F376254
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 269 | 173 | 266 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300025917|Ga0207660_11076210|Ga0207660_110762101 |
| Length | 200 |
| Sequence | MQDTRYVQTPVENDESQSVAGALPHDLPQPEGPPSGSEASRAAKATPGLEEQLKQALLSAQEHHDAWLRAKAEADNIRKRAQADITSAHKYAIENFSGDLLAVKDSLEAALAADKVTFESLKSGVELTLKQLNSVFDKNRIVEINPAGQKFDPHRHQAITTVESDAEPNSVVQVFQKGYALNDRVIRPAMVSVAKHPTAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 2 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 3 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 110 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 120 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 121 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 122 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 123 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 127 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 128 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 138 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 139 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 140 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 141 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 171 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 0 |
| Isolates | 1.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 4.09 |
| Rhizosphere | 94.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10164279 | 3300005328 | Bacteria | 1431 |
| 2 | Ga0070676_10607404 | 3300005328 | Archaea | 789 |
| 3 | Ga0070683_100143143 | 3300005329 | Bacteria | 2265 |
| 4 | Ga0070683_101372181 | 3300005329 | Bacteria | 679 |
| 5 | Ga0070670_100001183 | 3300005331 | Bacteria | 20679 |
| 6 | Ga0070677_10022629 | 3300005333 | Bacteria | 2317 |
| 7 | Ga0070677_10059100 | 3300005333 | Bacteria | 1576 |
| 8 | Ga0070666_10009457 | 3300005335 | Bacteria | 6078 |
| 9 | Ga0070666_10120953 | 3300005335 | Bacteria | 1815 |
| 10 | Ga0070680_100260643 | 3300005336 | Bacteria | 1467 |
| 11 | Ga0068868_100000563 | 3300005338 | Bacteria | 24853 |
| 12 | Ga0068868_100059865 | 3300005338 | Bacteria | 3013 |
| 13 | Ga0070661_100005436 | 3300005344 | Bacteria | 8782 |
| 14 | Ga0070675_100001483 | 3300005354 | Bacteria | 17312 |
| 15 | Ga0070675_100029011 | 3300005354 | Bacteria | 4459 |
| 16 | Ga0070671_100001086 | 3300005355 | Bacteria | 20125 |
| 17 | Ga0070671_100050012 | 3300005355 | Bacteria | 3477 |
| 18 | Ga0070674_100033854 | 3300005356 | Bacteria | 3406 |
| 19 | Ga0070674_100156611 | 3300005356 | Bacteria | 1724 |
| 20 | Ga0070673_100008418 | 3300005364 | Bacteria | 6859 |
| 21 | Ga0070673_100045341 | 3300005364 | Bacteria | 3409 |
| 22 | Ga0070667_100046501 | 3300005367 | Bacteria | 3651 |
| 23 | Ga0070667_100205497 | 3300005367 | Bacteria | 1749 |
| 24 | Ga0070700_100023208 | 3300005441 | Bacteria | 3627 |
| 25 | Ga0070700_100232219 | 3300005441 | Bacteria | 1313 |
| 26 | Ga0070694_100078909 | 3300005444 | Bacteria | 2284 |
| 27 | Ga0070694_100092110 | 3300005444 | Bacteria | 2129 |
| 28 | Ga0070694_100114213 | 3300005444 | Bacteria | 1928 |
| 29 | Ga0070663_100249529 | 3300005455 | Bacteria | 1404 |
| 30 | Ga0070678_100000081 | 3300005456 | Bacteria | 35889 |
| 31 | Ga0070678_100007489 | 3300005456 | Bacteria | 6480 |
| 32 | Ga0070678_100568484 | 3300005456 | Unclassified | 1008 |
| 33 | Ga0070662_100048829 | 3300005457 | Bacteria | 3050 |
| 34 | Ga0070681_10033093 | 3300005458 | Bacteria | 5189 |
| 35 | Ga0070681_10078831 | 3300005458 | Bacteria | 3251 |
| 36 | Ga0068867_100016980 | 3300005459 | Bacteria | 5172 |
| 37 | Ga0068867_100047967 | 3300005459 | Bacteria | 3141 |
| 38 | Ga0070706_100030455 | 3300005467 | Bacteria | 4972 |
| 39 | Ga0070707_100050434 | 3300005468 | Bacteria | 3989 |
| 40 | Ga0070679_100794767 | 3300005530 | Bacteria | 889 |
| 41 | Ga0070684_100026105 | 3300005535 | Bacteria | 4917 |
| 42 | Ga0070697_100124968 | 3300005536 | Bacteria | 2155 |
| 43 | Ga0070697_100399861 | 3300005536 | Bacteria | 1192 |
| 44 | Ga0070672_100000196 | 3300005543 | Bacteria | 33585 |
| 45 | Ga0070695_100133887 | 3300005545 | Bacteria | 1711 |
| 46 | Ga0070704_100021085 | 3300005549 | Bacteria | 4218 |
| 47 | Ga0070664_100008946 | 3300005564 | Bacteria | 8119 |
| 48 | Ga0070664_100145521 | 3300005564 | Bacteria | 2089 |
| 49 | Ga0068854_100004097 | 3300005578 | Bacteria | 9157 |
| 50 | Ga0070702_100061600 | 3300005615 | Bacteria | 2185 |
| 51 | Ga0068852_100000380 | 3300005616 | Bacteria | 29923 |
| 52 | Ga0068852_100918678 | 3300005616 | Archaea | 893 |
| 53 | Ga0068864_100013601 | 3300005618 | Bacteria | 6747 |
| 54 | Ga0068866_10027358 | 3300005718 | Bacteria | 2703 |
| 55 | Ga0068866_10217667 | 3300005718 | Bacteria | 1150 |
| 56 | Ga0068866_10458337 | 3300005718 | Bacteria | 835 |
| 57 | Ga0068851_10081235 | 3300005834 | Bacteria | 1693 |
| 58 | Ga0068870_10016484 | 3300005840 | Bacteria | 3531 |
