bacteria 6185
30 Ga0070681_10543542 3300005458 Bacteria 1075
31 Ga0070679_100006016 3300005530 Bacteria 11289
32 Ga0070679_100582422 3300005530 Bacteria 1062
33 Ga0070697_100029231 3300005536 Bacteria 4417
34 Ga0068853_100656657 3300005539 Bacteria 998
35 Ga0070672_100311479 3300005543 Bacteria 1336
36 Ga0070665_100050288 3300005548 Bacteria 4182
37 Ga0068855_100024971 3300005563 Bacteria 7152
38 Ga0068855_100222040 3300005563 Bacteria 2118
39 Ga0068854_100367493 3300005578 Bacteria 1182
40 Ga0068856_100139117 3300005614 Bacteria 2434
41 Ga0068856_100376976 3300005614 Bacteria 1438
42 Ga0068861_100568880 3300005719 Bacteria 1035
43 Ga0068863_100097805 3300005841 Bacteria 2787
44 Ga0081455_10010658 3300005937 Bacteria 9299
45 Ga0081455_10069947 3300005937 Bacteria 2916
46 Ga0081455_10071505 3300005937 Bacteria 2875
47 Ga0081538_10056096 3300005981 Bacteria 2311
48 Ga0081540_1010060 3300005983 Bacteria 6439
49 Ga0081540_1059963 3300005983 Bacteria 1823
50 Ga0081539_10043456 3300005985 Bacteria 2605
51 Ga0075365_10011377 3300006038 Bacteria 5230
52 Ga0075363_100031898 3300006048 Bacteria 2733
53 Ga0075364_10033054 3300006051 Bacteria 3327
54 Ga0075432_10046331 3300006058 Bacteria 1527
55 Ga0070715_10239869 3300006163 Bacteria 942
56 Ga0075367_10071259 3300006178 Bacteria 2090
57 Ga0075367_10357863 3300006178 Bacteria 921
58 Ga0097621_100304703 3300006237 Bacteria 1408
59 Ga0075370_10008649 3300006353 Bacteria 5247
60 Ga0068871_100206564 3300006358 Bacteria 1697
61 Ga0075434_100245344 3300006871 Bacteria 1811
62 Ga0075436_100098778 3300006914 Bacteria 2032
63 Ga0099794_10127259 3300007265 Bacteria 1285
64 Ga0105240_10178546 3300009093 Bacteria 2508
65 Ga0105240_10328880 3300009093 Bacteria 1740
66 Ga0105245_10344164 3300009098 Bacteria 1475
67 Ga0105245_10663556 3300009098 Bacteria 1074
68 Ga0105247_10274954 3300009101 Bacteria 1160
69 Ga0105243_10226422 3300009148 Bacteria 1656
70 Ga0105249_10251985 3300009553 Bacteria 1751
71 Ga0099796_10101436 3300010159 Bacteria 1083
72 Ga0105246_10782525 3300011119 Bacteria 845
73 Ga0157370_10012243 3300013104 Bacteria 8909
74 Ga0157374_10824702 3300013296 Bacteria 944
75 Ga0157378_10298906 3300013297 Bacteria 1557
76 Ga0157378_10598372 3300013297 Bacteria 1114
77 Ga0157375_10794122 3300013308 Bacteria 1095
78 Ga0182008_10191659 3300014497 Bacteria 1037
79 Ga0213874_10027264 3300021377 Bacteria 1624
80 Ga0213876_10035169 3300021384 Bacteria 2642
81 Ga0207653_10003862 3300025885 Bacteria 4718
82 Ga0207692_10000358 3300025898 Bacteria 15705
83 Ga0207680_10576294 3300025903 Bacteria 804
84 Ga0207699_10000359 3300025906 Bacteria 24077
85 Ga0207705_10067684 3300025909 Bacteria 2585
86 Ga0207707_10159515 3300025912 Bacteria 1972
87 Ga0207707_10471981 3300025912 Bacteria 1072
88 Ga0207695_10096598 3300025913 Bacteria 2956
89 Ga0207693_10065926 3300025915 Bacteria 2835
90 Ga0207663_10012150 3300025916 Bacteria 4646
91 Ga0207660_10074733 3300025917 Bacteria 2474
92 Ga0207657_10338557 3300025919 Bacteria 1188
93 Ga0207652_10034258 3300025921 Bacteria 4278
94 Ga0207700_10438854 3300025928 Bacteria 1149
95 Ga0207644_10113474 3300025931 Bacteria 2052
96 Ga0207686_10270740 3300025934 Bacteria 1249
