F376254

General Info

Members Datasets Scaffolds Average Seq Length
269 173 266 174

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_11076210|Ga0207660_110762101
Length 200
Sequence MQDTRYVQTPVENDESQSVAGALPHDLPQPEGPPSGSEASRAAKATPGLEEQLKQALLSAQEHHDAWLRAKAEADNIRKRAQADITSAHKYAIENFSGDLLAVKDSLEAALAADKVTFESLKSGVELTLKQLNSVFDKNRIVEINPAGQKFDPHRHQAITTVESDAEPNSVVQVFQKGYALNDRVIRPAMVSVAKHPTAQ

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
121 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
122 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 4.09
Rhizosphere 94.42
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10164279 3300005328 Bacteria 1431
2 Ga0070676_10607404 3300005328 Archaea 789
3 Ga0070683_100143143 3300005329 Bacteria 2265
4 Ga0070683_101372181 3300005329 Bacteria 679
5 Ga0070670_100001183 3300005331 Bacteria 20679
6 Ga0070677_10022629 3300005333 Bacteria 2317
7 Ga0070677_10059100 3300005333 Bacteria 1576
8 Ga0070666_10009457 3300005335 Bacteria 6078
9 Ga0070666_10120953 3300005335 Bacteria 1815
10 Ga0070680_100260643 3300005336 Bacteria 1467
11 Ga0068868_100000563 3300005338 Bacteria 24853
12 Ga0068868_100059865 3300005338 Bacteria 3013
13 Ga0070661_100005436 3300005344 Bacteria 8782
14 Ga0070675_100001483 3300005354 Bacteria 17312
15 Ga0070675_100029011 3300005354 Bacteria 4459
16 Ga0070671_100001086 3300005355 Bacteria 20125
17 Ga0070671_100050012 3300005355 Bacteria 3477
18 Ga0070674_100033854 3300005356 Bacteria 3406
19 Ga0070674_100156611 3300005356 Bacteria 1724
20 Ga0070673_100008418 3300005364 Bacteria 6859
21 Ga0070673_100045341 3300005364 Bacteria 3409
22 Ga0070667_100046501 3300005367 Bacteria 3651
23 Ga0070667_100205497 3300005367 Bacteria 1749
24 Ga0070700_100023208 3300005441 Bacteria 3627
25 Ga0070700_100232219 3300005441 Bacteria 1313
26 Ga0070694_100078909 3300005444 Bacteria 2284
27 Ga0070694_100092110 3300005444 Bacteria 2129
28 Ga0070694_100114213 3300005444 Bacteria 1928
29 Ga0070663_100249529 3300005455 Bacteria 1404
30 Ga0070678_100000081 3300005456 Bacteria 35889
31 Ga0070678_100007489 3300005456 Bacteria 6480
32 Ga0070678_100568484 3300005456 Unclassified 1008
33 Ga0070662_100048829 3300005457 Bacteria 3050
34 Ga0070681_10033093 3300005458 Bacteria 5189
35 Ga0070681_10078831 3300005458 Bacteria 3251
36 Ga0068867_100016980 3300005459 Bacteria 5172
37 Ga0068867_100047967 3300005459 Bacteria 3141
38 Ga0070706_100030455 3300005467 Bacteria 4972
39 Ga0070707_100050434 3300005468 Bacteria 3989
40 Ga0070679_100794767 3300005530 Bacteria 889
41 Ga0070684_100026105 3300005535 Bacteria 4917
42 Ga0070697_100124968 3300005536 Bacteria 2155
43 Ga0070697_100399861 3300005536 Bacteria 1192
44 Ga0070672_100000196 3300005543 Bacteria 33585
45 Ga0070695_100133887 3300005545 Bacteria 1711
46 Ga0070704_100021085 3300005549 Bacteria 4218
47 Ga0070664_100008946 3300005564 Bacteria 8119
48 Ga0070664_100145521 3300005564 Bacteria 2089
49 Ga0068854_100004097 3300005578 Bacteria 9157
50 Ga0070702_100061600 3300005615 Bacteria 2185
51 Ga0068852_100000380 3300005616 Bacteria 29923
52 Ga0068852_100918678 3300005616 Archaea 893
53 Ga0068864_100013601 3300005618 Bacteria 6747
54 Ga0068866_10027358 3300005718 Bacteria 2703
55 Ga0068866_10217667 3300005718 Bacteria 1150
56 Ga0068866_10458337 3300005718 Bacteria 835
57 Ga0068851_10081235 3300005834 Bacteria 1693
58 Ga0068870_10016484 3300005840 Bacteria 3531
59 Ga0068863_100045668 3300005841 Bacteria 4157
60 Ga0068863_100092574 3300005841 Bacteria 2868
61 Ga0068858_100606264 3300005842 Bacteria 1062
62 Ga0070716_100742671 3300006173 Unclassified 754
63 Ga0097621_100001161 3300006237 Bacteria 18255
64 Ga0097621_100033038 3300006237 Bacteria 4117
65 Ga0068871_100000811 3300006358 Bacteria 20992
66 Ga0075434_100184217 3300006871 Bacteria 2109
67 Ga0068865_100271288 3300006881 Bacteria 1347
68 Ga0068865_100348235 3300006881 Bacteria 1199