| 59 | Ga0068863_100045668 | 3300005841 | Bacteria | 4157 |
| 60 | Ga0068863_100092574 | 3300005841 | Bacteria | 2868 |
| 61 | Ga0068858_100606264 | 3300005842 | Bacteria | 1062 |
| 62 | Ga0070716_100742671 | 3300006173 | Unclassified | 754 |
| 63 | Ga0097621_100001161 | 3300006237 | Bacteria | 18255 |
| 64 | Ga0097621_100033038 | 3300006237 | Bacteria | 4117 |
| 65 | Ga0068871_100000811 | 3300006358 | Bacteria | 20992 |
| 66 | Ga0075434_100184217 | 3300006871 | Bacteria | 2109 |
| 67 | Ga0068865_100271288 | 3300006881 | Bacteria | 1347 |
| 68 | Ga0068865_100348235 | 3300006881 | Bacteria | 1199 |
| 69 | Ga0075436_100123686 | 3300006914 | Bacteria | 1812 |
| 70 | Ga0111539_10482807 | 3300009094 | Bacteria | 1443 |
| 71 | Ga0111539_10650770 | 3300009094 | Bacteria | 1227 |
| 72 | Ga0105243_10130324 | 3300009148 | Bacteria | 2133 |
| 73 | Ga0105243_10483541 | 3300009148 | Bacteria | 1169 |
| 74 | Ga0105248_10078020 | 3300009177 | Bacteria | 3724 |
| 75 | Ga0157373_10075210 | 3300013100 | Bacteria | 2383 |
| 76 | Ga0157374_10000304 | 3300013296 | Bacteria | 45616 |
| 77 | Ga0157374_10101340 | 3300013296 | Bacteria | 2761 |
| 78 | Ga0157378_10005133 | 3300013297 | Bacteria | 11498 |
| 79 | Ga0157375_10024454 | 3300013308 | Bacteria | 5590 |
| 80 | Ga0157375_10177866 | 3300013308 | Bacteria | 2278 |
| 81 | Ga0157375_11153685 | 3300013308 | Unclassified | 908 |
| 82 | Ga0157380_10496110 | 3300014326 | Bacteria | 1185 |
| 83 | Ga0157377_10032146 | 3300014745 | Bacteria | 2856 |
| 84 | Ga0157377_10169008 | 3300014745 | Bacteria | 1366 |
| 85 | Ga0157376_10042802 | 3300014969 | Bacteria | 3713 |
| 86 | Ga0163161_10220843 | 3300017792 | Bacteria | 1467 |
| 87 | Ga0207697_10095705 | 3300025315 | Bacteria | 1262 |
| 88 | Ga0207656_10042788 | 3300025321 | Bacteria | 1929 |
| 89 | Ga0207682_10000343 | 3300025893 | Bacteria | 21236 |
| 90 | Ga0207682_10047263 | 3300025893 | Bacteria | 1771 |
| 91 | Ga0207642_10164672 | 3300025899 | Bacteria | 1194 |
| 92 | Ga0207642_10346823 | 3300025899 | Bacteria | 875 |
| 93 | Ga0207688_10143382 | 3300025901 | Bacteria | 1407 |
| 94 | Ga0207680_10008354 | 3300025903 | Bacteria | 5077 |
| 95 | Ga0207705_10436412 | 3300025909 | Bacteria | 1015 |
| 96 | Ga0207684_10379895 | 3300025910 | Bacteria | 1215 |
| 97 | Ga0207707_10126255 | 3300025912 | Bacteria | 2237 |
| 98 | Ga0207707_10184446 | 3300025912 | Bacteria | 1821 |
| 99 | Ga0207660_10350845 | 3300025917 | Bacteria | 1182 |
| 100 | Ga0207660_11076210 | 3300025917 | Unclassified | 655 |
| 101 | Ga0207649_10009336 | 3300025920 | Bacteria | 5367 |
| 102 | Ga0207649_10090774 | 3300025920 | Bacteria | 2000 |
| 103 | Ga0207650_10003517 | 3300025925 | Bacteria | 10758 |
| 104 | Ga0207650_10063877 | 3300025925 | Bacteria | 2754 |
| 105 | Ga0207659_10002362 | 3300025926 | Bacteria | 11237 |
| 106 | Ga0207659_10008492 | 3300025926 | Bacteria | 6380 |
| 107 | Ga0207644_10001403 | 3300025931 | Bacteria | 15529 |
| 108 | Ga0207644_10085222 | 3300025931 | Bacteria | 2343 |
| 109 | Ga0207706_10117180 | 3300025933 | Bacteria | 2342 |
| 110 | Ga0207686_10263668 | 3300025934 | Bacteria | 1264 |
| 111 | Ga0207670_10199783 | 3300025936 | Bacteria | 1518 |
| 112 | Ga0207669_10015511 | 3300025937 | Bacteria | 3844 |
| 113 | Ga0207704_10256998 | 3300025938 | Bacteria | 1315 |
| 114 | Ga0207704_10357838 | 3300025938 | Bacteria | 1139 |
| 115 | Ga0207691_10000196 | 3300025940 | Bacteria | 58015 |
| 116 | Ga0207661_10177815 | 3300025944 | Bacteria | 1856 |
| 117 | Ga0207661_11248011 | 3300025944 | Bacteria | 683 |
| 118 | Ga0207679_10001021 | 3300025945 | Bacteria | 17888 |
| 119 | Ga0207651_10030799 | 3300025960 | Bacteria | 3421 |
| 120 | Ga0207651_10042623 | 3300025960 | Bacteria | 3022 |
| 121 | Ga0207640_10003758 | 3300025981 | Bacteria | 8182 |
| 122 | Ga0207658_10031380 | 3300025986 | Bacteria | 3772 |
| 123 | Ga0207658_10136090 | 3300025986 | Bacteria | 1981 |
| 124 | Ga0207678_10285097 | 3300026067 | Bacteria | 1418 |
| 125 | Ga0207708_10001754 | 3300026075 | Bacteria | 16016 |
| 126 | Ga0207708_10018649 | 3300026075 | Bacteria | 5226 |
| 127 | Ga0207641_10125599 | 3300026088 | Bacteria | 2296 |
| 128 | Ga0207641_10270472 | 3300026088 | Bacteria | 1594 |
| 129 | Ga0207648_10082808 | 3300026089 | Bacteria | 2798 |
| 130 | Ga0207676_10006899 | 3300026095 | Bacteria | 8049 |
| 131 | Ga0207676_10009027 | 3300026095 | Bacteria | 7097 |
| 132 | Ga0207674_10404320 | 3300026116 | Bacteria | 1319 |
| 133 | Ga0207675_100034244 | 3300026118 | Bacteria | 4735 |
| 134 | Ga0207683_10011395 | 3300026121 | Bacteria | 7586 |
| 135 | Ga0207698_10000360 | 3300026142 | Bacteria | 26761 |
| 136 | Ga0207698_11292328 | 3300026142 | Archaea | 744 |
| 137 | Ga0209969_1002904 | 3300027360 | Bacteria | 2371 |
| 138 | Ga0209969_1004918 | 3300027360 | Bacteria | 1868 |