97 Ga0207665_10005765 3300025939 Bacteria 8238
98 Ga0207691_10717773 3300025940 Bacteria 842
99 Ga0207661_10438938 3300025944 Bacteria 1188
100 Ga0207679_10787661 3300025945 Bacteria 866
101 Ga0207667_10116651 3300025949 Bacteria 2751
102 Ga0207651_10227014 3300025960 Bacteria 1513
103 Ga0207712_10065279 3300025961 Bacteria 2598
104 Ga0207640_10523582 3300025981 Bacteria 991
105 Ga0207677_10453760 3300026023 Bacteria 1099
106 Ga0207703_10640217 3300026035 Bacteria 1008
107 Ga0207639_10068023 3300026041 Bacteria 2774
108 Ga0207639_10676844 3300026041 Bacteria 956
109 Ga0207702_10223297 3300026078 Bacteria 1756
110 Ga0207702_10389615 3300026078 Bacteria 1341
111 Ga0207674_10306431 3300026116 Bacteria 1537
112 Ga0207683_10180050 3300026121 Bacteria 1916
113 Ga0268265_10941088 3300028380 Bacteria 850
114 Ga0307511_10098697 3300030521 Bacteria 1932
115 Ga0307512_10164438 3300030522 Bacteria 1290
116 Ga0265330_10036062 3300031235 Bacteria 2205
117 Ga0265332_10019335 3300031238 Bacteria 3006
118 Ga0265328_10076242 3300031239 Bacteria 1234
119 Ga0265325_10015972 3300031241 Bacteria 4205
120 Ga0265329_10073735 3300031242 Bacteria 1080
121 Ga0265339_10017430 3300031249 Bacteria 4256
122 Ga0307513_10324881 3300031456 Bacteria 1295
123 Ga0307509_10067813 3300031507 Bacteria 3735
124 Ga0307509_10254917 3300031507 Bacteria 1535
125 Ga0307408_100119888 3300031548 Bacteria 2036
126 Ga0265314_10070689 3300031711 Bacteria 2338
127 Ga0265314_10142359 3300031711 Bacteria 1481
128 Ga0265342_10037131 3300031712 Bacteria 2972
129 Ga0307412_10152996 3300031911 Bacteria 1705
130 Ga0307412_10249513 3300031911 Bacteria 1377
131 Ga0307416_101410397 3300032002 Bacteria 802
132 Ga0307510_10023588 3300033180 Bacteria 7129
133 Ga0373949_0044858 3300035090 Bacteria 1098
134 Ga0373951_0026860 3300035091 Bacteria 1343
135 Ga0373923_0006529 3300035111 Bacteria 4040
136 Ga0373939_0041419 3300035114 Bacteria 1388
137 Ga0373939_0119567 3300035114 Bacteria 928
138 Ga0373961_0021790 3300035241 Bacteria 1708
139 Ga0373931_0241656 3300035691 Bacteria 1095
140 Ga0373933_0002396 3300035724 Bacteria 10573
141 Ga0373925_0263041 3300037068 Bacteria 1386
142 Ga0395900_0154950 3300037418 Bacteria 2340
143 Ga0395900_0602364 3300037418 Bacteria 1039
144 Ga0395898_0062406 3300037466 Bacteria 3619
145 Ga0436360_0167039 3300039438 Bacteria 1629
146 Ga0436361_0995697 3300039447 Bacteria 2421
147 Ga0436363_0486526 3300039450 Bacteria 1112
148 Ga0436363_1306688 3300039450 Bacteria 2758
149 Ga0436363_1688839 3300039450 Bacteria 913
150 Ga0439465_0062665 3300041413 Bacteria 1234
151 Ga0466967_0043281 3300045976 Bacteria 3898
152 Ga0495617_076572 3300046452 Bacteria 1097
153 Ga0495592_0418142 3300046454 Bacteria 846
154 Ga0495603_0048245 3300046455 Bacteria 2535
155 Ga0495603_0072830 3300046455 Bacteria 2018
156 Ga0495603_0140429 3300046455 Bacteria 1405
157 Ga0495590_0042018 3300046457 Bacteria 1593
158 Ga0495650_0038991 3300046471 Bacteria 2053
159 Ga0495650_0070276 3300046471 Bacteria 1375
160 Ga0495605_0264102 3300046474 Bacteria 734
161 Ga0495664_0104851 3300046477 Bacteria 1704
162 Ga0495594_0106245 3300046499 Bacteria 1581
163 Ga0495606_0001109 3300046507 Bacteria 38467