69 Ga0075436_100123686 3300006914 Bacteria 1812
70 Ga0111539_10482807 3300009094 Bacteria 1443
71 Ga0111539_10650770 3300009094 Bacteria 1227
72 Ga0105243_10130324 3300009148 Bacteria 2133
73 Ga0105243_10483541 3300009148 Bacteria 1169
74 Ga0105248_10078020 3300009177 Bacteria 3724
75 Ga0157373_10075210 3300013100 Bacteria 2383
76 Ga0157374_10000304 3300013296 Bacteria 45616
77 Ga0157374_10101340 3300013296 Bacteria 2761
78 Ga0157378_10005133 3300013297 Bacteria 11498
79 Ga0157375_10024454 3300013308 Bacteria 5590
80 Ga0157375_10177866 3300013308 Bacteria 2278
81 Ga0157375_11153685 3300013308 Unclassified 908
82 Ga0157380_10496110 3300014326 Bacteria 1185
83 Ga0157377_10032146 3300014745 Bacteria 2856
84 Ga0157377_10169008 3300014745 Bacteria 1366
85 Ga0157376_10042802 3300014969 Bacteria 3713
86 Ga0163161_10220843 3300017792 Bacteria 1467
87 Ga0207697_10095705 3300025315 Bacteria 1262
88 Ga0207656_10042788 3300025321 Bacteria 1929
89 Ga0207682_10000343 3300025893 Bacteria 21236
90 Ga0207682_10047263 3300025893 Bacteria 1771
91 Ga0207642_10164672 3300025899 Bacteria 1194
92 Ga0207642_10346823 3300025899 Bacteria 875
93 Ga0207688_10143382 3300025901 Bacteria 1407
94 Ga0207680_10008354 3300025903 Bacteria 5077
95 Ga0207705_10436412 3300025909 Bacteria 1015
96 Ga0207684_10379895 3300025910 Bacteria 1215
97 Ga0207707_10126255 3300025912 Bacteria 2237
98 Ga0207707_10184446 3300025912 Bacteria 1821
99 Ga0207660_10350845 3300025917 Bacteria 1182
100 Ga0207660_11076210 3300025917 Unclassified 655
101 Ga0207649_10009336 3300025920 Bacteria 5367
102 Ga0207649_10090774 3300025920 Bacteria 2000
103 Ga0207650_10003517 3300025925 Bacteria 10758
104 Ga0207650_10063877 3300025925 Bacteria 2754
105 Ga0207659_10002362 3300025926 Bacteria 11237
106 Ga0207659_10008492 3300025926 Bacteria 6380
107 Ga0207644_10001403 3300025931 Bacteria 15529
108 Ga0207644_10085222 3300025931 Bacteria 2343
109 Ga0207706_10117180 3300025933 Bacteria 2342
110 Ga0207686_10263668 3300025934 Bacteria 1264
111 Ga0207670_10199783 3300025936 Bacteria 1518
112 Ga0207669_10015511 3300025937 Bacteria 3844
113 Ga0207704_10256998 3300025938 Bacteria 1315
114 Ga0207704_10357838 3300025938 Bacteria 1139
115 Ga0207691_10000196 3300025940 Bacteria 58015
116 Ga0207661_10177815 3300025944 Bacteria 1856
117 Ga0207661_11248011 3300025944 Bacteria 683
118 Ga0207679_10001021 3300025945 Bacteria 17888
119 Ga0207651_10030799 3300025960 Bacteria 3421
120 Ga0207651_10042623 3300025960 Bacteria 3022
121 Ga0207640_10003758 3300025981 Bacteria 8182
122 Ga0207658_10031380 3300025986 Bacteria 3772
123 Ga0207658_10136090 3300025986 Bacteria 1981
124 Ga0207678_10285097 3300026067 Bacteria 1418
125 Ga0207708_10001754 3300026075 Bacteria 16016
126 Ga0207708_10018649 3300026075 Bacteria 5226
127 Ga0207641_10125599 3300026088 Bacteria 2296
128 Ga0207641_10270472 3300026088 Bacteria 1594
129 Ga0207648_10082808 3300026089 Bacteria 2798
130 Ga0207676_10006899 3300026095 Bacteria 8049
131 Ga0207676_10009027 3300026095 Bacteria 7097
132 Ga0207674_10404320 3300026116 Bacteria 1319
133 Ga0207675_100034244 3300026118 Bacteria 4735
134 Ga0207683_10011395 3300026121 Bacteria 7586
135 Ga0207698_10000360 3300026142 Bacteria 26761
136 Ga0207698_11292328 3300026142 Archaea 744
137 Ga0209969_1002904 3300027360 Bacteria 2371
138 Ga0209969_1004918 3300027360 Bacteria 1868
139 Ga0209967_1004556 3300027364 Bacteria 1844
140 Ga0209996_1017417 3300027395 Bacteria 992
141 Ga0209984_1001646 3300027424 Bacteria 2432
142 Ga0209984_1029893 3300027424 Bacteria 768
143 Ga0210000_1000899 3300027462 Bacteria 4140
144 Ga0210000_1035541 3300027462 Bacteria 785
145 Ga0209995_1000430 3300027471 Bacteria 6470
146 Ga0209968_1005835 3300027526 Bacteria 1851
147 Ga0209999_1027216 3300027543 Bacteria 1058
148 Ga0209983_1008538 3300027665 Bacteria 2095
149 Ga0209966_1015493 3300027695 Bacteria 1432