| 139 | Ga0209967_1004556 | 3300027364 | Bacteria | 1844 |
| 140 | Ga0209996_1017417 | 3300027395 | Bacteria | 992 |
| 141 | Ga0209984_1001646 | 3300027424 | Bacteria | 2432 |
| 142 | Ga0209984_1029893 | 3300027424 | Bacteria | 768 |
| 143 | Ga0210000_1000899 | 3300027462 | Bacteria | 4140 |
| 144 | Ga0210000_1035541 | 3300027462 | Bacteria | 785 |
| 145 | Ga0209995_1000430 | 3300027471 | Bacteria | 6470 |
| 146 | Ga0209968_1005835 | 3300027526 | Bacteria | 1851 |
| 147 | Ga0209999_1027216 | 3300027543 | Bacteria | 1058 |
| 148 | Ga0209983_1008538 | 3300027665 | Bacteria | 2095 |
| 149 | Ga0209966_1015493 | 3300027695 | Bacteria | 1432 |
| 150 | Ga0209974_10007659 | 3300027876 | Bacteria | 3714 |
| 151 | Ga0209974_10036805 | 3300027876 | Bacteria | 1625 |
| 152 | Ga0268265_10065560 | 3300028380 | Bacteria | 2803 |
| 153 | Ga0265323_10022236 | 3300028653 | Bacteria | 2424 |
| 154 | Ga0265338_10213835 | 3300028800 | Bacteria | 1445 |
| 155 | Ga0265324_10027896 | 3300029957 | Bacteria | 1993 |
| 156 | Ga0265332_10003891 | 3300031238 | Bacteria | 7124 |
| 157 | Ga0265328_10002740 | 3300031239 | Bacteria | 7882 |
| 158 | Ga0265320_10048835 | 3300031240 | Bacteria | 2063 |
| 159 | Ga0265331_10002398 | 3300031250 | Bacteria | 12700 |
| 160 | Ga0265327_10031566 | 3300031251 | Bacteria | 2974 |
| 161 | Ga0265327_10043783 | 3300031251 | Bacteria | 2392 |
| 162 | Ga0265316_10039350 | 3300031344 | Bacteria | 3798 |
| 163 | Ga0265316_10097114 | 3300031344 | Bacteria | 2243 |
| 164 | Ga0265316_10119820 | 3300031344 | Bacteria | 1988 |
| 165 | Ga0265316_10261395 | 3300031344 | Bacteria | 1269 |
| 166 | Ga0265316_10619008 | 3300031344 | Bacteria | 767 |
| 167 | Ga0265316_10637671 | 3300031344 | Bacteria | 754 |
| 168 | Ga0307509_10000006 | 3300031507 | Bacteria | 421538 |
| 169 | Ga0307408_100764848 | 3300031548 | Bacteria | 874 |
| 170 | Ga0265314_10000245 | 3300031711 | Bacteria | 79757 |
| 171 | Ga0265342_10082828 | 3300031712 | Bacteria | 1850 |
| 172 | Ga0307413_10269819 | 3300031824 | Bacteria | 1273 |
| 173 | Ga0307406_10441120 | 3300031901 | Bacteria | 1042 |
| 174 | Ga0373959_0051684 | 3300034820 | Bacteria | 889 |
| 175 | Ga0373929_0084695 | 3300035085 | Bacteria | 778 |
| 176 | Ga0373952_0000128 | 3300035092 | Bacteria | 10746 |
| 177 | Ga0373942_0039029 | 3300035207 | Bacteria | 1290 |
| 178 | Ga0373961_0049245 | 3300035241 | Bacteria | 1245 |
| 179 | Ga0373931_0745392 | 3300035691 | Unclassified | 650 |
| 180 | Ga0451577_0005018 | 3300042876 | Bacteria | 13695 |
| 181 | Ga0451577_0180303 | 3300042876 | Bacteria | 1904 |
| 182 | Ga0451577_0199243 | 3300042876 | Bacteria | 1807 |
| 183 | Ga0451577_0422056 | 3300042876 | Bacteria | 1211 |
| 184 | Ga0451577_0478548 | 3300042876 | Bacteria | 1130 |
| 185 | Ga0453683_0041056 | 3300044673 | Bacteria | 2905 |
| 186 | Ga0453683_0342900 | 3300044673 | Bacteria | 959 |
| 187 | Ga0453684_0000163 | 3300044712 | Bacteria | 296196 |
| 188 | Ga0453684_0004902 | 3300044712 | Bacteria | 27396 |
| 189 | Ga0453684_0005751 | 3300044712 | Bacteria | 24224 |
| 190 | Ga0453684_0008183 | 3300044712 | Bacteria | 18861 |
| 191 | Ga0453684_0083731 | 3300044712 | Bacteria | 3969 |
| 192 | Ga0453684_0123369 | 3300044712 | Bacteria | 3123 |
| 193 | Ga0453684_0887018 | 3300044712 | Bacteria | 956 |
| 194 | Ga0451576_0000738 | 3300045051 | Bacteria | 65424 |
| 195 | Ga0451576_0000845 | 3300045051 | Bacteria | 59543 |
| 196 | Ga0451576_0012728 | 3300045051 | Bacteria | 9445 |
| 197 | Ga0451576_0042535 | 3300045051 | Bacteria | 4796 |
| 198 | Ga0451576_0070741 | 3300045051 | Bacteria | 3631 |
| 199 | Ga0451576_0142826 | 3300045051 | Bacteria | 2496 |
| 200 | Ga0451576_0151749 | 3300045051 | Bacteria | 2416 |
| 201 | Ga0451576_0313395 | 3300045051 | Bacteria | 1641 |
| 202 | Ga0451576_0591936 | 3300045051 | Bacteria | 1166 |
| 203 | Ga0451576_1421482 | 3300045051 | Bacteria | 722 |
| 204 | Ga0451576_1430325 | 3300045051 | Bacteria | 719 |
| 205 | Ga0451576_1866595 | 3300045051 | Bacteria | 620 |
| 206 | Ga0495629_0390575 | 3300046459 | Bacteria | 946 |
| 207 | Ga0495642_0118439 | 3300046528 | Bacteria | 1135 |
| 208 | Ga0495658_0014998 | 3300046683 | Bacteria | 3970 |
| 209 | Ga0496102_0085124 | 3300048905 | Bacteria | 2919 |
| 210 | Ga0496104_0055946 | 3300048907 | Bacteria | 3730 |
| 211 | Ga0496104_0334284 | 3300048907 | Bacteria | 1428 |
| 212 | Ga0496108_0013458 | 3300048911 | Bacteria | 6674 |
| 213 | Ga0496109_0013179 | 3300048912 | Bacteria | 7155 |
| 214 | Ga0496109_0674511 | 3300048912 | Unclassified | 971 |
| 215 | Ga0496110_0082254 | 3300048913 | Bacteria | 2871 |
| 216 | Ga0496111_0006494 | 3300048914 | Bacteria | 7597 |
| 217 | Ga0496113_0128700 | 3300048916 | Bacteria | 1985 |
| 218 | Ga0496113_0334068 | 3300048916 | Bacteria | 1215 |
| 219 | Ga0496114_0558230 | 3300048917 | Bacteria | 1011 |
| 220 | Ga0501034_0036478 | 3300049571 | Bacteria | 4980 |