164 Ga0495606_0073666 3300046507 Bacteria 2142
165 Ga0495610_0028997 3300046512 Bacteria 2920
166 Ga0495616_0154108 3300046513 Bacteria 1037
167 Ga0495631_0164540 3300046518 Bacteria 952
168 Ga0495643_0144794 3300046522 Bacteria 1181
169 Ga0495648_0134695 3300046524 Bacteria 1308
170 Ga0495663_0127179 3300046525 Bacteria 857
171 Ga0495642_0250302 3300046528 Bacteria 774
172 Ga0495622_0056052 3300046557 Bacteria 1827
173 Ga0495668_0334964 3300046616 Bacteria 830
174 Ga0495611_0167955 3300046648 Bacteria 1025
175 Ga0495635_0362774 3300046663 Bacteria 966
176 Ga0495599_0017031 3300046678 Bacteria 4515
177 Ga0495669_0061796 3300046684 Bacteria 1696
178 Ga0495624_0410033 3300046690 Bacteria 813
179 Ga0495671_0109912 3300046692 Bacteria 1346
180 Ga0495649_0087012 3300046694 Bacteria 1667
181 Ga0495649_0217943 3300046694 Bacteria 988
182 Ga0495589_0115676 3300046794 Bacteria 1293
183 Ga0495600_0248517 3300046809 Bacteria 1132
184 Ga0495600_0494494 3300046809 Bacteria 752
185 Ga0495660_0076280 3300046810 Bacteria 1766
186 Ga0495604_0493712 3300047317 Bacteria 795
187 Ga0495636_0258015 3300047318 Bacteria 807
188 Ga0495672_0008046 3300047320 Bacteria 7841
189 Ga0495672_0015549 3300047320 Bacteria 5162
190 Ga0495672_0344560 3300047320 Bacteria 693
191 Ga0495673_0054405 3300047469 Bacteria 1740
192 Ga0495673_0054848 3300047469 Bacteria 1732
193 Ga0495602_0209056 3300048088 Bacteria 1483
194 Ga0496102_0189155 3300048905 Bacteria 1940
195 Ga0496102_0341191 3300048905 Bacteria 1411
196 Ga0496106_0901745 3300048909 Bacteria 698
197 Ga0496107_0502750 3300048910 Bacteria 899
198 Ga0496107_0529420 3300048910 Bacteria 873
199 Ga0496108_0329886 3300048911 Bacteria 1330
200 Ga0496109_0466432 3300048912 Bacteria 1192
201 Ga0496110_0232586 3300048913 Bacteria 1676
202 Ga0496112_0000015 3300048915 Bacteria 206423
203 Ga0496112_0186801 3300048915 Bacteria 2035
204 Ga0496114_0471112 3300048917 Bacteria 1111
205 Ga0496114_0542023 3300048917 Bacteria 1028
206 Ga0496121_0000865 3300048924 Bacteria 54663
207 Ga0496121_0341909 3300048924 Bacteria 1000
208 Ga0496126_0049832 3300048929 Bacteria 3821
209 Ga0496126_0103163 3300048929 Bacteria 2492
210 Ga0496126_0240151 3300048929 Bacteria 1514
211 Ga0496126_0567263 3300048929 Bacteria 898
212 Ga0495678_049460 3300049459 Bacteria 1633
213 Ga0501031_0339060 3300049568 Bacteria 973
214 Ga0501038_0454134 3300049574 Bacteria 985
215 Ga0501040_0486168 3300049576 Bacteria 890
216 Ga0501042_0635228 3300049578 Bacteria 776
217 Ga0501068_0376110 3300049584 Bacteria 914
218 Ga0501073_0126919 3300049589 Bacteria 1768
219 Ga0501044_0268976 3300049823 Bacteria 1641
220 nmdc:mga03n38_32899_c1 3300050490 Bacteria 2201
221 nmdc:mga00v17_300130_c1 3300050491 Bacteria 1043
222 nmdc:mga0yw44_540810_c1 3300050492 Bacteria 791
223 nmdc:mga06z11_36191_c1 3300050494 Bacteria 2435
224 nmdc:mga07m45_118676_c1 3300050496 Bacteria 1527
225 nmdc:mga0n895_251700_c1 3300050512 Bacteria 1793
226 nmdc:mga0n895_74255_c1 3300050512 Bacteria 3377
227 nmdc:mga0rr50_363906_c1 3300050513 Bacteria 1218
228 nmdc:mga0rr50_456118_c1 3300050513 Bacteria 1084
229 nmdc:mga08x19_151845_c1 3300050514 Bacteria 1569
230 Ga0495655_0152453 3300053083 Bacteria 728