150 Ga0209974_10007659 3300027876 Bacteria 3714
151 Ga0209974_10036805 3300027876 Bacteria 1625
152 Ga0268265_10065560 3300028380 Bacteria 2803
153 Ga0265323_10022236 3300028653 Bacteria 2424
154 Ga0265338_10213835 3300028800 Bacteria 1445
155 Ga0265324_10027896 3300029957 Bacteria 1993
156 Ga0265332_10003891 3300031238 Bacteria 7124
157 Ga0265328_10002740 3300031239 Bacteria 7882
158 Ga0265320_10048835 3300031240 Bacteria 2063
159 Ga0265331_10002398 3300031250 Bacteria 12700
160 Ga0265327_10031566 3300031251 Bacteria 2974
161 Ga0265327_10043783 3300031251 Bacteria 2392
162 Ga0265316_10039350 3300031344 Bacteria 3798
163 Ga0265316_10097114 3300031344 Bacteria 2243
164 Ga0265316_10119820 3300031344 Bacteria 1988
165 Ga0265316_10261395 3300031344 Bacteria 1269
166 Ga0265316_10619008 3300031344 Bacteria 767
167 Ga0265316_10637671 3300031344 Bacteria 754
168 Ga0307509_10000006 3300031507 Bacteria 421538
169 Ga0307408_100764848 3300031548 Bacteria 874
170 Ga0265314_10000245 3300031711 Bacteria 79757
171 Ga0265342_10082828 3300031712 Bacteria 1850
172 Ga0307413_10269819 3300031824 Bacteria 1273
173 Ga0307406_10441120 3300031901 Bacteria 1042
174 Ga0373959_0051684 3300034820 Bacteria 889
175 Ga0373929_0084695 3300035085 Bacteria 778
176 Ga0373952_0000128 3300035092 Bacteria 10746
177 Ga0373942_0039029 3300035207 Bacteria 1290
178 Ga0373961_0049245 3300035241 Bacteria 1245
179 Ga0373931_0745392 3300035691 Unclassified 650
180 Ga0451577_0005018 3300042876 Bacteria 13695
181 Ga0451577_0180303 3300042876 Bacteria 1904
182 Ga0451577_0199243 3300042876 Bacteria 1807
183 Ga0451577_0422056 3300042876 Bacteria 1211
184 Ga0451577_0478548 3300042876 Bacteria 1130
185 Ga0453683_0041056 3300044673 Bacteria 2905
186 Ga0453683_0342900 3300044673 Bacteria 959
187 Ga0453684_0000163 3300044712 Bacteria 296196
188 Ga0453684_0004902 3300044712 Bacteria 27396
189 Ga0453684_0005751 3300044712 Bacteria 24224
190 Ga0453684_0008183 3300044712 Bacteria 18861
191 Ga0453684_0083731 3300044712 Bacteria 3969
192 Ga0453684_0123369 3300044712 Bacteria 3123
193 Ga0453684_0887018 3300044712 Bacteria 956
194 Ga0451576_0000738 3300045051 Bacteria 65424
195 Ga0451576_0000845 3300045051 Bacteria 59543
196 Ga0451576_0012728 3300045051 Bacteria 9445
197 Ga0451576_0042535 3300045051 Bacteria 4796
198 Ga0451576_0070741 3300045051 Bacteria 3631
199 Ga0451576_0142826 3300045051 Bacteria 2496
200 Ga0451576_0151749 3300045051 Bacteria 2416
201 Ga0451576_0313395 3300045051 Bacteria 1641
202 Ga0451576_0591936 3300045051 Bacteria 1166
203 Ga0451576_1421482 3300045051 Bacteria 722
204 Ga0451576_1430325 3300045051 Bacteria 719
205 Ga0451576_1866595 3300045051 Bacteria 620
206 Ga0495629_0390575 3300046459 Bacteria 946
207 Ga0495642_0118439 3300046528 Bacteria 1135
208 Ga0495658_0014998 3300046683 Bacteria 3970
209 Ga0496102_0085124 3300048905 Bacteria 2919
210 Ga0496104_0055946 3300048907 Bacteria 3730
211 Ga0496104_0334284 3300048907 Bacteria 1428
212 Ga0496108_0013458 3300048911 Bacteria 6674
213 Ga0496109_0013179 3300048912 Bacteria 7155
214 Ga0496109_0674511 3300048912 Unclassified 971
215 Ga0496110_0082254 3300048913 Bacteria 2871
216 Ga0496111_0006494 3300048914 Bacteria 7597
217 Ga0496113_0128700 3300048916 Bacteria 1985
218 Ga0496113_0334068 3300048916 Bacteria 1215
219 Ga0496114_0558230 3300048917 Bacteria 1011
220 Ga0501034_0036478 3300049571 Bacteria 4980
221 Ga0501034_0123264 3300049571 Bacteria 2577
222 Ga0501034_0656265 3300049571 Bacteria 950
223 Ga0501036_0077947 3300049572 Bacteria 2803
224 Ga0501037_0010855 3300049573 Bacteria 6693
225 Ga0501038_0014267 3300049574 Bacteria 7239
226 Ga0501038_0021458 3300049574 Bacteria 5795
227 Ga0501038_0370080 3300049574 Bacteria 1113
228 Ga0501039_0056751 3300049575 Bacteria 3033
229 Ga0501039_0150479 3300049575 Bacteria 1828
230 Ga0501040_0000717 3300049576 Bacteria 20471