| 221 | Ga0501034_0123264 | 3300049571 | Bacteria | 2577 |
| 222 | Ga0501034_0656265 | 3300049571 | Bacteria | 950 |
| 223 | Ga0501036_0077947 | 3300049572 | Bacteria | 2803 |
| 224 | Ga0501037_0010855 | 3300049573 | Bacteria | 6693 |
| 225 | Ga0501038_0014267 | 3300049574 | Bacteria | 7239 |
| 226 | Ga0501038_0021458 | 3300049574 | Bacteria | 5795 |
| 227 | Ga0501038_0370080 | 3300049574 | Bacteria | 1113 |
| 228 | Ga0501039_0056751 | 3300049575 | Bacteria | 3033 |
| 229 | Ga0501039_0150479 | 3300049575 | Bacteria | 1828 |
| 230 | Ga0501040_0000717 | 3300049576 | Bacteria | 20471 |
| 231 | Ga0501041_0325692 | 3300049577 | Bacteria | 969 |
| 232 | Ga0501042_0002650 | 3300049578 | Bacteria | 11010 |
| 233 | Ga0501042_0031837 | 3300049578 | Bacteria | 3731 |
| 234 | Ga0501042_0190881 | 3300049578 | Bacteria | 1478 |
| 235 | Ga0501042_0521821 | 3300049578 | Bacteria | 863 |
| 236 | Ga0501043_0035235 | 3300049579 | Bacteria | 3936 |
| 237 | Ga0501046_0014108 | 3300049580 | Bacteria | 6747 |
| 238 | Ga0501046_0057115 | 3300049580 | Bacteria | 3062 |
| 239 | Ga0501048_0012583 | 3300049582 | Bacteria | 6293 |
| 240 | Ga0501048_0030924 | 3300049582 | Bacteria | 3875 |
| 241 | Ga0501069_0587389 | 3300049585 | Bacteria | 668 |
| 242 | Ga0501071_0155126 | 3300049587 | Bacteria | 1709 |
| 243 | Ga0501072_0012122 | 3300049588 | Bacteria | 6586 |
| 244 | Ga0501074_0177906 | 3300049590 | Bacteria | 1518 |
| 245 | Ga0501075_0004968 | 3300049591 | Bacteria | 9067 |
| 246 | Ga0501075_0353203 | 3300049591 | Bacteria | 1120 |
| 247 | Ga0501076_0002014 | 3300049592 | Bacteria | 13893 |
| 248 | Ga0501076_0238565 | 3300049592 | Bacteria | 1487 |
| 249 | Ga0501077_0055508 | 3300049593 | Bacteria | 2515 |
| 250 | Ga0501079_0094865 | 3300049741 | Bacteria | 2312 |
| 251 | Ga0501080_0012150 | 3300049742 | Bacteria | 7890 |
| 252 | Ga0501080_0194568 | 3300049742 | Bacteria | 1863 |
| 253 | Ga0501081_0237873 | 3300049743 | Bacteria | 1327 |
| 254 | Ga0501035_0205882 | 3300049822 | Bacteria | 1685 |
| 255 | Ga0501044_0018905 | 3300049823 | Bacteria | 7377 |
| 256 | Ga0501045_0003754 | 3300049824 | Bacteria | 10446 |
| 257 | Ga0501045_0008758 | 3300049824 | Bacteria | 7060 |
| 258 | nmdc:mga06r32_1595_c1 | 3300050510 | Bacteria | 20426 |
| 259 | nmdc:mga08y16_326384_c1 | 3300050511 | Bacteria | 1579 |
| 260 | nmdc:mga0n895_113085_c1 | 3300050512 | Bacteria | 2732 |
| 261 | nmdc:mga0rr50_700990_c1 | 3300050513 | Bacteria | 864 |
| 262 | nmdc:mga08x19_166471_c1 | 3300050514 | Bacteria | 1499 |
| 263 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 264 | Ga0501084_0232096 | 3300054114 | Bacteria | 1557 |
| 265 | Ga0501082_0005377 | 3300060353 | Bacteria | 11113 |
| 266 | Ga0530510_0001310 | 3300061734 | Bacteria | 16625 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0313395 | Ga0451576_0313395_1049_1573 | 145 |
| 2 | 3300031251 | Ga0265327_10043783 | Ga0265327_100437832 | 146 |
| 3 | 3300042876 | Ga0451577_0005018 | Ga0451577_0005018_3865_4401 | 146 |
| 4 | 3300044712 | Ga0453684_0123369 | Ga0453684_0123369_1423_1947 | 146 |
| 5 | 3300045051 | Ga0451576_0000845 | Ga0451576_0000845_7075_7611 | 146 |
| 6 | 3300045051 | Ga0451576_0151749 | Ga0451576_0151749_816_1352 | 146 |
| 7 | 3300035691 | Ga0373931_0745392 | Ga0373931_0745392_35_562 | 150 |
| 8 | 3300005458 | Ga0070681_10078831 | Ga0070681_100788312 | 151 |
| 9 | 3300025912 | Ga0207707_10184446 | Ga0207707_101844462 | 151 |
| 10 | 3300031251 | Ga0265327_10031566 | Ga0265327_100315662 | 151 |
| 11 | 3300031344 | Ga0265316_10637671 | Ga0265316_106376711 | 152 |
| 12 | 3300045051 | Ga0451576_0042535 | Ga0451576_0042535_3368_3904 | 152 |
| 13 | 3300005536 | Ga0070697_100399861 | Ga0070697_1003998612 | 153 |
| 14 | 3300042876 | Ga0451577_0478548 | Ga0451577_0478548_433_990 | 153 |
| 15 | 3300044712 | Ga0453684_0004902 | Ga0453684_0004902_534_1091 | 153 |
| 16 | 3300044712 | Ga0453684_0005751 | Ga0453684_0005751_22454_23014 | 153 |
| 17 | 3300045051 | Ga0451576_0000738 | Ga0451576_0000738_64112_64669 | 153 |
| 18 | 3300049574 | Ga0501038_0370080 | Ga0501038_0370080_224_781 | 153 |
| 19 | 3300049577 | Ga0501041_0325692 | Ga0501041_0325692_126_713 | 153 |
| 20 | 3300049578 | Ga0501042_0002650 | Ga0501042_0002650_7103_7690 | 153 |
| 21 | 3300049578 | Ga0501042_0521821 | Ga0501042_0521821_288_845 | 153 |
| 22 | 3300049580 | Ga0501046_0057115 | Ga0501046_0057115_2353_2922 | 153 |
| 23 | 3300049582 | Ga0501048_0030924 | Ga0501048_0030924_1966_2553 | 153 |
| 24 | 3300049587 | Ga0501071_0155126 | Ga0501071_0155126_1026_1613 | 153 |
| 25 | 3300049588 | Ga0501072_0012122 | Ga0501072_0012122_5408_5977 | 153 |
| 26 | 3300049590 | Ga0501074_0177906 | Ga0501074_0177906_125_712 | 153 |
| 27 | 3300049591 | Ga0501075_0004968 | Ga0501075_0004968_1515_2102 | 153 |
| 28 | 3300049591 | Ga0501075_0353203 | Ga0501075_0353203_368_925 | 153 |