231 Ga0495619_0143649 3300053085 Bacteria 1644
232 Ga0495619_0400207 3300053085 Bacteria 948
233 Ga0495619_0624616 3300053085 Bacteria 736
234 Ga0500578_0125011 3300053086 Bacteria 1615
235 Ga0500643_078185 3300053087 Bacteria 911
236 Ga0500651_0141198 3300053093 Bacteria 1451
237 Ga0500566_0040949 3300053094 Bacteria 2677
238 Ga0500566_0310193 3300053094 Bacteria 739
239 Ga0500554_178857 3300053102 Bacteria 713
240 Ga0500569_016943 3300053109 Bacteria 1854
241 Ga0500572_000265 3300053111 Bacteria 18846
242 Ga0500594_0030157 3300053118 Bacteria 1422
243 Ga0500595_003439 3300053119 Bacteria 7386
244 Ga0500595_003770 3300053119 Bacteria 6979
245 Ga0500614_086020 3300053123 Bacteria 887
246 Ga0500617_051924 3300053124 Bacteria 1827
247 Ga0500621_092098 3300053126 Bacteria 1204
248 Ga0500658_0099822 3300053134 Bacteria 1265
249 Ga0500559_0000371 3300053136 Bacteria 33055
250 Ga0500568_0033173 3300053139 Bacteria 2120
251 Ga0500579_124916 3300053143 Bacteria 1230
252 Ga0500589_011085 3300053147 Bacteria 3886
253 Ga0500589_128074 3300053147 Bacteria 1064
254 Ga0500590_093958 3300053148 Bacteria 1452
255 Ga0500603_001022 3300053150 Bacteria 6584
256 Ga0500603_089419 3300053150 Bacteria 902
257 Ga0500627_0129297 3300053158 Bacteria 1140
258 Ga0500634_0070956 3300053161 Bacteria 1822
259 Ga0500639_062274 3300053163 Bacteria 1920
260 Ga0500636_0055971 3300053177 Bacteria 2311
261 Ga0500637_0002991 3300053178 Bacteria 7669
262 Ga0500637_0104581 3300053178 Bacteria 1641
263 Ga0500611_015675 3300053727 Bacteria 1347
264 Ga0500645_085486 3300053730 Bacteria 897
265 Ga0501082_0210125 3300060353 Bacteria 1693
266 Ga0501082_0702724 3300060353 Bacteria 885
267 Ga0530510_0824469 3300061734 Bacteria 708
268 2885380032 2885374607 Bacteria 8927485
269 2908747262 2908739725 Bacteria 8628932
270 Ga0265316_10096901
271 JGI25406J46586_10000015
272 JGI25153J46596_10012347
273 Ga0070658_10088188
274 Ga0070676_10077298
275 Ga0070683_100338488
276 Ga0068869_100829349
277 Ga0070680_100062112
278 Ga0070682_100056499
279 Ga0068868_100296012
280 Ga0070660_100200014
281 Ga0070689_100095259
282 Ga0070689_100506922
283 Ga0070661_100200847
284 Ga0070669_100468533
285 Ga0070671_100164550
286 Ga0070673_100228520
287 Ga0070703_10174558
288 Ga0070714_100503943
289 Ga0070713_100300840
290 Ga0070713_100352121
291 Ga0070710_10000249
292 Ga0070711_100014025
293 Ga0070700_100075798
294 Ga0070663_100099166
295 Ga0070663_100180422
296 Ga0070662_100240560
297 Ga0070681_10005165
298 Ga0070681_10023620
299 Ga0070681_10543542
300 Ga0070679_100006016
301 Ga0070679_100582422
302 Ga0070697_100029231
303 Ga0068853_100656657
304 Ga0070672_100311479
305 Ga0070665_100050288
306 Ga0068855_100024971
307 Ga0068855_100222040
308 Ga0068854_100367493
309 Ga0068856_100139117
310 Ga0068856_100376976
311 Ga0068861_100568880
312 Ga0068863_100097805
313 Ga0081455_10010658
314 Ga0081455_10069947
315 Ga0081455_10071505
316 Ga0081538_10056096
317 Ga0081540_1010060
318 Ga0081540_1059963
319 Ga0081539_10043456
320 Ga0075365_10011377
321 Ga0075363_100031898
322 Ga0075364_10033054
323 Ga0075432_10046331
324 Ga0070715_10239869
325 Ga0075367_10071259
326 Ga0075367_10357863