231 Ga0501041_0325692 3300049577 Bacteria 969
232 Ga0501042_0002650 3300049578 Bacteria 11010
233 Ga0501042_0031837 3300049578 Bacteria 3731
234 Ga0501042_0190881 3300049578 Bacteria 1478
235 Ga0501042_0521821 3300049578 Bacteria 863
236 Ga0501043_0035235 3300049579 Bacteria 3936
237 Ga0501046_0014108 3300049580 Bacteria 6747
238 Ga0501046_0057115 3300049580 Bacteria 3062
239 Ga0501048_0012583 3300049582 Bacteria 6293
240 Ga0501048_0030924 3300049582 Bacteria 3875
241 Ga0501069_0587389 3300049585 Bacteria 668
242 Ga0501071_0155126 3300049587 Bacteria 1709
243 Ga0501072_0012122 3300049588 Bacteria 6586
244 Ga0501074_0177906 3300049590 Bacteria 1518
245 Ga0501075_0004968 3300049591 Bacteria 9067
246 Ga0501075_0353203 3300049591 Bacteria 1120
247 Ga0501076_0002014 3300049592 Bacteria 13893
248 Ga0501076_0238565 3300049592 Bacteria 1487
249 Ga0501077_0055508 3300049593 Bacteria 2515
250 Ga0501079_0094865 3300049741 Bacteria 2312
251 Ga0501080_0012150 3300049742 Bacteria 7890
252 Ga0501080_0194568 3300049742 Bacteria 1863
253 Ga0501081_0237873 3300049743 Bacteria 1327
254 Ga0501035_0205882 3300049822 Bacteria 1685
255 Ga0501044_0018905 3300049823 Bacteria 7377
256 Ga0501045_0003754 3300049824 Bacteria 10446
257 Ga0501045_0008758 3300049824 Bacteria 7060
258 nmdc:mga06r32_1595_c1 3300050510 Bacteria 20426
259 nmdc:mga08y16_326384_c1 3300050511 Bacteria 1579
260 nmdc:mga0n895_113085_c1 3300050512 Bacteria 2732
261 nmdc:mga0rr50_700990_c1 3300050513 Bacteria 864
262 nmdc:mga08x19_166471_c1 3300050514 Bacteria 1499
263 Ga0500622_0000002 3300053156 Bacteria 646442
264 Ga0501084_0232096 3300054114 Bacteria 1557
265 Ga0501082_0005377 3300060353 Bacteria 11113
266 Ga0530510_0001310 3300061734 Bacteria 16625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0313395 Ga0451576_0313395_1049_1573 145
2 3300031251 Ga0265327_10043783 Ga0265327_100437832 146
3 3300042876 Ga0451577_0005018 Ga0451577_0005018_3865_4401 146
4 3300044712 Ga0453684_0123369 Ga0453684_0123369_1423_1947 146
5 3300045051 Ga0451576_0000845 Ga0451576_0000845_7075_7611 146
6 3300045051 Ga0451576_0151749 Ga0451576_0151749_816_1352 146
7 3300035691 Ga0373931_0745392 Ga0373931_0745392_35_562 150
8 3300005458 Ga0070681_10078831 Ga0070681_100788312 151
9 3300025912 Ga0207707_10184446 Ga0207707_101844462 151
10 3300031251 Ga0265327_10031566 Ga0265327_100315662 151
11 3300031344 Ga0265316_10637671 Ga0265316_106376711 152
12 3300045051 Ga0451576_0042535 Ga0451576_0042535_3368_3904 152
13 3300005536 Ga0070697_100399861 Ga0070697_1003998612 153
14 3300042876 Ga0451577_0478548 Ga0451577_0478548_433_990 153
15 3300044712 Ga0453684_0004902 Ga0453684_0004902_534_1091 153
16 3300044712 Ga0453684_0005751 Ga0453684_0005751_22454_23014 153
17 3300045051 Ga0451576_0000738 Ga0451576_0000738_64112_64669 153
18 3300049574 Ga0501038_0370080 Ga0501038_0370080_224_781 153
19 3300049577 Ga0501041_0325692 Ga0501041_0325692_126_713 153
20 3300049578 Ga0501042_0002650 Ga0501042_0002650_7103_7690 153
21 3300049578 Ga0501042_0521821 Ga0501042_0521821_288_845 153
22 3300049580 Ga0501046_0057115 Ga0501046_0057115_2353_2922 153
23 3300049582 Ga0501048_0030924 Ga0501048_0030924_1966_2553 153
24 3300049587 Ga0501071_0155126 Ga0501071_0155126_1026_1613 153
25 3300049588 Ga0501072_0012122 Ga0501072_0012122_5408_5977 153
26 3300049590 Ga0501074_0177906 Ga0501074_0177906_125_712 153
27 3300049591 Ga0501075_0004968 Ga0501075_0004968_1515_2102 153
28 3300049591 Ga0501075_0353203 Ga0501075_0353203_368_925 153
29 3300049592 Ga0501076_0002014 Ga0501076_0002014_11160_11747 153
30 3300049592 Ga0501076_0238565 Ga0501076_0238565_37_594 153
31 3300049593 Ga0501077_0055508 Ga0501077_0055508_346_933 153
32 3300049741 Ga0501079_0094865 Ga0501079_0094865_1450_2037 153
33 3300049742 Ga0501080_0012150 Ga0501080_0012150_7020_7607 153
34 3300049742 Ga0501080_0194568 Ga0501080_0194568_370_927 153
35 3300049743 Ga0501081_0237873 Ga0501081_0237873_624_1211 153
36 3300049824 Ga0501045_0008758 Ga0501045_0008758_6383_6970 153
37 3300054114 Ga0501084_0232096 Ga0501084_0232096_841_1428 153
38 3300060353 Ga0501082_0005377 Ga0501082_0005377_608_1195 153
39 3300061734 Ga0530510_0001310 Ga0530510_0001310_12274_12861 153
40 iso_pu_bacteria 2526164512 2526211175 157
41 3300042876 Ga0451577_0199243 Ga0451577_0199243_1098_1652 158
42 3300044712 Ga0453684_0000163 Ga0453684_0000163_78118_78672 158
43 3300045051 Ga0451576_0070741 Ga0451576_0070741_867_1421 158
44 3300005329 Ga0070683_101372181 Ga0070683_1013721811 159
45 3300005545 Ga0070695_100133887 Ga0070695_1001338872 159
46 3300009094 Ga0111539_10650770 Ga0111539_106507701 159
47 3300014326 Ga0157380_10496110 Ga0157380_104961102 159
48 3300025944 Ga0207661_11248011 Ga0207661_112480111 159
49 3300031344 Ga0265316_10097114 Ga0265316_100971142 159
50 3300031344 Ga0265316_10619008 Ga0265316_106190082 159
51 3300031711 Ga0265314_10000245 Ga0265314_1000024573 159
52 3300035092 Ga0373952_0000128 Ga0373952_0000128_8937_9458 159
53 3300046528 Ga0495642_0118439 Ga0495642_0118439_190_756 159
54 3300050511 nmdc:mga08y16_326384_c1 nmdc:mga08y16_326384_c1_933_1493 159
55 3300005336 Ga0070680_100260643 Ga0070680_1002606431 160
56 3300005444 Ga0070694_100078909 Ga0070694_1000789092 160
57 3300005549 Ga0070704_100021085 Ga0070704_1000210852 160
58 3300025917 Ga0207660_10350845 Ga0207660_103508452 160
59 3300031238 Ga0265332_10003891 Ga0265332_100038911 160
60 3300031239 Ga0265328_10002740 Ga0265328_100027404 160
61 3300031240 Ga0265320_10048835 Ga0265320_100488352 160
62 3300031250 Ga0265331_10002398 Ga0265331_100023983 160
63 3300031344 Ga0265316_10039350 Ga0265316_100393501 160
64 3300031712 Ga0265342_10082828 Ga0265342_100828281 160
65 3300045051 Ga0451576_1866595 Ga0451576_1866595_13_567 160
66 3300049571 Ga0501034_0656265 Ga0501034_0656265_244_807 160
67 3300005328 Ga0070676_10607404 Ga0070676_106074041 161
68 3300005333 Ga0070677_10022629 Ga0070677_100226291 161
69 3300005335 Ga0070666_10120953 Ga0070666_101209531 161
70 3300005356 Ga0070674_100156611 Ga0070674_1001566112 161
71 3300005456 Ga0070678_100007489 Ga0070678_1000074892 161
72 3300005459 Ga0068867_100016980 Ga0068867_1000169802 161
73 3300005616 Ga0068852_100918678 Ga0068852_1009186781 161
74 3300005718 Ga0068866_10027358 Ga0068866_100273582 161
75 3300006237 Ga0097621_100033038 Ga0097621_1000330382 161
76 3300009148 Ga0105243_10130324 Ga0105243_101303242 161
77 3300013296 Ga0157374_10101340 Ga0157374_101013401 161
78 3300013308 Ga0157375_10177866 Ga0157375_101778663 161
79 3300017792 Ga0163161_10220843 Ga0163161_102208431 161
80 3300025315 Ga0207697_10095705 Ga0207697_100957052 161
81 3300025893 Ga0207682_10000343 Ga0207682_100003436 161
82 3300025934 Ga0207686_10263668 Ga0207686_102636682 161
83 3300025937 Ga0207669_10015511 Ga0207669_100155113 161
84 3300026075 Ga0207708_10018649 Ga0207708_100186492 161
85 3300026116 Ga0207674_10404320 Ga0207674_104043202 161
86 3300026118 Ga0207675_100034244 Ga0207675_1000342442 161
87 3300026142 Ga0207698_11292328 Ga0207698_112923281 161
88 3300027424 Ga0209984_1029893 Ga0209984_10298932 161
89 3300027462 Ga0210000_1035541 Ga0210000_10355411 161
90 3300027876 Ga0209974_10036805 Ga0209974_100368052 161
91 3300048916 Ga0496113_0128700 Ga0496113_0128700_545_1060 161
92 3300053156 Ga0500622_0000002 Ga0500622_0000002_514371_514889 161
93 3300005338 Ga0068868_100059865 Ga0068868_1000598653 162
94 3300005354 Ga0070675_100029011 Ga0070675_1000290112 162
95 3300005355 Ga0070671_100050012 Ga0070671_1000500124 162
96 3300005364 Ga0070673_100045341 Ga0070673_1000453412 162
97 3300005367 Ga0070667_100205497 Ga0070667_1002054971 162
98 3300005441 Ga0070700_100023208 Ga0070700_1000232082 162
99 3300005441 Ga0070700_100232219 Ga0070700_1002322192 162
100 3300005444 Ga0070694_100092110 Ga0070694_1000921103 162
101 3300005456 Ga0070678_100568484 Ga0070678_1005684841 162
102 3300005564 Ga0070664_100145521 Ga0070664_1001455212 162
103 3300005718 Ga0068866_10458337 Ga0068866_104583372 162
104 3300005840 Ga0068870_10016484 Ga0068870_100164843 162
105 3300005841 Ga0068863_100045668 Ga0068863_1000456682 162
106 3300006881 Ga0068865_100271288 Ga0068865_1002712882 162
107 3300009094 Ga0111539_10482807 Ga0111539_104828072 162
108 3300009148 Ga0105243_10483541 Ga0105243_104835412 162
109 3300014745 Ga0157377_10032146 Ga0157377_100321462 162
110 3300025899 Ga0207642_10346823 Ga0207642_103468232 162
111 3300025901 Ga0207688_10143382 Ga0207688_101433823 162
112 3300025920 Ga0207649_10090774 Ga0207649_100907743 162
113 3300025925 Ga0207650_10063877 Ga0207650_100638772 162
114 3300025926 Ga0207659_10008492 Ga0207659_100084924 162
115 3300025931 Ga0207644_10085222 Ga0207644_100852221 162
116 3300025936 Ga0207670_10199783 Ga0207670_101997832 162
117 3300025938 Ga0207704_10357838 Ga0207704_103578382 162
118 3300025960 Ga0207651_10030799 Ga0207651_100307993 162
119 3300025986 Ga0207658_10136090 Ga0207658_101360903 162
120 3300026075 Ga0207708_10001754 Ga0207708_1000175411 162
121 3300026088 Ga0207641_10270472 Ga0207641_102704723 162
122 3300026095 Ga0207676_10009027 Ga0207676_100090278 162
123 3300028380 Ga0268265_10065560 Ga0268265_100655603 162
124 3300046459 Ga0495629_0390575 Ga0495629_0390575_355_921 162
125 3300046683 Ga0495658_0014998 Ga0495658_0014998_2173_2739 162
126 3300048912 Ga0496109_0674511 Ga0496109_0674511_28_594 162
127 3300049585 Ga0501069_0587389 Ga0501069_0587389_10_591 162
128 3300035207 Ga0373942_0039029 Ga0373942_0039029_648_1154 163
129 3300045051 Ga0451576_0012728 Ga0451576_0012728_8405_8971 163
130 3300050513 nmdc:mga0rr50_700990_c1 nmdc:mga0rr50_700990_c1_304_843 163
131 3300029957 Ga0265324_10027896 Ga0265324_100278962 164
132 3300031548 Ga0307408_100764848 Ga0307408_1007648481 164
133 3300031824 Ga0307413_10269819 Ga0307413_102698192 164
134 3300031901 Ga0307406_10441120 Ga0307406_104411202 164
135 3300050510 nmdc:mga06r32_1595_c1 nmdc:mga06r32_1595_c1_15732_16277 164
136 3300044673 Ga0453683_0041056 Ga0453683_0041056_429_986 165
137 3300044673 Ga0453683_0342900 Ga0453683_0342900_235_798 165
138 3300045051 Ga0451576_0142826 Ga0451576_0142826_1335_1904 165
139 3300045051 Ga0451576_1430325 Ga0451576_1430325_69_623 165
140 3300049578 Ga0501042_0190881 Ga0501042_0190881_749_1294 165
141 iso_pu_bacteria 2891633521 2891634728 165
142 3300005530 Ga0070679_100794767 Ga0070679_1007947671 166
143 3300006914 Ga0075436_100123686 Ga0075436_1001236862 166
144 3300027360 Ga0209969_1002904 Ga0209969_10029042 166
145 3300027360 Ga0209969_1004918 Ga0209969_10049182 166
146 3300027364 Ga0209967_1004556 Ga0209967_10045562 166
147 3300027395 Ga0209996_1017417 Ga0209996_10174172 166
148 3300027424 Ga0209984_1001646 Ga0209984_10016462 166
149 3300027462 Ga0210000_1000899 Ga0210000_10008993 166
150 3300027471 Ga0209995_1000430 Ga0209995_10004303 166
151 3300027526 Ga0209968_1005835 Ga0209968_10058352 166
152 3300027543 Ga0209999_1027216 Ga0209999_10272162 166
153 3300027665 Ga0209983_1008538 Ga0209983_10085382 166
154 3300027695 Ga0209966_1015493 Ga0209966_10154932 166
155 3300027876 Ga0209974_10007659 Ga0209974_100076592 166
156 3300031507 Ga0307509_10000006 Ga0307509_10000006360 166
157 3300034820 Ga0373959_0051684 Ga0373959_0051684_268_822 166
158 3300035085 Ga0373929_0084695 Ga0373929_0084695_184_738 166
159 3300035241 Ga0373961_0049245 Ga0373961_0049245_583_1137 166
160 3300048907 Ga0496104_0334284 Ga0496104_0334284_591_1139 166
161 3300050514 nmdc:mga08x19_166471_c1 nmdc:mga08x19_166471_c1_619_1173 166
162 iso_pu_bacteria 2574179768 2574431013 166
163 3300005578 Ga0068854_100004097 Ga0068854_1000040976 167
164 3300005618 Ga0068864_100013601 Ga0068864_1000136017 167
165 3300005841 Ga0068863_100092574 Ga0068863_1000925742 167
166 3300006237 Ga0097621_100001161 Ga0097621_1000011612 167
167 3300025903 Ga0207680_10008354 Ga0207680_100083543 167
168 3300025920 Ga0207649_10009336 Ga0207649_100093362 167
169 3300025925 Ga0207650_10003517 Ga0207650_100035175 167
170 3300025926 Ga0207659_10002362 Ga0207659_1000236212 167
171 3300025931 Ga0207644_10001403 Ga0207644_1000140316 167
172 3300025933 Ga0207706_10117180 Ga0207706_101171802 167
173 3300025945 Ga0207679_10001021 Ga0207679_1000102114 167
174 3300025960 Ga0207651_10042623 Ga0207651_100426232 167
175 3300025981 Ga0207640_10003758 Ga0207640_100037583 167
176 3300025986 Ga0207658_10031380 Ga0207658_100313804 167
177 3300026088 Ga0207641_10125599 Ga0207641_101255992 167
178 3300026095 Ga0207676_10006899 Ga0207676_100068992 167
179 3300026142 Ga0207698_10000360 Ga0207698_1000036019 167
180 3300031344 Ga0265316_10119820 Ga0265316_101198202 167
181 3300042876 Ga0451577_0180303 Ga0451577_0180303_1080_1634 167
182 3300042876 Ga0451577_0422056 Ga0451577_0422056_389_946 167
183 3300044712 Ga0453684_0008183 Ga0453684_0008183_16894_17460 167
184 3300044712 Ga0453684_0083731 Ga0453684_0083731_2457_3011 167
185 3300048905 Ga0496102_0085124 Ga0496102_0085124_1086_1625 167
186 3300048907 Ga0496104_0055946 Ga0496104_0055946_1565_2104 167
187 3300048911 Ga0496108_0013458 Ga0496108_0013458_3623_4162 167
188 3300048912 Ga0496109_0013179 Ga0496109_0013179_2997_3536 167
189 3300048913 Ga0496110_0082254 Ga0496110_0082254_1781_2320 167
190 3300048914 Ga0496111_0006494 Ga0496111_0006494_5717_6256 167
191 3300048916 Ga0496113_0334068 Ga0496113_0334068_85_624 167
192 3300048917 Ga0496114_0558230 Ga0496114_0558230_241_780 167
193 3300028653 Ga0265323_10022236 Ga0265323_100222361 168
194 3300031344 Ga0265316_10261395 Ga0265316_102613952 168
195 3300044712 Ga0453684_0887018 Ga0453684_0887018_96_665 168
196 3300045051 Ga0451576_0591936 Ga0451576_0591936_64_636 168
197 3300045051 Ga0451576_1421482 Ga0451576_1421482_93_650 168
198 3300005328 Ga0070676_10164279 Ga0070676_101642791 169
199 3300005329 Ga0070683_100143143 Ga0070683_1001431432 169
200 3300005331 Ga0070670_100001183 Ga0070670_10000118317 169
201 3300005333 Ga0070677_10059100 Ga0070677_100591002 169
202 3300005335 Ga0070666_10009457 Ga0070666_100094575 169
203 3300005338 Ga0068868_100000563 Ga0068868_10000056321 169
204 3300005344 Ga0070661_100005436 Ga0070661_1000054362 169
205 3300005354 Ga0070675_100001483 Ga0070675_10000148317 169
206 3300005355 Ga0070671_100001086 Ga0070671_10000108616 169
207 3300005356 Ga0070674_100033854 Ga0070674_1000338542 169
208 3300005364 Ga0070673_100008418 Ga0070673_1000084182 169
209 3300005367 Ga0070667_100046501 Ga0070667_1000465012 169
210 3300005444 Ga0070694_100114213 Ga0070694_1001142132 169
211 3300005455 Ga0070663_100249529 Ga0070663_1002495292 169
212 3300005456 Ga0070678_100000081 Ga0070678_10000008134 169
213 3300005457 Ga0070662_100048829 Ga0070662_1000488293 169
214 3300005458 Ga0070681_10033093 Ga0070681_100330932 169
215 3300005459 Ga0068867_100047967 Ga0068867_1000479673 169
216 3300005467 Ga0070706_100030455 Ga0070706_1000304553 169
217 3300005468 Ga0070707_100050434 Ga0070707_1000504343 169
218 3300005535 Ga0070684_100026105 Ga0070684_1000261056 169
219 3300005536 Ga0070697_100124968 Ga0070697_1001249683 169
220 3300005543 Ga0070672_100000196 Ga0070672_10000019629 169
221 3300005564 Ga0070664_100008946 Ga0070664_1000089467 169
222 3300005615 Ga0070702_100061600 Ga0070702_1000616003 169
223 3300005616 Ga0068852_100000380 Ga0068852_10000038014 169
224 3300005718 Ga0068866_10217667 Ga0068866_102176672 169
225 3300005834 Ga0068851_10081235 Ga0068851_100812352 169
226 3300005842 Ga0068858_100606264 Ga0068858_1006062641 169
227 3300006173 Ga0070716_100742671 Ga0070716_1007426711 169
228 3300006358 Ga0068871_100000811 Ga0068871_10000081113 169