| 29 | 3300049592 | Ga0501076_0002014 | Ga0501076_0002014_11160_11747 | 153 |
| 30 | 3300049592 | Ga0501076_0238565 | Ga0501076_0238565_37_594 | 153 |
| 31 | 3300049593 | Ga0501077_0055508 | Ga0501077_0055508_346_933 | 153 |
| 32 | 3300049741 | Ga0501079_0094865 | Ga0501079_0094865_1450_2037 | 153 |
| 33 | 3300049742 | Ga0501080_0012150 | Ga0501080_0012150_7020_7607 | 153 |
| 34 | 3300049742 | Ga0501080_0194568 | Ga0501080_0194568_370_927 | 153 |
| 35 | 3300049743 | Ga0501081_0237873 | Ga0501081_0237873_624_1211 | 153 |
| 36 | 3300049824 | Ga0501045_0008758 | Ga0501045_0008758_6383_6970 | 153 |
| 37 | 3300054114 | Ga0501084_0232096 | Ga0501084_0232096_841_1428 | 153 |
| 38 | 3300060353 | Ga0501082_0005377 | Ga0501082_0005377_608_1195 | 153 |
| 39 | 3300061734 | Ga0530510_0001310 | Ga0530510_0001310_12274_12861 | 153 |
| 40 | iso_pu_bacteria | 2526164512 | 2526211175 | 157 |
| 41 | 3300042876 | Ga0451577_0199243 | Ga0451577_0199243_1098_1652 | 158 |
| 42 | 3300044712 | Ga0453684_0000163 | Ga0453684_0000163_78118_78672 | 158 |
| 43 | 3300045051 | Ga0451576_0070741 | Ga0451576_0070741_867_1421 | 158 |
| 44 | 3300005329 | Ga0070683_101372181 | Ga0070683_1013721811 | 159 |
| 45 | 3300005545 | Ga0070695_100133887 | Ga0070695_1001338872 | 159 |
| 46 | 3300009094 | Ga0111539_10650770 | Ga0111539_106507701 | 159 |
| 47 | 3300014326 | Ga0157380_10496110 | Ga0157380_104961102 | 159 |
| 48 | 3300025944 | Ga0207661_11248011 | Ga0207661_112480111 | 159 |
| 49 | 3300031344 | Ga0265316_10097114 | Ga0265316_100971142 | 159 |
| 50 | 3300031344 | Ga0265316_10619008 | Ga0265316_106190082 | 159 |
| 51 | 3300031711 | Ga0265314_10000245 | Ga0265314_1000024573 | 159 |
| 52 | 3300035092 | Ga0373952_0000128 | Ga0373952_0000128_8937_9458 | 159 |
| 53 | 3300046528 | Ga0495642_0118439 | Ga0495642_0118439_190_756 | 159 |
| 54 | 3300050511 | nmdc:mga08y16_326384_c1 | nmdc:mga08y16_326384_c1_933_1493 | 159 |
| 55 | 3300005336 | Ga0070680_100260643 | Ga0070680_1002606431 | 160 |
| 56 | 3300005444 | Ga0070694_100078909 | Ga0070694_1000789092 | 160 |
| 57 | 3300005549 | Ga0070704_100021085 | Ga0070704_1000210852 | 160 |
| 58 | 3300025917 | Ga0207660_10350845 | Ga0207660_103508452 | 160 |
| 59 | 3300031238 | Ga0265332_10003891 | Ga0265332_100038911 | 160 |
| 60 | 3300031239 | Ga0265328_10002740 | Ga0265328_100027404 | 160 |
| 61 | 3300031240 | Ga0265320_10048835 | Ga0265320_100488352 | 160 |
| 62 | 3300031250 | Ga0265331_10002398 | Ga0265331_100023983 | 160 |
| 63 | 3300031344 | Ga0265316_10039350 | Ga0265316_100393501 | 160 |
| 64 | 3300031712 | Ga0265342_10082828 | Ga0265342_100828281 | 160 |
| 65 | 3300045051 | Ga0451576_1866595 | Ga0451576_1866595_13_567 | 160 |
| 66 | 3300049571 | Ga0501034_0656265 | Ga0501034_0656265_244_807 | 160 |
| 67 | 3300005328 | Ga0070676_10607404 | Ga0070676_106074041 | 161 |
| 68 | 3300005333 | Ga0070677_10022629 | Ga0070677_100226291 | 161 |
| 69 | 3300005335 | Ga0070666_10120953 | Ga0070666_101209531 | 161 |
| 70 | 3300005356 | Ga0070674_100156611 | Ga0070674_1001566112 | 161 |
| 71 | 3300005456 | Ga0070678_100007489 | Ga0070678_1000074892 | 161 |
| 72 | 3300005459 | Ga0068867_100016980 | Ga0068867_1000169802 | 161 |
| 73 | 3300005616 | Ga0068852_100918678 | Ga0068852_1009186781 | 161 |
| 74 | 3300005718 | Ga0068866_10027358 | Ga0068866_100273582 | 161 |
| 75 | 3300006237 | Ga0097621_100033038 | Ga0097621_1000330382 | 161 |
| 76 | 3300009148 | Ga0105243_10130324 | Ga0105243_101303242 | 161 |
| 77 | 3300013296 | Ga0157374_10101340 | Ga0157374_101013401 | 161 |
| 78 | 3300013308 | Ga0157375_10177866 | Ga0157375_101778663 | 161 |
| 79 | 3300017792 | Ga0163161_10220843 | Ga0163161_102208431 | 161 |
| 80 | 3300025315 | Ga0207697_10095705 | Ga0207697_100957052 | 161 |
| 81 | 3300025893 | Ga0207682_10000343 | Ga0207682_100003436 | 161 |
| 82 | 3300025934 | Ga0207686_10263668 | Ga0207686_102636682 | 161 |
| 83 | 3300025937 | Ga0207669_10015511 | Ga0207669_100155113 | 161 |
| 84 | 3300026075 | Ga0207708_10018649 | Ga0207708_100186492 | 161 |
| 85 | 3300026116 | Ga0207674_10404320 | Ga0207674_104043202 | 161 |
| 86 | 3300026118 | Ga0207675_100034244 | Ga0207675_1000342442 | 161 |
| 87 | 3300026142 | Ga0207698_11292328 | Ga0207698_112923281 | 161 |
| 88 | 3300027424 | Ga0209984_1029893 | Ga0209984_10298932 | 161 |
| 89 | 3300027462 | Ga0210000_1035541 | Ga0210000_10355411 | 161 |
| 90 | 3300027876 | Ga0209974_10036805 | Ga0209974_100368052 | 161 |
| 91 | 3300048916 | Ga0496113_0128700 | Ga0496113_0128700_545_1060 | 161 |
| 92 | 3300053156 | Ga0500622_0000002 | Ga0500622_0000002_514371_514889 | 161 |
| 93 | 3300005338 | Ga0068868_100059865 | Ga0068868_1000598653 | 162 |
| 94 | 3300005354 | Ga0070675_100029011 | Ga0070675_1000290112 | 162 |
| 95 | 3300005355 | Ga0070671_100050012 | Ga0070671_1000500124 | 162 |
| 96 | 3300005364 | Ga0070673_100045341 | Ga0070673_1000453412 | 162 |