327 Ga0097621_100304703
328 Ga0075370_10008649
329 Ga0068871_100206564
330 Ga0075434_100245344
331 Ga0075436_100098778
332 Ga0099794_10127259
333 Ga0105240_10178546
334 Ga0105240_10328880
335 Ga0105245_10344164
336 Ga0105245_10663556
337 Ga0105247_10274954
338 Ga0105243_10226422
339 Ga0105249_10251985
340 Ga0099796_10101436
341 Ga0105246_10782525
342 Ga0157370_10012243
343 Ga0157374_10824702
344 Ga0157378_10298906
345 Ga0157378_10598372
346 Ga0157375_10794122
347 Ga0182008_10191659
348 Ga0213874_10027264
349 Ga0213876_10035169
350 Ga0207653_10003862
351 Ga0207692_10000358
352 Ga0207680_10576294
353 Ga0207699_10000359
354 Ga0207705_10067684
355 Ga0207707_10159515
356 Ga0207707_10471981
357 Ga0207695_10096598
358 Ga0207693_10065926
359 Ga0207663_10012150
360 Ga0207660_10074733
361 Ga0207657_10338557
362 Ga0207652_10034258
363 Ga0207700_10438854
364 Ga0207644_10113474
365 Ga0207686_10270740
366 Ga0207665_10005765
367 Ga0207691_10717773
368 Ga0207661_10438938
369 Ga0207679_10787661
370 Ga0207667_10116651
371 Ga0207651_10227014
372 Ga0207712_10065279
373 Ga0207640_10523582
374 Ga0207677_10453760
375 Ga0207703_10640217
376 Ga0207639_10068023
377 Ga0207639_10676844
378 Ga0207702_10223297
379 Ga0207702_10389615
380 Ga0207674_10306431
381 Ga0207683_10180050
382 Ga0268265_10941088
383 Ga0307511_10098697
384 Ga0307512_10164438
385 Ga0265330_10036062
386 Ga0265332_10019335
387 Ga0265328_10076242
388 Ga0265325_10015972
389 Ga0265329_10073735
390 Ga0265339_10017430
391 Ga0307513_10324881
392 Ga0307509_10067813
393 Ga0307509_10254917
394 Ga0307408_100119888
395 Ga0265314_10070689
396 Ga0265314_10142359
397 Ga0265342_10037131
398 Ga0307412_10152996
399 Ga0307412_10249513
400 Ga0307416_101410397
401 Ga0307510_10023588
402 Ga0373949_0044858
403 Ga0373951_0026860
404 Ga0373923_0006529
405 Ga0373939_0041419
406 Ga0373939_0119567
407 Ga0373961_0021790
408 Ga0373931_0241656
409 Ga0373933_0002396
410 Ga0373925_0263041
411 Ga0395900_0154950
412 Ga0395900_0602364
413 Ga0395898_0062406
414 Ga0436360_0167039
415 Ga0436361_0995697
416 Ga0436363_0486526
417 Ga0436363_1306688
418 Ga0436363_1688839
419 Ga0439465_0062665
420 Ga0466967_0043281
421 Ga0495617_076572
422 Ga0495592_0418142
423 Ga0495603_0048245
424 Ga0495603_0072830
425 Ga0495603_0140429
426 Ga0495590_0042018
427 Ga0495650_0038991
428 Ga0495650_0070276
429 Ga0495605_0264102
430 Ga0495664_0104851
431 Ga0495594_0106245
432 Ga0495606_0001109
433 Ga0495606_0073666
434 Ga0495610_0028997
435 Ga0495616_0154108
436 Ga0495631_0164540
437 Ga0495643_0144794
438 Ga0495648_0134695
439 Ga0495663_0127179
440 Ga0495642_0250302
441 Ga0495622_0056052
442 Ga0495668_0334964
443 Ga0495611_0167955
444 Ga0495635_0362774
445 Ga0495599_0017031
446 Ga0495669_0061796
447 Ga0495624_0410033
448 Ga0495671_0109912
449 Ga0495649_0087012
450 Ga0495649_0217943
451 Ga0495589_0115676
452 Ga0495600_0248517
453 Ga0495600_0494494
454 Ga0495660_0076280
455 Ga0495604_0493712
456 Ga0495636_0258015
457 Ga0495672_0008046
458 Ga0495672_0015549
459 Ga0495672_0344560
460 Ga0495673_0054405
461 Ga0495673_0054848
462 Ga0495602_0209056
463 Ga0496102_0189155
464 Ga0496102_0341191
465 Ga0496106_0901745
466 Ga0496107_0502750
467 Ga0496107_0529420
468 Ga0496108_0329886
469 Ga0496109_0466432
470 Ga0496110_0232586
471 Ga0496112_0000015
472 Ga0496112_0186801
473 Ga0496114_0471112
474 Ga0496114_0542023
475 Ga0496121_0000865
476 Ga0496121_0341909
477 Ga0496126_0049832
478 Ga0496126_0103163
479 Ga0496126_0240151
480 Ga0496126_0567263
481 Ga0495678_049460
482 Ga0501031_0339060
483 Ga0501038_0454134
484 Ga0501040_0486168
485 Ga0501042_0635228
486 Ga0501068_0376110
487 Ga0501073_0126919
488 Ga0501044_0268976
489 nmdc:mga03n38_32899_c1
490 nmdc:mga00v17_300130_c1
491 nmdc:mga0yw44_540810_c1
492 nmdc:mga06z11_36191_c1
493 nmdc:mga07m45_118676_c1
494 nmdc:mga0n895_251700_c1
495 nmdc:mga0n895_74255_c1
496 nmdc:mga0rr50_363906_c1
497 nmdc:mga0rr50_456118_c1
498 nmdc:mga08x19_151845_c1
499 Ga0495655_0152453
500 Ga0495619_0143649
501 Ga0495619_0400207
502 Ga0495619_0624616
503 Ga0500578_0125011
504 Ga0500643_078185
505 Ga0500651_0141198
506 Ga0500566_0040949
507 Ga0500566_0310193
508 Ga0500554_178857
509 Ga0500569_016943
510 Ga0500572_000265
511 Ga0500594_0030157
512 Ga0500595_003439
513 Ga0500595_003770
514 Ga0500614_086020
515 Ga0500617_051924
516 Ga0500621_092098
517 Ga0500658_0099822
518 Ga0500559_0000371
519 Ga0500568_0033173
520 Ga0500579_124916
521 Ga0500589_011085
522 Ga0500589_128074
523 Ga0500590_093958
524 Ga0500603_001022
525 Ga0500603_089419
526 Ga0500627_0129297
527 Ga0500634_0070956
528 Ga0500639_062274
529 Ga0500636_0055971
530 Ga0500637_0002991
531 Ga0500637_0104581
532 Ga0500611_015675
533 Ga0500645_085486
534 Ga0501082_0210125
535 Ga0501082_0702724
536 Ga0530510_0824469
537 2885380032
538 2908747262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04296

YlxR

Protein of unknown function (DUF448)

22

97

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on1-assembly1.cif.gz_A the structure of a protein with unknown function from bacillus halodurans c 0.8926 105 207
4lck-assembly1.cif.gz_A co-crystal structure of a t-box riboswitch stem i domain in complex with its cognate trna 0.8706 117 195
8b2l-assembly1.cif.gz_P3 cryo-em structure of the plant 80s ribosome 0.8648 106 195
7bhp-assembly1.cif.gz_Lc cryo-em structure of the human ebp1 - 80s ribosome 0.8625 114 195
7qiz-assembly1.cif.gz_e specific features and methylation sites of a plant 80s ribosome 0.8598 106 194
ID Description Score Start End Superfamily
3on1A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8858 105 207 3.30.1330.30
3v7qC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8557 105 203 3.30.1330.30
4cuwc00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8456 117 196 3.30.1330.30
3on1A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8451 105 207 3.30.1330.30
af_I6XFF7_1_86_3.30.1230.10 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;YlxR-like 0.8319 23 93 3.30.1230.10
ID Description Score Start End GO Terms
AF-A0A1I5CVF6-F1-model_v4 YlxR domain-containing protein 0.9776 23 217
AF-A0A845ML67-F1-model_v4 RNA-binding protein 0.9775 22 213
AF-A0A435GI91-F1-model_v4 DUF448 domain-containing protein 0.9762 22 116
AF-A0A519PSQ6-F1-model_v4 DUF448 domain-containing protein 0.9696 22 132
AF-A0A1M3CGF5-F1-model_v4 DNA-binding protein 0.958 1 213 GO:0003677

Map