229 3300006871 Ga0075434_100184217 Ga0075434_1001842173 169
230 3300006881 Ga0068865_100348235 Ga0068865_1003482352 169
231 3300009177 Ga0105248_10078020 Ga0105248_100780203 169
232 3300013100 Ga0157373_10075210 Ga0157373_100752102 169
233 3300013296 Ga0157374_10000304 Ga0157374_1000030414 169
234 3300013297 Ga0157378_10005133 Ga0157378_100051339 169
235 3300013308 Ga0157375_10024454 Ga0157375_100244546 169
236 3300013308 Ga0157375_11153685 Ga0157375_111536851 169
237 3300014745 Ga0157377_10169008 Ga0157377_101690081 169
238 3300014969 Ga0157376_10042802 Ga0157376_100428022 169
239 3300025321 Ga0207656_10042788 Ga0207656_100427883 169
240 3300025893 Ga0207682_10047263 Ga0207682_100472632 169
241 3300025899 Ga0207642_10164672 Ga0207642_101646722 169
242 3300025909 Ga0207705_10436412 Ga0207705_104364122 169
243 3300025910 Ga0207684_10379895 Ga0207684_103798951 169
244 3300025912 Ga0207707_10126255 Ga0207707_101262551 169
245 3300025917 Ga0207660_11076210 Ga0207660_110762101 169
246 3300025938 Ga0207704_10256998 Ga0207704_102569982 169
247 3300025940 Ga0207691_10000196 Ga0207691_1000019621 169
248 3300025944 Ga0207661_10177815 Ga0207661_101778153 169
249 3300026067 Ga0207678_10285097 Ga0207678_102850972 169
250 3300026089 Ga0207648_10082808 Ga0207648_100828082 169
251 3300026121 Ga0207683_10011395 Ga0207683_100113952 169
252 3300028800 Ga0265338_10213835 Ga0265338_102138351 169
253 3300049571 Ga0501034_0036478 Ga0501034_0036478_1725_2312 169
254 3300049571 Ga0501034_0123264 Ga0501034_0123264_791_1378 169
255 3300049572 Ga0501036_0077947 Ga0501036_0077947_337_924 169
256 3300049573 Ga0501037_0010855 Ga0501037_0010855_1976_2563 169
257 3300049574 Ga0501038_0014267 Ga0501038_0014267_6558_7145 169
258 3300049574 Ga0501038_0021458 Ga0501038_0021458_1367_1954 169
259 3300049575 Ga0501039_0056751 Ga0501039_0056751_896_1483 169
260 3300049575 Ga0501039_0150479 Ga0501039_0150479_352_939 169
261 3300049576 Ga0501040_0000717 Ga0501040_0000717_95_682 169
262 3300049578 Ga0501042_0031837 Ga0501042_0031837_1281_1868 169
263 3300049579 Ga0501043_0035235 Ga0501043_0035235_404_991 169
264 3300049580 Ga0501046_0014108 Ga0501046_0014108_4653_5240 169
265 3300049582 Ga0501048_0012583 Ga0501048_0012583_2303_2890 169
266 3300049822 Ga0501035_0205882 Ga0501035_0205882_1084_1671 169
267 3300049823 Ga0501044_0018905 Ga0501044_0018905_3304_3891 169
268 3300049824 Ga0501045_0003754 Ga0501045_0003754_2522_3109 169
269 3300050512 nmdc:mga0n895_113085_c1 nmdc:mga0n895_113085_c1_705_1307 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

35

195

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aai-assembly1.cif.gz_C x-ray crystal structure of csor from thermus thermophilus hb8 0.8088 64 107
3aai-assembly1.cif.gz_A x-ray crystal structure of csor from thermus thermophilus hb8 0.8085 64 107
4kqt-assembly1.cif.gz_A crystal structure of a putative outer membrane chaperone (omph-like) (cc_1914) from caulobacter crescentus cb15 at 2.83 a resolution (psi community target, shapiro) 0.8008 52 110
3aai-assembly1.cif.gz_B x-ray crystal structure of csor from thermus thermophilus hb8 0.7916 64 107
4err-assembly1.cif.gz_A 1.55 angstrom crystal structure of the four helical bundle membrane localization domain (4hbm) of the vibrio vulnificus martx effector domain duf5 0.7863 64 110
ID Description Score Start End Superfamily
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9965 111 165 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9704 111 164 2.30.22.10
af_Q2FXZ1_152_207_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9697 111 163 2.30.22.10
af_Q18421_178_235_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9614 111 163 2.30.22.10
af_P09372_138_194_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9562 111 165 2.30.22.10

Feature Viewer

pLDDT pTM Quality
85.97 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map