| 97 | 3300005367 | Ga0070667_100205497 | Ga0070667_1002054971 | 162 |
| 98 | 3300005441 | Ga0070700_100023208 | Ga0070700_1000232082 | 162 |
| 99 | 3300005441 | Ga0070700_100232219 | Ga0070700_1002322192 | 162 |
| 100 | 3300005444 | Ga0070694_100092110 | Ga0070694_1000921103 | 162 |
| 101 | 3300005456 | Ga0070678_100568484 | Ga0070678_1005684841 | 162 |
| 102 | 3300005564 | Ga0070664_100145521 | Ga0070664_1001455212 | 162 |
| 103 | 3300005718 | Ga0068866_10458337 | Ga0068866_104583372 | 162 |
| 104 | 3300005840 | Ga0068870_10016484 | Ga0068870_100164843 | 162 |
| 105 | 3300005841 | Ga0068863_100045668 | Ga0068863_1000456682 | 162 |
| 106 | 3300006881 | Ga0068865_100271288 | Ga0068865_1002712882 | 162 |
| 107 | 3300009094 | Ga0111539_10482807 | Ga0111539_104828072 | 162 |
| 108 | 3300009148 | Ga0105243_10483541 | Ga0105243_104835412 | 162 |
| 109 | 3300014745 | Ga0157377_10032146 | Ga0157377_100321462 | 162 |
| 110 | 3300025899 | Ga0207642_10346823 | Ga0207642_103468232 | 162 |
| 111 | 3300025901 | Ga0207688_10143382 | Ga0207688_101433823 | 162 |
| 112 | 3300025920 | Ga0207649_10090774 | Ga0207649_100907743 | 162 |
| 113 | 3300025925 | Ga0207650_10063877 | Ga0207650_100638772 | 162 |
| 114 | 3300025926 | Ga0207659_10008492 | Ga0207659_100084924 | 162 |
| 115 | 3300025931 | Ga0207644_10085222 | Ga0207644_100852221 | 162 |
| 116 | 3300025936 | Ga0207670_10199783 | Ga0207670_101997832 | 162 |
| 117 | 3300025938 | Ga0207704_10357838 | Ga0207704_103578382 | 162 |
| 118 | 3300025960 | Ga0207651_10030799 | Ga0207651_100307993 | 162 |
| 119 | 3300025986 | Ga0207658_10136090 | Ga0207658_101360903 | 162 |
| 120 | 3300026075 | Ga0207708_10001754 | Ga0207708_1000175411 | 162 |
| 121 | 3300026088 | Ga0207641_10270472 | Ga0207641_102704723 | 162 |
| 122 | 3300026095 | Ga0207676_10009027 | Ga0207676_100090278 | 162 |
| 123 | 3300028380 | Ga0268265_10065560 | Ga0268265_100655603 | 162 |
| 124 | 3300046459 | Ga0495629_0390575 | Ga0495629_0390575_355_921 | 162 |
| 125 | 3300046683 | Ga0495658_0014998 | Ga0495658_0014998_2173_2739 | 162 |
| 126 | 3300048912 | Ga0496109_0674511 | Ga0496109_0674511_28_594 | 162 |
| 127 | 3300049585 | Ga0501069_0587389 | Ga0501069_0587389_10_591 | 162 |
| 128 | 3300035207 | Ga0373942_0039029 | Ga0373942_0039029_648_1154 | 163 |
| 129 | 3300045051 | Ga0451576_0012728 | Ga0451576_0012728_8405_8971 | 163 |
| 130 | 3300050513 | nmdc:mga0rr50_700990_c1 | nmdc:mga0rr50_700990_c1_304_843 | 163 |
| 131 | 3300029957 | Ga0265324_10027896 | Ga0265324_100278962 | 164 |
| 132 | 3300031548 | Ga0307408_100764848 | Ga0307408_1007648481 | 164 |
| 133 | 3300031824 | Ga0307413_10269819 | Ga0307413_102698192 | 164 |
| 134 | 3300031901 | Ga0307406_10441120 | Ga0307406_104411202 | 164 |
| 135 | 3300050510 | nmdc:mga06r32_1595_c1 | nmdc:mga06r32_1595_c1_15732_16277 | 164 |
| 136 | 3300044673 | Ga0453683_0041056 | Ga0453683_0041056_429_986 | 165 |
| 137 | 3300044673 | Ga0453683_0342900 | Ga0453683_0342900_235_798 | 165 |
| 138 | 3300045051 | Ga0451576_0142826 | Ga0451576_0142826_1335_1904 | 165 |
| 139 | 3300045051 | Ga0451576_1430325 | Ga0451576_1430325_69_623 | 165 |
| 140 | 3300049578 | Ga0501042_0190881 | Ga0501042_0190881_749_1294 | 165 |
| 141 | iso_pu_bacteria | 2891633521 | 2891634728 | 165 |
| 142 | 3300005530 | Ga0070679_100794767 | Ga0070679_1007947671 | 166 |
| 143 | 3300006914 | Ga0075436_100123686 | Ga0075436_1001236862 | 166 |
| 144 | 3300027360 | Ga0209969_1002904 | Ga0209969_10029042 | 166 |
| 145 | 3300027360 | Ga0209969_1004918 | Ga0209969_10049182 | 166 |
| 146 | 3300027364 | Ga0209967_1004556 | Ga0209967_10045562 | 166 |
| 147 | 3300027395 | Ga0209996_1017417 | Ga0209996_10174172 | 166 |
| 148 | 3300027424 | Ga0209984_1001646 | Ga0209984_10016462 | 166 |
| 149 | 3300027462 | Ga0210000_1000899 | Ga0210000_10008993 | 166 |
| 150 | 3300027471 | Ga0209995_1000430 | Ga0209995_10004303 | 166 |
| 151 | 3300027526 | Ga0209968_1005835 | Ga0209968_10058352 | 166 |
| 152 | 3300027543 | Ga0209999_1027216 | Ga0209999_10272162 | 166 |
| 153 | 3300027665 | Ga0209983_1008538 | Ga0209983_10085382 | 166 |
| 154 | 3300027695 | Ga0209966_1015493 | Ga0209966_10154932 | 166 |
| 155 | 3300027876 | Ga0209974_10007659 | Ga0209974_100076592 | 166 |
| 156 | 3300031507 | Ga0307509_10000006 | Ga0307509_10000006360 | 166 |
| 157 | 3300034820 | Ga0373959_0051684 | Ga0373959_0051684_268_822 | 166 |
| 158 | 3300035085 | Ga0373929_0084695 | Ga0373929_0084695_184_738 | 166 |
| 159 | 3300035241 | Ga0373961_0049245 | Ga0373961_0049245_583_1137 | 166 |
| 160 | 3300048907 | Ga0496104_0334284 | Ga0496104_0334284_591_1139 | 166 |
| 161 | 3300050514 | nmdc:mga08x19_166471_c1 | nmdc:mga08x19_166471_c1_619_1173 | 166 |
| 162 | iso_pu_bacteria | 2574179768 | 2574431013 | 166 |
| 163 | 3300005578 | Ga0068854_100004097 | Ga0068854_1000040976 | 167 |
| 164 | 3300005618 | Ga0068864_100013601 | Ga0068864_1000136017 | 167 |
