F376232

General Info

Members Datasets Scaffolds Average Seq Length
269 194 538 219

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10019680|Ga0213875_100196801
Length 263
Sequence MCRLLRVPAADPLGGRVTRKSRPPGTARARASCSTQVLIGMDAEPRLLCVFMPTASFSGDFCTELCRLLVWRRDVRRFRREPLLEGTLERLLELACLAPSVGLSQPWRFVLVENAGRRQAVLESFLACNREALDACPADRASRYARLKLAGLQEAPHQVAVFCDEATDQGGGLGRRTMPEMLRYSAVLAVHTLWLAARAEGVGIGWVSILDPACVHAALQVPAPWSLVAYLCIGYPVAEDDVPELERAGWERRCPLKQFILQR

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
87 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
180 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
181 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
182 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
185 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
188 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
189 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
190 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
191 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
192 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
193 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
194 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 1.12
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 1.12
Rhizoplane 4.83
Rhizosphere 73.98
Stem 0
Stem Tuber 0
Unclassified 5.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10019680 3300021388 Bacteria 3246
2 rootH1_10036817 3300003323 Bacteria 3096
3 Ga0070658_10039160 3300005327 Unclassified 3824
4 Ga0070666_10047775 3300005335 Bacteria 2874
5 Ga0070680_100004844 3300005336 Bacteria 10135
6 Ga0070680_100036302 3300005336 Bacteria 3982
7 Ga0070682_100014716 3300005337 Bacteria 4524
8 Ga0070660_100177759 3300005339 Bacteria 1721
9 Ga0070669_100209795 3300005353 Bacteria 1536
10 Ga0070659_100030295 3300005366 Unclassified 4187
11 Ga0070667_100478570 3300005367 Bacteria 1140
12 Ga0070714_100122029 3300005435 Bacteria 2319
13 Ga0070714_100844039 3300005435 Bacteria 888
14 Ga0070713_100025132 3300005436 Bacteria 4652
15 Ga0070713_100218943 3300005436 Bacteria 1726
16 Ga0070713_100553936 3300005436 Bacteria 1089
17 Ga0070711_100055051 3300005439 Bacteria 2747
18 Ga0070663_100710565 3300005455 Unclassified 855
19 Ga0070681_10003583 3300005458 Bacteria 14563
20 Ga0070681_10097799 3300005458 Bacteria 2882
21 Ga0070681_10598609 3300005458 Bacteria 1017
22 Ga0070706_100105271 3300005467 Bacteria 2625
23 Ga0070698_100125767 3300005471 Bacteria 2521
24 Ga0070679_100076551 3300005530 Bacteria 3335
25 Ga0070679_100085487 3300005530 Bacteria 3141
26 Ga0070684_100208211 3300005535 Bacteria 1782
27 Ga0070693_100109786 3300005547 Bacteria 1695
28 Ga0068857_100497551 3300005577 Bacteria 1144
29 Ga0068854_100862900 3300005578 Bacteria 793
30 Ga0068852_100310209 3300005616 Bacteria 1529
31 Ga0068852_101023963 3300005616 Bacteria 845
32 Ga0068858_100000158 3300005842 Bacteria 71944
33 Ga0081455_10032241 3300005937 Bacteria 4724
34 Ga0070717_10219242 3300006028 Bacteria 1672
35 Ga0070717_10797238 3300006028 Bacteria 859
36 Ga0075365_10103806 3300006038 Bacteria 1948
37 Ga0075365_10187525 3300006038 Bacteria 1447
38 Ga0075363_100249219 3300006048 Bacteria 1022
39 Ga0075364_10259426 3300006051 Bacteria 1181
40 Ga0070712_100003437 3300006175 Bacteria 9746
41 Ga0070712_100814306 3300006175 Unclassified 802
42 Ga0075362_10125078 3300006177 Bacteria 1219
43 Ga0075367_10120966 3300006178 Bacteria 1613
44 Ga0075367_10169086 3300006178 Bacteria 1361
45 Ga0097621_100269438 3300006237 Bacteria 1496
46 Ga0097621_100535409 3300006237 Bacteria 1065
47 Ga0075370_10316465 3300006353 Bacteria 929
48 Ga0068871_100304536 3300006358 Bacteria 1400
49 Ga0068871_100734448 3300006358 Bacteria 906
50 Ga0075431_100665096 3300006847 Bacteria 1021
51 Ga0075433_10222026 3300006852 Bacteria 1678
52 Ga0075435_100498350 3300007076 Bacteria 1053
53 Ga0099794_10148851 3300007265 Bacteria 1188
54 Ga0105240_10215292 3300009093 Bacteria 2242
55 Ga0114129_10317727 3300009147 Bacteria 2071
56 Ga0105248_10534160 3300009177 Bacteria 1323
57 Ga0105237_10094723 3300009545 Bacteria 2975
58 Ga0105237_10334911 3300009545 Bacteria 1518
59 Ga0105238_10081186 3300009551 Bacteria 3232
60 Ga0105238_10179865 3300009551 Bacteria 2092
61 Ga0105239_10023541 3300010375 Bacteria 6783
62 Ga0157371_10031691 3300013102 Bacteria 3809
63 Ga0157371_10180103 3300013102 Bacteria 1512
64 Ga0157369_10052137 3300013105 Bacteria 4427
65 Ga0157369_10226517 3300013105 Bacteria 1955
66 Ga0157374_10090776 3300013296 Bacteria 2913
67 Ga0157378_10447012 3300013297 Bacteria 1282
68 Ga0163163_10006128 3300014325 Bacteria 10474
69 Ga0157379_10041610 3300014968 Bacteria 4102
70 Ga0157376_10099621 3300014969 Bacteria 2536
71 Ga0206354_10739475 3300020081 Bacteria 1938
72 Ga0213872_10068055 3300021361 Bacteria 1607
73 Ga0213876_10279611 3300021384 Bacteria 887
74 Ga0213875_10000124 3300021388 Bacteria 86711
75 Ga0213875_10001749 3300021388 Bacteria 13620
76 Ga0213875_10006322 3300021388 Bacteria 6234
77 Ga0213875_10038861 3300021388 Bacteria 2243
78 Ga0207680_10143450 3300025903 Bacteria 1585
79 Ga0207685_10016001 3300025905 Bacteria 2390
80 Ga0207699_10008461 3300025906 Bacteria 5080
81 Ga0207699_10024818 3300025906 Bacteria 3283
82 Ga0207699_10416837 3300025906 Bacteria 958
83 Ga0207705_10551306 3300025909 Bacteria 896
84 Ga0207707_10000173 3300025912 Bacteria 67122
85 Ga0207707_10013035 3300025912 Bacteria 7239
86 Ga0207707_10055993 3300025912 Bacteria 3430
87 Ga0207693_10006890 3300025915 Bacteria 9385
88 Ga0207693_10083649 3300025915 Bacteria 2500
89 Ga0207693_10549164 3300025915 Unclassified 901
90 Ga0207660_10008044 3300025917 Bacteria 6819
91 Ga0207660_10079699 3300025917 Bacteria 2403
92 Ga0207657_10194032 3300025919 Bacteria 1637
93 Ga0207652_10010264 3300025921 Bacteria 7538
94 Ga0207652_10260471 3300025921 Bacteria 1564
95 Ga0207681_10119346 3300025923 Bacteria 1932
96 Ga0207694_10082369 3300025924 Bacteria 2529
97 Ga0207694_10135724 3300025924 Bacteria 1975
98 Ga0207650_10058983 3300025925 Bacteria 2859
99 Ga0207700_10211438 3300025928 Bacteria 1640
100 Ga0207706_10055563 3300025933 Bacteria 3491
101 Ga0207661_10002436 3300025944 Bacteria 12825
102 Ga0207679_10127038 3300025945 Bacteria 2039
103 Ga0207667_10163293 3300025949 Bacteria 2290
104 Ga0207667_10326051 3300025949 Bacteria 1568
105 Ga0207651_10577334 3300025960 Bacteria 980
106 Ga0207703_10000191 3300026035 Bacteria 71974
107 Ga0207639_10226452 3300026041 Bacteria 1618
108 Ga0207678_10544368 3300026067 Bacteria 1015
109 Ga0207698_10354464 3300026142 Bacteria 1387
110 Ga0207428_10006435 3300027907 Bacteria 10848
111 Ga0265339_10162222 3300031249 Bacteria 1124
112 Ga0265313_10074312 3300031595 Bacteria 1559
113 Ga0316575_10004380 3300031665 Bacteria 4965
114 Ga0316579_10069499 3300031691 Bacteria 1666
115 Ga0316578_10051510 3300031728 Bacteria 2410
116 Ga0307414_10526685 3300032004 Bacteria 1050
117 Ga0316583_10021086 3300032133 Bacteria 2336
118 Ga0316580_10012414 3300032139 Bacteria 2595
119 Ga0316593_10116430 3300032168 Bacteria 957
120 Ga0316588_1073129 3300033528 Bacteria 843
121 Ga0373934_0028721 3300035086 Bacteria 2170
122 Ga0373944_0072212 3300035089 Bacteria 1126
123 Ga0373944_0084833 3300035089 Bacteria 1051
124 Ga0373923_0063560 3300035111 Bacteria 1572
125 Ga0373936_0011769 3300035113 Bacteria 3318
126 Ga0373936_0015624 3300035113 Bacteria 2909
127 Ga0373953_0087750 3300035117 Bacteria 1299
128 Ga0373957_0063339 3300035120 Bacteria 1436
129 Ga0373943_0003856 3300035170 Bacteria 6820
130 Ga0373943_0144086 3300035170 Unclassified 1286
131 Ga0373943_0343568 3300035170 Bacteria 854
132 Ga0373955_0028887 3300035172 Bacteria 2879
133 Ga0373955_0164210 3300035172 Bacteria 1312
134 Ga0373935_0189742 3300035692 Unclassified 1415
135 Ga0373927_0030069 3300035695 Bacteria 3543
136 Ga0373927_0063434 3300035695 Bacteria 2390
137 Ga0373947_0015611 3300035725 Bacteria 4363
138 Ga0373937_0084506 3300036401 Bacteria 2936
139 Ga0316584_0160986 3300036712 Bacteria 1667
140 Ga0373925_0194562 3300037068 Bacteria 1610
141 Ga0373925_0295603 3300037068 Bacteria 1307
142 Ga0395898_0059003 3300037466 Bacteria 3735
143 Ga0395898_0087244 3300037466 Bacteria 3006
144 Ga0316581_0006063 3300037588 Bacteria 3183
145 Ga0436364_0053496 3300037853 Bacteria 31567
146 Ga0436364_0313404 3300037853 Bacteria 3615
147 Ga0436364_0980614 3300037853 Bacteria 3361
148 Ga0436364_1171513 3300037853 Bacteria 122046
149 Ga0436364_1260460 3300037853 Bacteria 34019
150 Ga0436365_1213951 3300039437 Bacteria 2423
151 Ga0436365_1275293 3300039437 Bacteria 3504
152 Ga0436365_1585976 3300039437 Bacteria 1047
153 Ga0436360_0686133 3300039438 Bacteria 1437
154 Ga0436360_0968660 3300039438 Bacteria 2494
155 Ga0436361_0639126 3300039447 Bacteria 1581
156 Ga0436361_0950266 3300039447 Bacteria 1522
157 Ga0436363_0898353 3300039450 Unclassified 755
158 Ga0436363_0964285 3300039450 Bacteria 815
159 Ga0436363_1470830 3300039450 Bacteria 5495
160 Ga0436362_0385013 3300039453 Bacteria 2526
161 Ga0436362_0872069 3300039453 Bacteria 849
162 Ga0451577_0149788 3300042876 Bacteria 2099
163 Ga0466966_0213509 3300044684 Bacteria 1166
164 Ga0466959_0129837 3300045049 Bacteria 1786
165 Ga0451576_0000426 3300045051 Bacteria 96967
166 Ga0466958_0273941 3300045836 Bacteria 1081
167 Ga0466967_0377169 3300045976 Bacteria 1376
168 Ga0495592_0050902 3300046454 Bacteria 3077
169 Ga0495592_0108188 3300046454 Bacteria 1971
170 Ga0495603_0000748 3300046455 Bacteria 18565
171 Ga0495603_0228939 3300046455 Bacteria 1072
172 Ga0495629_0011185 3300046459 Bacteria 6515
173 Ga0495641_0011605 3300046461 Bacteria 5002
174 Ga0495580_0000341 3300046472 Bacteria 38098
175 Ga0495582_0000352 3300046473 Bacteria 25196
176 Ga0495639_0003657 3300046475 Bacteria 6622
177 Ga0495639_0209481 3300046475 Bacteria 956
178 Ga0495662_0032696 3300046476 Bacteria 2514
179 Ga0495662_0146400 3300046476 Unclassified 1163
180 Ga0495664_0114872 3300046477 Bacteria 1626
181 Ga0495594_0000049 3300046499 Bacteria 52677
182 Ga0495608_0285961 3300046511 Bacteria 1023
183 Ga0495618_0207928 3300046514 Bacteria 1237
184 Ga0495618_0214828 3300046514 Bacteria 1215
185 Ga0495628_0156262 3300046516 Bacteria 1735
186 Ga0495630_0014938 3300046517 Bacteria 5663
187 Ga0495630_0824791 3300046517 Bacteria 708
188 Ga0495665_0008199 3300046531 Bacteria 5666
189 Ga0495665_0061521 3300046531 Bacteria 1982
190 Ga0495640_0047995 3300046533 Bacteria 2953
191 Ga0495640_0137411 3300046533 Bacteria 1577
192 Ga0495586_0143713 3300046535 Bacteria 1340
193 Ga0495645_0082151 3300046543 Bacteria 2311
194 Ga0495645_0176110 3300046543 Bacteria 1469
195 Ga0495622_0002864 3300046557 Bacteria 8233
196 Ga0495634_0016095 3300046642 Bacteria 5353
197 Ga0495634_0293714 3300046642 Bacteria 984
198 Ga0495588_0040142 3300046674 Unclassified 2386
199 Ga0495599_0069195 3300046678 Bacteria 2203
200 Ga0495599_0319168 3300046678 Bacteria 935
201 Ga0495647_0081929 3300046681 Unclassified 1309
202 Ga0495658_0058495 3300046683 Bacteria 2205
203 Ga0495613_0000244 3300046689 Bacteria 51563
204 Ga0495613_0128886 3300046689 Bacteria 1812
205 Ga0495600_0221901 3300046809 Bacteria 1209
206 Ga0495600_0354619 3300046809 Unclassified 918
207 Ga0495581_0006114 3300047315 Bacteria 6978
208 Ga0495604_0175651 3300047317 Bacteria 1502
209 Ga0495676_0312334 3300047321 Unclassified 1057
210 Ga0495593_0000689 3300047673 Bacteria 19483
211 Ga0495593_0045112 3300047673 Bacteria 2354
212 Ga0496102_0018859 3300048905 Bacteria 6069
213 Ga0496104_0043736 3300048907 Bacteria 4206
214 Ga0496105_0029422 3300048908 Bacteria 4496
215 Ga0496106_0501083 3300048909 Bacteria 975
216 Ga0496108_0006104 3300048911 Bacteria 9745
217 Ga0496110_0014063 3300048913 Bacteria 6633
218 Ga0496110_0044254 3300048913 Unclassified 3888
219 Ga0496111_0000449 3300048914 Bacteria 20923
220 Ga0496113_0000528 3300048916 Bacteria 18859
221 Ga0496114_0387606 3300048917 Bacteria 1237
222 Ga0496114_0516021 3300048917 Bacteria 1057
223 Ga0496115_0012089 3300048918 Bacteria 6491
224 Ga0496115_0704888 3300048918 Bacteria 793
225 Ga0496121_0147482 3300048924 Bacteria 1736
226 Ga0496126_0159644 3300048929 Bacteria 1927
227 Ga0496126_0245164 3300048929 Bacteria 1495
228 Ga0496126_0574345 3300048929 Bacteria 891
229 Ga0501047_0044247 3300049581 Bacteria 4301
230 Ga0501073_0152215 3300049589 Bacteria 1603
231 Ga0501074_0027809 3300049590 Bacteria 4100
232 Ga0501074_0680008 3300049590 Bacteria 727
233 Ga0501080_0058873 3300049742 Bacteria 3575
234 Ga0501044_0038932 3300049823 Bacteria 4964
235 nmdc:mga03683_31639_c1 3300050489 Bacteria 2124
236 nmdc:mga03683_50284_c1 3300050489 Bacteria 1737
237 nmdc:mga00v17_171824_c1 3300050491 Bacteria 1398
238 nmdc:mga0yw44_102124_c1 3300050492 Bacteria 1828
239 nmdc:mga0yw44_196025_c1 3300050492 Bacteria 1333
240 nmdc:mga0k408_202478_c1 3300050493 Bacteria 1185
241 nmdc:mga06z11_209760_c1 3300050494 Bacteria 1135
242 nmdc:mga07m45_318768_c1 3300050496 Bacteria 904
243 nmdc:mga07m45_63460_c1 3300050496 Bacteria 2095
244 nmdc:mga05p37_180889_c1 3300050507 Bacteria 2565
245 nmdc:mga06r32_651014_c1 3300050510 Bacteria 1022
246 nmdc:mga08y16_1920_c1 3300050511 Bacteria 21196
247 nmdc:mga0n895_437519_c1 3300050512 Bacteria 1321
248 nmdc:mga0a205_118328_c1 3300050515 Bacteria 2548
249 Ga0495601_0036509 3300053077 Bacteria 3069
250 Ga0495601_0044955 3300053077 Bacteria 2776
251 Ga0495612_0034095 3300053078 Bacteria 2060
252 Ga0500647_0016895 3300053091 Bacteria 3357
253 Ga0500566_0000113 3300053094 Bacteria 41467
254 Ga0500640_000015 3300053095 Bacteria 25262
255 Ga0500572_000087 3300053111 Bacteria 29543
256 Ga0500608_003463 3300053122 Bacteria 5925
257 Ga0500614_001273 3300053123 Bacteria 6098
258 Ga0500559_0028369 3300053136 Bacteria 2391
259 Ga0500590_047397 3300053148 Bacteria 2194
260 Ga0500603_001564 3300053150 Bacteria 5181
261 Ga0500616_0044895 3300053153 Bacteria 2357
262 Ga0500630_001370 3300053159 Bacteria 11489
263 Ga0500639_000050 3300053163 Bacteria 54136
264 Ga0500637_0013615 3300053178 Bacteria 4271
265 Ga0500596_010821 3300053735 Bacteria 1403
266 Ga0500601_008443 3300053737 Bacteria 1145
267 2513888237 2513237141 Bacteria 8496279
268 2835315134 2835312727 Bacteria 7413381
269 2842337315 2842333319 Bacteria 8899485
270 Ga0213875_10019680
271 rootH1_10036817
272 Ga0070658_10039160
273 Ga0070666_10047775
274 Ga0070680_100004844
275 Ga0070680_100036302
276 Ga0070682_100014716
277 Ga0070660_100177759
278 Ga0070669_100209795
279 Ga0070659_100030295
280 Ga0070667_100478570
281 Ga0070714_100122029
282 Ga0070714_100844039
283 Ga0070713_100025132
284 Ga0070713_100218943
285 Ga0070713_100553936
286 Ga0070711_100055051
287 Ga0070663_100710565
288 Ga0070681_10003583
289 Ga0070681_10097799
290 Ga0070681_10598609
291 Ga0070706_100105271
292 Ga0070698_100125767
293 Ga0070679_100076551
294 Ga0070679_100085487
295 Ga0070684_100208211
296 Ga0070693_100109786
297 Ga0068857_100497551
298 Ga0068854_100862900
299 Ga0068852_100310209
300 Ga0068852_101023963
301 Ga0068858_100000158
302 Ga0081455_10032241
303 Ga0070717_10219242
304 Ga0070717_10797238
305 Ga0075365_10103806
306 Ga0075365_10187525
307 Ga0075363_100249219
308 Ga0075364_10259426
309 Ga0070712_100003437
310 Ga0070712_100814306
311 Ga0075362_10125078
312 Ga0075367_10120966
313 Ga0075367_10169086
314 Ga0097621_100269438
315 Ga0097621_100535409
316 Ga0075370_10316465
317 Ga0068871_100304536
318 Ga0068871_100734448
319 Ga0075431_100665096
320 Ga0075433_10222026
321 Ga0075435_100498350
322 Ga0099794_10148851
323 Ga0105240_10215292
324 Ga0114129_10317727
325 Ga0105248_10534160
326 Ga0105237_10094723
327 Ga0105237_10334911
328 Ga0105238_10081186
329 Ga0105238_10179865
330 Ga0105239_10023541
331 Ga0157371_10031691
332 Ga0157371_10180103
333 Ga0157369_10052137
334 Ga0157369_10226517
335 Ga0157374_10090776
336 Ga0157378_10447012
337 Ga0163163_10006128
338 Ga0157379_10041610
339 Ga0157376_10099621
340 Ga0206354_10739475
341 Ga0213872_10068055
342 Ga0213876_10279611
343 Ga0213875_10000124
344 Ga0213875_10001749
345 Ga0213875_10006322
346 Ga0213875_10038861
347 Ga0207680_10143450
348 Ga0207685_10016001
349 Ga0207699_10008461
350 Ga0207699_10024818
351 Ga0207699_10416837
352 Ga0207705_10551306
353 Ga0207707_10000173
354 Ga0207707_10013035
355 Ga0207707_10055993
356 Ga0207693_10006890
357 Ga0207693_10083649
358 Ga0207693_10549164
359 Ga0207660_10008044
360 Ga0207660_10079699
361 Ga0207657_10194032
362 Ga0207652_10010264
363 Ga0207652_10260471
364 Ga0207681_10119346
365 Ga0207694_10082369
366 Ga0207694_10135724
367 Ga0207650_10058983
368 Ga0207700_10211438
369 Ga0207706_10055563
370 Ga0207661_10002436
371 Ga0207679_10127038
372 Ga0207667_10163293
373 Ga0207667_10326051
374 Ga0207651_10577334
375 Ga0207703_10000191
376 Ga0207639_10226452
377 Ga0207678_10544368
378 Ga0207698_10354464
379 Ga0207428_10006435
380 Ga0265339_10162222
381 Ga0265313_10074312
382 Ga0316575_10004380
383 Ga0316579_10069499
384 Ga0316578_10051510
385 Ga0307414_10526685
386 Ga0316583_10021086
387 Ga0316580_10012414
388 Ga0316593_10116430
389 Ga0316588_1073129
390 Ga0373934_0028721
391 Ga0373944_0072212
392 Ga0373944_0084833
393 Ga0373923_0063560
394 Ga0373936_0011769
395 Ga0373936_0015624
396 Ga0373953_0087750
397 Ga0373957_0063339
398 Ga0373943_0003856
399 Ga0373943_0144086
400 Ga0373943_0343568
401 Ga0373955_0028887
402 Ga0373955_0164210
403 Ga0373935_0189742
404 Ga0373927_0030069
405 Ga0373927_0063434
406 Ga0373947_0015611
407 Ga0373937_0084506
408 Ga0316584_0160986
409 Ga0373925_0194562
410 Ga0373925_0295603
411 Ga0395898_0059003
412 Ga0395898_0087244
413 Ga0316581_0006063
414 Ga0436364_0053496
415 Ga0436364_0313404
416 Ga0436364_0980614
417 Ga0436364_1171513
418 Ga0436364_1260460
419 Ga0436365_1213951
420 Ga0436365_1275293
421 Ga0436365_1585976
422 Ga0436360_0686133
423 Ga0436360_0968660
424 Ga0436361_0639126
425 Ga0436361_0950266
426 Ga0436363_0898353
427 Ga0436363_0964285
428 Ga0436363_1470830
429 Ga0436362_0385013
430 Ga0436362_0872069
431 Ga0451577_0149788
432 Ga0466966_0213509
433 Ga0466959_0129837
434 Ga0451576_0000426
435 Ga0466958_0273941
436 Ga0466967_0377169
437 Ga0495592_0050902
438 Ga0495592_0108188
439 Ga0495603_0000748
440 Ga0495603_0228939
441 Ga0495629_0011185
442 Ga0495641_0011605
443 Ga0495580_0000341
444 Ga0495582_0000352
445 Ga0495639_0003657
446 Ga0495639_0209481
447 Ga0495662_0032696
448 Ga0495662_0146400
449 Ga0495664_0114872
450 Ga0495594_0000049
451 Ga0495608_0285961
452 Ga0495618_0207928
453 Ga0495618_0214828
454 Ga0495628_0156262
455 Ga0495630_0014938
456 Ga0495630_0824791
457 Ga0495665_0008199
458 Ga0495665_0061521
459 Ga0495640_0047995
460 Ga0495640_0137411
461 Ga0495586_0143713
462 Ga0495645_0082151
463 Ga0495645_0176110
464 Ga0495622_0002864
465 Ga0495634_0016095
466 Ga0495634_0293714
467 Ga0495588_0040142
468 Ga0495599_0069195
469 Ga0495599_0319168
470 Ga0495647_0081929
471 Ga0495658_0058495
472 Ga0495613_0000244
473 Ga0495613_0128886
474 Ga0495600_0221901
475 Ga0495600_0354619
476 Ga0495581_0006114
477 Ga0495604_0175651
478 Ga0495676_0312334
479 Ga0495593_0000689
480 Ga0495593_0045112
481 Ga0496102_0018859
482 Ga0496104_0043736
483 Ga0496105_0029422
484 Ga0496106_0501083
485 Ga0496108_0006104
486 Ga0496110_0014063
487 Ga0496110_0044254
488 Ga0496111_0000449
489 Ga0496113_0000528
490 Ga0496114_0387606
491 Ga0496114_0516021
492 Ga0496115_0012089
493 Ga0496115_0704888
494 Ga0496121_0147482
495 Ga0496126_0159644
496 Ga0496126_0245164
497 Ga0496126_0574345
498 Ga0501047_0044247
499 Ga0501073_0152215
500 Ga0501074_0027809
501 Ga0501074_0680008
502 Ga0501080_0058873
503 Ga0501044_0038932
504 nmdc:mga03683_31639_c1
505 nmdc:mga03683_50284_c1
506 nmdc:mga00v17_171824_c1
507 nmdc:mga0yw44_102124_c1
508 nmdc:mga0yw44_196025_c1
509 nmdc:mga0k408_202478_c1
510 nmdc:mga06z11_209760_c1
511 nmdc:mga07m45_318768_c1
512 nmdc:mga07m45_63460_c1
513 nmdc:mga05p37_180889_c1
514 nmdc:mga06r32_651014_c1
515 nmdc:mga08y16_1920_c1
516 nmdc:mga0n895_437519_c1
517 nmdc:mga0a205_118328_c1
518 Ga0495601_0036509
519 Ga0495601_0044955
520 Ga0495612_0034095
521 Ga0500647_0016895
522 Ga0500566_0000113
523 Ga0500640_000015
524 Ga0500572_000087
525 Ga0500608_003463
526 Ga0500614_001273
527 Ga0500559_0028369
528 Ga0500590_047397
529 Ga0500603_001564
530 Ga0500616_0044895
531 Ga0500630_001370
532 Ga0500639_000050
533 Ga0500637_0013615
534 Ga0500596_010821
535 Ga0500601_008443
536 2513888237
537 2835315134
538 2842337315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

69

235

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2isj-assembly1.cif.gz_A blub bound to oxidized fmn 0.9008 7 214
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.878 19 191
3g14-assembly1.cif.gz_B crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8777 19 192
2isj-assembly1.cif.gz_A blub bound to oxidized fmn 0.8581 7 214
6q1l-assembly1.cif.gz_B crystal structure of oxidized iodotyrosine deiodinase (iyd) bound to fmn and 3-iodo-l-tyrosine 0.8462 20 194
ID Description Score Start End Superfamily
2isjB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9022 7 196 3.40.109.10
2isjB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8845 7 196 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8842 10 190 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.875 10 190 3.40.109.10
3g14A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8722 19 191 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A238JDV8-F1-model_v4 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) 0.9343 9 218 GO:0102919
AF-A0A238JDV8-F1-model_v4 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) 0.93 9 218 GO:0102919
AF-A0A1C3ZRR8-F1-model_v4 deleted 0.9292 10 217
AF-A0A398BYT6-F1-model_v4 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) 0.9282 8 218 GO:0102919
AF-A0A0M2R8U9-F1-model_v4 Cob(II)yrinic acid a,c-diamide reductase 0.926 8 217 GO:0016491

Map