| 165 | 3300005841 | Ga0068863_100092574 | Ga0068863_1000925742 | 167 |
| 166 | 3300006237 | Ga0097621_100001161 | Ga0097621_1000011612 | 167 |
| 167 | 3300025903 | Ga0207680_10008354 | Ga0207680_100083543 | 167 |
| 168 | 3300025920 | Ga0207649_10009336 | Ga0207649_100093362 | 167 |
| 169 | 3300025925 | Ga0207650_10003517 | Ga0207650_100035175 | 167 |
| 170 | 3300025926 | Ga0207659_10002362 | Ga0207659_1000236212 | 167 |
| 171 | 3300025931 | Ga0207644_10001403 | Ga0207644_1000140316 | 167 |
| 172 | 3300025933 | Ga0207706_10117180 | Ga0207706_101171802 | 167 |
| 173 | 3300025945 | Ga0207679_10001021 | Ga0207679_1000102114 | 167 |
| 174 | 3300025960 | Ga0207651_10042623 | Ga0207651_100426232 | 167 |
| 175 | 3300025981 | Ga0207640_10003758 | Ga0207640_100037583 | 167 |
| 176 | 3300025986 | Ga0207658_10031380 | Ga0207658_100313804 | 167 |
| 177 | 3300026088 | Ga0207641_10125599 | Ga0207641_101255992 | 167 |
| 178 | 3300026095 | Ga0207676_10006899 | Ga0207676_100068992 | 167 |
| 179 | 3300026142 | Ga0207698_10000360 | Ga0207698_1000036019 | 167 |
| 180 | 3300031344 | Ga0265316_10119820 | Ga0265316_101198202 | 167 |
| 181 | 3300042876 | Ga0451577_0180303 | Ga0451577_0180303_1080_1634 | 167 |
| 182 | 3300042876 | Ga0451577_0422056 | Ga0451577_0422056_389_946 | 167 |
| 183 | 3300044712 | Ga0453684_0008183 | Ga0453684_0008183_16894_17460 | 167 |
| 184 | 3300044712 | Ga0453684_0083731 | Ga0453684_0083731_2457_3011 | 167 |
| 185 | 3300048905 | Ga0496102_0085124 | Ga0496102_0085124_1086_1625 | 167 |
| 186 | 3300048907 | Ga0496104_0055946 | Ga0496104_0055946_1565_2104 | 167 |
| 187 | 3300048911 | Ga0496108_0013458 | Ga0496108_0013458_3623_4162 | 167 |
| 188 | 3300048912 | Ga0496109_0013179 | Ga0496109_0013179_2997_3536 | 167 |
| 189 | 3300048913 | Ga0496110_0082254 | Ga0496110_0082254_1781_2320 | 167 |
| 190 | 3300048914 | Ga0496111_0006494 | Ga0496111_0006494_5717_6256 | 167 |
| 191 | 3300048916 | Ga0496113_0334068 | Ga0496113_0334068_85_624 | 167 |
| 192 | 3300048917 | Ga0496114_0558230 | Ga0496114_0558230_241_780 | 167 |
| 193 | 3300028653 | Ga0265323_10022236 | Ga0265323_100222361 | 168 |
| 194 | 3300031344 | Ga0265316_10261395 | Ga0265316_102613952 | 168 |
| 195 | 3300044712 | Ga0453684_0887018 | Ga0453684_0887018_96_665 | 168 |
| 196 | 3300045051 | Ga0451576_0591936 | Ga0451576_0591936_64_636 | 168 |
| 197 | 3300045051 | Ga0451576_1421482 | Ga0451576_1421482_93_650 | 168 |
| 198 | 3300005328 | Ga0070676_10164279 | Ga0070676_101642791 | 169 |
| 199 | 3300005329 | Ga0070683_100143143 | Ga0070683_1001431432 | 169 |
| 200 | 3300005331 | Ga0070670_100001183 | Ga0070670_10000118317 | 169 |
| 201 | 3300005333 | Ga0070677_10059100 | Ga0070677_100591002 | 169 |
| 202 | 3300005335 | Ga0070666_10009457 | Ga0070666_100094575 | 169 |
| 203 | 3300005338 | Ga0068868_100000563 | Ga0068868_10000056321 | 169 |
| 204 | 3300005344 | Ga0070661_100005436 | Ga0070661_1000054362 | 169 |
| 205 | 3300005354 | Ga0070675_100001483 | Ga0070675_10000148317 | 169 |
| 206 | 3300005355 | Ga0070671_100001086 | Ga0070671_10000108616 | 169 |
| 207 | 3300005356 | Ga0070674_100033854 | Ga0070674_1000338542 | 169 |
| 208 | 3300005364 | Ga0070673_100008418 | Ga0070673_1000084182 | 169 |
| 209 | 3300005367 | Ga0070667_100046501 | Ga0070667_1000465012 | 169 |
| 210 | 3300005444 | Ga0070694_100114213 | Ga0070694_1001142132 | 169 |
| 211 | 3300005455 | Ga0070663_100249529 | Ga0070663_1002495292 | 169 |
| 212 | 3300005456 | Ga0070678_100000081 | Ga0070678_10000008134 | 169 |
| 213 | 3300005457 | Ga0070662_100048829 | Ga0070662_1000488293 | 169 |
| 214 | 3300005458 | Ga0070681_10033093 | Ga0070681_100330932 | 169 |
| 215 | 3300005459 | Ga0068867_100047967 | Ga0068867_1000479673 | 169 |
| 216 | 3300005467 | Ga0070706_100030455 | Ga0070706_1000304553 | 169 |
| 217 | 3300005468 | Ga0070707_100050434 | Ga0070707_1000504343 | 169 |
| 218 | 3300005535 | Ga0070684_100026105 | Ga0070684_1000261056 | 169 |
| 219 | 3300005536 | Ga0070697_100124968 | Ga0070697_1001249683 | 169 |
| 220 | 3300005543 | Ga0070672_100000196 | Ga0070672_10000019629 | 169 |
| 221 | 3300005564 | Ga0070664_100008946 | Ga0070664_1000089467 | 169 |
| 222 | 3300005615 | Ga0070702_100061600 | Ga0070702_1000616003 | 169 |
| 223 | 3300005616 | Ga0068852_100000380 | Ga0068852_10000038014 | 169 |
| 224 | 3300005718 | Ga0068866_10217667 | Ga0068866_102176672 | 169 |
| 225 | 3300005834 | Ga0068851_10081235 | Ga0068851_100812352 | 169 |
| 226 | 3300005842 | Ga0068858_100606264 | Ga0068858_1006062641 | 169 |
| 227 | 3300006173 | Ga0070716_100742671 | Ga0070716_1007426711 | 169 |
| 228 | 3300006358 | Ga0068871_100000811 | Ga0068871_10000081113 | 169 |
| 229 | 3300006871 | Ga0075434_100184217 | Ga0075434_1001842173 | 169 |
| 230 | 3300006881 | Ga0068865_100348235 | Ga0068865_1003482352 | 169 |
| 231 | 3300009177 | Ga0105248_10078020 | Ga0105248_100780203 | 169 |
| 232 | 3300013100 | Ga0157373_10075210 | Ga0157373_100752102 | 169 |
| 233 | 3300013296 | Ga0157374_10000304 | Ga0157374_1000030414 | 169 |
| 234 | 3300013297 | Ga0157378_10005133 | Ga0157378_100051339 | 169 |
| 235 | 3300013308 | Ga0157375_10024454 | Ga0157375_100244546 | 169 |
| 236 | 3300013308 | Ga0157375_11153685 | Ga0157375_111536851 | 169 |
| 237 | 3300014745 | Ga0157377_10169008 | Ga0157377_101690081 | 169 |
| 238 | 3300014969 | Ga0157376_10042802 | Ga0157376_100428022 | 169 |
| 239 | 3300025321 | Ga0207656_10042788 | Ga0207656_100427883 | 169 |
| 240 | 3300025893 | Ga0207682_10047263 | Ga0207682_100472632 | 169 |
| 241 | 3300025899 | Ga0207642_10164672 | Ga0207642_101646722 | 169 |
| 242 | 3300025909 | Ga0207705_10436412 | Ga0207705_104364122 | 169 |
| 243 | 3300025910 | Ga0207684_10379895 | Ga0207684_103798951 | 169 |
| 244 | 3300025912 | Ga0207707_10126255 | Ga0207707_101262551 | 169 |
| 245 | 3300025917 | Ga0207660_11076210 | Ga0207660_110762101 | 169 |
| 246 | 3300025938 | Ga0207704_10256998 | Ga0207704_102569982 | 169 |
| 247 | 3300025940 | Ga0207691_10000196 | Ga0207691_1000019621 | 169 |
| 248 | 3300025944 | Ga0207661_10177815 | Ga0207661_101778153 | 169 |
| 249 | 3300026067 | Ga0207678_10285097 | Ga0207678_102850972 | 169 |
| 250 | 3300026089 | Ga0207648_10082808 | Ga0207648_100828082 | 169 |
| 251 | 3300026121 | Ga0207683_10011395 | Ga0207683_100113952 | 169 |
| 252 | 3300028800 | Ga0265338_10213835 | Ga0265338_102138351 | 169 |
| 253 | 3300049571 | Ga0501034_0036478 | Ga0501034_0036478_1725_2312 | 169 |
| 254 | 3300049571 | Ga0501034_0123264 | Ga0501034_0123264_791_1378 | 169 |
| 255 | 3300049572 | Ga0501036_0077947 | Ga0501036_0077947_337_924 | 169 |
| 256 | 3300049573 | Ga0501037_0010855 | Ga0501037_0010855_1976_2563 | 169 |
| 257 | 3300049574 | Ga0501038_0014267 | Ga0501038_0014267_6558_7145 | 169 |
| 258 | 3300049574 | Ga0501038_0021458 | Ga0501038_0021458_1367_1954 | 169 |
| 259 | 3300049575 | Ga0501039_0056751 | Ga0501039_0056751_896_1483 | 169 |
| 260 | 3300049575 | Ga0501039_0150479 | Ga0501039_0150479_352_939 | 169 |
| 261 | 3300049576 | Ga0501040_0000717 | Ga0501040_0000717_95_682 | 169 |
| 262 | 3300049578 | Ga0501042_0031837 | Ga0501042_0031837_1281_1868 | 169 |
| 263 | 3300049579 | Ga0501043_0035235 | Ga0501043_0035235_404_991 | 169 |
| 264 | 3300049580 | Ga0501046_0014108 | Ga0501046_0014108_4653_5240 | 169 |
| 265 | 3300049582 | Ga0501048_0012583 | Ga0501048_0012583_2303_2890 | 169 |
| 266 | 3300049822 | Ga0501035_0205882 | Ga0501035_0205882_1084_1671 | 169 |
| 267 | 3300049823 | Ga0501044_0018905 | Ga0501044_0018905_3304_3891 | 169 |
| 268 | 3300049824 | Ga0501045_0003754 | Ga0501045_0003754_2522_3109 | 169 |
| 269 | 3300050512 | nmdc:mga0n895_113085_c1 | nmdc:mga0n895_113085_c1_705_1307 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3aai-assembly1.cif.gz_C | x-ray crystal structure of csor from thermus thermophilus hb8 | 0.8088 | 64 | 107 |
| 3aai-assembly1.cif.gz_A | x-ray crystal structure of csor from thermus thermophilus hb8 | 0.8085 | 64 | 107 |
| 4kqt-assembly1.cif.gz_A | crystal structure of a putative outer membrane chaperone (omph-like) (cc_1914) from caulobacter crescentus cb15 at 2.83 a resolution (psi community target, shapiro) | 0.8008 | 52 | 110 |
| 3aai-assembly1.cif.gz_B | x-ray crystal structure of csor from thermus thermophilus hb8 | 0.7916 | 64 | 107 |
| 4err-assembly1.cif.gz_A | 1.55 angstrom crystal structure of the four helical bundle membrane localization domain (4hbm) of the vibrio vulnificus martx effector domain duf5 | 0.7863 | 64 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q99LP6_159_215_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9965 | 111 | 165 | 2.30.22.10 |
| af_A0A0P0VLJ4_201_256_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9704 | 111 | 164 | 2.30.22.10 |
| af_Q2FXZ1_152_207_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9697 | 111 | 163 | 2.30.22.10 |
| af_Q18421_178_235_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9614 | 111 | 163 | 2.30.22.10 |
| af_P09372_138_194_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9562 | 111 | 165 | 2.30.22.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0F638-F1-model_v4 | Protein GrpE | 0.9845 | 62 | 165 |
GO:0000774
GO:0005829 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
| AF-A0A2R6AW44-F1-model_v4 | Protein GrpE | 0.9749 | 100 | 169 |
GO:0000774
GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
| AF-A0A1G0F638-F1-model_v4 | Protein GrpE | 0.9573 | 62 | 165 |
GO:0000774
GO:0005829 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
| AF-A0A2A5FCL5-F1-model_v4 | deleted | 0.9508 | 86 | 167 |
|
| AF-A0A847VIW9-F1-model_v4 | Protein GrpE | 0.9481 | 61 | 167 |
GO:0000774
GO:0005829 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar