F376100

General Info

Members Datasets Scaffolds Average Seq Length
269 175 266 247

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100718254|Ga0068858_1007182541
Length 271
Sequence MPAPEAGAPDDLHGGFPPXXVPKAALVTGGARRIGRALVLALAEDGYAVAVHHHASRPDAEALVADIERAGGRAVALSADLADEQAVKGLLPQAVAALGPVGVLVNNASIFENDTVATVTRDSWDAHLAVNLRAPFVLIQEFAARLPPDSGGVVINLLDERVWNLTPYFLSYTLSKSALWTLTQSTALGLAPRIRVNGIGPGPTLPSPRQSPEQFARQCRMMPLQRGTSPAEIAAALRFILSAPAMTGQMIALDGGQHLGWAQPGQIPQVE

Samples

Sample ID Description Type Environment
1 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
2 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
3 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
124 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 2.6
Rhizosphere 90.33
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1008648 3300002987 Bacteria 2774
2 JGI25151J46595_10000290 3300003187 Bacteria 56749
3 JGI25160J50197_1004214 3300003354 Bacteria 6249
4 Ga0070670_100851332 3300005331 Bacteria 825
5 Ga0070680_100015386 3300005336 Bacteria 5996
6 Ga0070682_100005946 3300005337 Bacteria 6829
7 Ga0068868_100216766 3300005338 Bacteria 1601
8 Ga0070660_100229914 3300005339 Bacteria 1509
9 Ga0070691_10064327 3300005341 Bacteria 1770
10 Ga0070668_100034566 3300005347 Bacteria 3852
11 Ga0070659_100007782 3300005366 Bacteria 7793
12 Ga0070709_10005519 3300005434 Bacteria 6849
13 Ga0070714_100004955 3300005435 Bacteria 10121
14 Ga0070714_100185298 3300005435 Bacteria 1896
15 Ga0070714_100285523 3300005435 Bacteria 1534
16 Ga0070714_100309153 3300005435 Bacteria 1475
17 Ga0070713_100069532 3300005436 Bacteria 2969
18 Ga0070713_100131995 3300005436 Bacteria 2203
19 Ga0070713_100157569 3300005436 Bacteria 2025
20 Ga0070710_10000601 3300005437 Bacteria 17146
21 Ga0070711_100000791 3300005439 Bacteria 16534
22 Ga0070711_100024589 3300005439 Bacteria 3931
23 Ga0070711_100055814 3300005439 Bacteria 2730
24 Ga0070705_100014954 3300005440 Bacteria 4003
25 Ga0070700_100287656 3300005441 Bacteria 1194
26 Ga0070694_100042667 3300005444 Bacteria 3031
27 Ga0070663_100001710 3300005455 Bacteria 12186
28 Ga0070678_100118476 3300005456 Bacteria 2084
29 Ga0070662_100272801 3300005457 Bacteria 1366
30 Ga0070681_10002483 3300005458 Bacteria 16886
31 Ga0070681_10013038 3300005458 Bacteria 8254
32 Ga0070681_10160354 3300005458 Bacteria 2173
33 Ga0070706_100052118 3300005467 Bacteria 3777
34 Ga0070706_100412057 3300005467 Bacteria 1258
35 Ga0070707_100007401 3300005468 Bacteria 10195
36 Ga0070698_100002604 3300005471 Bacteria 19881
37 Ga0070698_100147324 3300005471 Bacteria 2303
38 Ga0070698_100289593 3300005471 Bacteria 1569
39 Ga0070699_100029256 3300005518 Bacteria 4749
40 Ga0070699_100185592 3300005518 Bacteria 1847
41 Ga0070679_100012334 3300005530 Bacteria 8162
42 Ga0070679_100013459 3300005530 Bacteria 7833
43 Ga0070684_100201921 3300005535 Bacteria 1811
44 Ga0070697_100087963 3300005536 Bacteria 2565
45 Ga0070697_100109725 3300005536 Bacteria 2298
46 Ga0068853_100021815 3300005539 Bacteria 5342
47 Ga0070695_100006171 3300005545 Bacteria 7083
48 Ga0070695_100050978 3300005545 Bacteria 2654
49 Ga0070696_100036056 3300005546 Bacteria 3408
50 Ga0070665_100293955 3300005548 Bacteria 1627
51 Ga0070665_100600105 3300005548 Bacteria 1114
52 Ga0068855_100037468 3300005563 Bacteria 5765
53 Ga0070664_100168300 3300005564 Bacteria 1943
54 Ga0068854_100519578 3300005578 Bacteria 1005
55 Ga0068856_100029512 3300005614 Bacteria 5357
56 Ga0070702_100064956 3300005615 Bacteria 2136
57 Ga0068861_100194351 3300005719 Bacteria 1699
58 Ga0068858_100718254 3300005842 Bacteria 973
59 Ga0068860_100061700 3300005843 Bacteria 3562
60 Ga0081540_1038030 3300005983 Bacteria 2542
61 Ga0070717_10000230 3300006028 Bacteria 38578
62 Ga0070717_10008007 3300006028 Bacteria 7874
63 Ga0070717_10111823 3300006028 Bacteria 2331
64 Ga0070716_100172619 3300006173 Bacteria 1412
65 Ga0070712_100001947 3300006175 Bacteria 12657
66 Ga0070712_100246968 3300006175 Bacteria 1424
67 Ga0075435_100238358 3300007076 Bacteria 1546
68 Ga0105245_10412789 3300009098 Bacteria 1352
69 Ga0105243_10005920 3300009148 Bacteria 9472
70 Ga0105241_10006259 3300009174 Bacteria 8775
71 Ga0105238_10013850 3300009551 Bacteria 8152
72 Ga0105239_10023741 3300010375 Bacteria 6752
73 Ga0105246_10004253 3300011119 Bacteria 8706
74 Ga0157370_10018088 3300013104 Bacteria 7095
75 Ga0157369_10540329 3300013105 Bacteria 1205
76 Ga0157369_10619198 3300013105 Bacteria 1117
77 Ga0157378_10144223 3300013297 Bacteria 2214
78 Ga0157379_10044682 3300014968 Bacteria 3955
79 Ga0157379_10100690 3300014968 Bacteria 2594
80 Ga0213872_10000606 3300021361 Bacteria 27189
81 Ga0213872_10004997 3300021361 Bacteria 6890
82 Ga0213872_10007283 3300021361 Bacteria 5462
83 Ga0213872_10009639 3300021361 Bacteria 4623
84 Ga0213872_10016819 3300021361 Bacteria 3389
85 Ga0213872_10021556 3300021361 Bacteria 2967
86 Ga0213872_10040687 3300021361 Bacteria 2122
87 Ga0213872_10079835 3300021361 Bacteria 1470
88 Ga0213876_10026707 3300021384 Bacteria 3045
89 Ga0213875_10000145 3300021388 Bacteria 75194
90 Ga0213875_10007933 3300021388 Bacteria 5458
91 Ga0213875_10011053 3300021388 Bacteria 4505
92 Ga0228598_1006456 3300024227 Bacteria 2428
93 Ga0209130_1001424 3300025284 Bacteria 15911
94 Ga0209025_1000212 3300025294 Bacteria 139086
95 Ga0209758_1005134 3300025297 Bacteria 10337
96 Ga0207426_1000102 3300025302 Bacteria 255303
97 Ga0207692_10059782 3300025898 Bacteria 1969
98 Ga0207647_10058681 3300025904 Bacteria 2356
99 Ga0207699_10001605 3300025906 Bacteria 10738
100 Ga0207684_10123230 3300025910 Bacteria 2223
101 Ga0207654_10229335 3300025911 Bacteria 1236
102 Ga0207707_10021403 3300025912 Bacteria 5653
103 Ga0207707_10041710 3300025912 Bacteria 4007
104 Ga0207707_10459078 3300025912 Bacteria 1089
105 Ga0207693_10000460 3300025915 Bacteria 37218
106 Ga0207693_10057638 3300025915 Bacteria 3044
107 Ga0207693_10070123 3300025915 Bacteria 2743
108 Ga0207693_10313527 3300025915 Bacteria 1228
109 Ga0207663_10013565 3300025916 Bacteria 4432
110 Ga0207660_10035294 3300025917 Bacteria 3471
111 Ga0207657_10023037 3300025919 Bacteria 5809
112 Ga0207649_10180306 3300025920 Bacteria 1478
113 Ga0207652_10005712 3300025921 Bacteria 10099
114 Ga0207652_10207827 3300025921 Bacteria 1762
115 Ga0207646_10190858 3300025922 Bacteria 1850
116 Ga0207694_10268114 3300025924 Bacteria 1400
117 Ga0207700_10002530 3300025928 Bacteria 10490
118 Ga0207700_10083558 3300025928 Bacteria 2500
119 Ga0207700_10317066 3300025928 Bacteria 1350
120 Ga0207664_10007945 3300025929 Bacteria 7375
121 Ga0207664_10216185 3300025929 Unclassified 1660
122 Ga0207690_10065163 3300025932 Bacteria 2490
123 Ga0207665_10021497 3300025939 Bacteria 4243
124 Ga0207665_10133316 3300025939 Bacteria 1765
125 Ga0207667_10178716 3300025949 Bacteria 2180
126 Ga0207668_10220965 3300025972 Bacteria 1521
127 Ga0207640_10358701 3300025981 Bacteria 1174
128 Ga0207658_10032844 3300025986 Bacteria 3698
129 Ga0207658_10246297 3300025986 Bacteria 1517
130 Ga0207677_10367519 3300026023 Bacteria 1210
131 Ga0207703_10245530 3300026035 Bacteria 1611
132 Ga0207703_10288206 3300026035 Bacteria 1493
133 Ga0207639_10008101 3300026041 Bacteria 7185
134 Ga0207678_10000132 3300026067 Bacteria 62810
135 Ga0207708_10319813 3300026075 Bacteria 1266
136 Ga0207702_10065971 3300026078 Bacteria 3101
137 Ga0207702_10453269 3300026078 Bacteria 1245
138 Ga0268266_10545199 3300028379 Bacteria 1111
139 Ga0268266_10736469 3300028379 Bacteria 951
140 Ga0265329_10040410 3300031242 Bacteria 1497
141 Ga0265327_10002872 3300031251 Bacteria 17334
142 Ga0265316_10037137 3300031344 Bacteria 3935
143 Ga0265342_10084069 3300031712 Bacteria 1834
144 Ga0373934_0009311 3300035086 Bacteria 3677
145 Ga0373934_0047744 3300035086 Bacteria 1694
146 Ga0373953_0019747 3300035117 Bacteria 2510
147 Ga0373954_0004047 3300035118 Bacteria 6272
148 Ga0373954_0187233 3300035118 Unclassified 1016
149 Ga0373957_0005349 3300035120 Bacteria 3975
150 Ga0373943_0265535 3300035170 Unclassified 967
151 Ga0373955_0001423 3300035172 Bacteria 10181
152 Ga0373924_0071774 3300035410 Bacteria 1461
153 Ga0373931_0181602 3300035691 Bacteria 1246
154 Ga0373931_0236774 3300035691 Bacteria 1105
155 Ga0373933_0001689 3300035724 Bacteria 12836
156 Ga0373933_0074719 3300035724 Bacteria 2068
157 Ga0373933_0092012 3300035724 Bacteria 1873
158 Ga0373947_0042815 3300035725 Bacteria 2703
159 Ga0373947_0127437 3300035725 Bacteria 1622
160 Ga0373937_0012902 3300036401 Bacteria 7359
161 Ga0373937_0027872 3300036401 Bacteria 5110
162 Ga0373937_0097054 3300036401 Bacteria 2733
163 Ga0373937_0188959 3300036401 Bacteria 1935
164 Ga0373925_0100910 3300037068 Bacteria 2219
165 Ga0395898_0073669 3300037466 Bacteria 3299
166 Ga0436364_0056880 3300037853 Bacteria 87492
167 Ga0436364_0062844 3300037853 Bacteria 42162
168 Ga0436364_0414080 3300037853 Bacteria 6313
169 Ga0436364_1493393 3300037853 Bacteria 1197
170 Ga0395901_0010632 3300038443 Bacteria 9326
171 Ga0395901_0273103 3300038443 Bacteria 1758
172 Ga0395901_0434763 3300038443 Bacteria 1344
173 Ga0436365_0934504 3300039437 Bacteria 1235
174 Ga0436365_1428539 3300039437 Bacteria 1132
175 Ga0436360_0119295 3300039438 Bacteria 1806
176 Ga0436360_0254736 3300039438 Bacteria 2363
177 Ga0436360_0770041 3300039438 Bacteria 1041
178 Ga0436360_0840642 3300039438 Bacteria 3764
179 Ga0436360_1071904 3300039438 Bacteria 2061
180 Ga0436361_0049175 3300039447 Bacteria 1590
181 Ga0436361_0075171 3300039447 Bacteria 5289
182 Ga0436361_0242926 3300039447 Bacteria 32751
183 Ga0436361_0248942 3300039447 Bacteria 11981
184 Ga0436361_0287258 3300039447 Bacteria 3406
185 Ga0436361_0461392 3300039447 Bacteria 5831
186 Ga0436361_0681229 3300039447 Bacteria 4374
187 Ga0436361_0705649 3300039447 Bacteria 2318
188 Ga0436361_0719120 3300039447 Bacteria 8324
189 Ga0436361_0963791 3300039447 Bacteria 22825
190 Ga0436363_0064137 3300039450 Bacteria 3572
191 Ga0436362_0142033 3300039453 Bacteria 1718
192 Ga0436362_0401702 3300039453 Bacteria 4353
193 Ga0439431_0004418 3300041997 Bacteria 3092
194 Ga0439458_0009445 3300042157 Bacteria 2171
195 Ga0439459_0013482 3300042438 Bacteria 1472
196 Ga0466966_0015514 3300044684 Bacteria 5036
197 Ga0453684_0144497 3300044712 Bacteria 2836
198 Ga0466957_0005329 3300044842 Bacteria 7216
199 Ga0451576_0000159 3300045051 Bacteria 171363
200 Ga0451576_0388295 3300045051 Bacteria 1463
201 Ga0466958_0000303 3300045836 Bacteria 19346
202 Ga0495580_0366172 3300046472 Unclassified 975
203 Ga0495610_0040783 3300046512 Bacteria 2336
204 Ga0495618_0293467 3300046514 Bacteria 1011
205 Ga0495640_0155018 3300046533 Bacteria 1470
206 Ga0495586_0044296 3300046535 Bacteria 2397
207 Ga0495667_0052906 3300046559 Bacteria 2674
208 Ga0495635_0113495 3300046663 Bacteria 1850
209 Ga0495600_0308954 3300046809 Bacteria 996
210 Ga0495684_0227623 3300047471 Bacteria 1365
211 Ga0495684_0276516 3300047471 Bacteria 1213
212 Ga0496100_0008386 3300048903 Bacteria 5762
213 Ga0496102_0457340 3300048905 Unclassified 1197
214 Ga0496103_0004702 3300048906 Bacteria 8261
215 Ga0496106_0022233 3300048909 Bacteria 4710
216 Ga0496107_0004994 3300048910 Bacteria 9032
217 Ga0496113_0282033 3300048916 Bacteria 1328
218 Ga0496115_0010175 3300048918 Bacteria 7019
219 Ga0501032_0012502 3300049569 Bacteria 6061
220 Ga0501034_0000013 3300049571 Bacteria 297898
221 Ga0501036_0018165 3300049572 Bacteria 5890
222 Ga0501037_0013012 3300049573 Bacteria 6133
223 Ga0501038_0029439 3300049574 Bacteria 4866
224 Ga0501038_0149511 3300049574 Bacteria 1905
225 Ga0501039_0001004 3300049575 Bacteria 20555
226 Ga0501039_0030021 3300049575 Bacteria 4189
227 Ga0501042_0023358 3300049578 Bacteria 4327
228 Ga0501043_0066349 3300049579 Bacteria 2834
229 Ga0501043_0439871 3300049579 Bacteria 981
230 Ga0501046_0066561 3300049580 Bacteria 2807
231 Ga0501046_0431998 3300049580 Bacteria 948
232 Ga0501047_0000212 3300049581 Bacteria 69742
233 Ga0501047_0070542 3300049581 Bacteria 3364
234 Ga0501047_0136022 3300049581 Bacteria 2338
235 Ga0501047_0334384 3300049581 Bacteria 1353
236 Ga0501048_0000953 3300049582 Bacteria 21365
237 Ga0501048_0094808 3300049582 Bacteria 2105
238 Ga0501067_0025732 3300049583 Bacteria 3261
239 Ga0501070_0020729 3300049586 Bacteria 5513
240 Ga0501070_0067191 3300049586 Bacteria 2969
241 Ga0501072_0145842 3300049588 Bacteria 1887
242 Ga0501073_0107849 3300049589 Bacteria 1932
243 Ga0501074_0261605 3300049590 Bacteria 1230
244 Ga0501075_0083497 3300049591 Bacteria 2420
245 Ga0501077_0042053 3300049593 Bacteria 2908
246 Ga0501079_0125813 3300049741 Bacteria 1994
247 Ga0501080_0000003 3300049742 Bacteria 214890
248 Ga0501080_0094159 3300049742 Bacteria 2782
249 Ga0501081_0152213 3300049743 Bacteria 1662
250 Ga0501081_0214330 3300049743 Bacteria 1399
251 Ga0501083_0021391 3300049744 Bacteria 4495
252 Ga0501083_0048070 3300049744 Bacteria 2881
253 Ga0501035_0000149 3300049822 Bacteria 85464
254 Ga0501035_0192161 3300049822 Bacteria 1755
255 Ga0501035_0283527 3300049822 Bacteria 1400
256 Ga0501044_0000392 3300049823 Bacteria 54287
257 Ga0501044_0075955 3300049823 Bacteria 3411
258 Ga0501044_0327642 3300049823 Bacteria 1455
259 nmdc:mga0n895_266633_c1 3300050512 Bacteria 1737
260 Ga0495601_0056640 3300053077 Bacteria 2483
261 Ga0495601_0161716 3300053077 Bacteria 1463
262 Ga0495595_0012030 3300053084 Bacteria 3629
263 Ga0495619_0003815 3300053085 Bacteria 9698
264 Ga0495619_0166033 3300053085 Bacteria 1526
265 Ga0501082_0021705 3300060353 Bacteria 5535
266 Ga0530510_0026311 3300061734 Bacteria 4164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100007401 Ga0070707_10000740112 215
2 3300025922 Ga0207646_10190858 Ga0207646_101908582 215
3 3300046514 Ga0495618_0293467 Ga0495618_0293467_87_926 217
4 3300036401 Ga0373937_0188959 Ga0373937_0188959_495_1301 220
5 3300046535 Ga0495586_0044296 Ga0495586_0044296_512_1318 220
6 3300046559 Ga0495667_0052906 Ga0495667_0052906_984_1790 220
7 3300046663 Ga0495635_0113495 Ga0495635_0113495_894_1700 220
8 3300046809 Ga0495600_0308954 Ga0495600_0308954_156_983 220
9 3300053077 Ga0495601_0056640 Ga0495601_0056640_1020_1826 220
10 3300053084 Ga0495595_0012030 Ga0495595_0012030_1018_1824 220
11 3300053085 Ga0495619_0003815 Ga0495619_0003815_3224_4030 220
12 3300005458 Ga0070681_10013038 Ga0070681_100130385 221
13 3300049743 Ga0501081_0214330 Ga0501081_0214330_66_830 226
14 3300038443 Ga0395901_0010632 Ga0395901_0010632_7912_8712 228
15 3300039438 Ga0436360_1071904 Ga0436360_1071904_1083_1898 228
16 3300039447 Ga0436361_0705649 Ga0436361_0705649_746_1492 229
17 3300005530 Ga0070679_100013459 Ga0070679_1000134595 230
18 3300013104 Ga0157370_10018088 Ga0157370_100180882 230
19 3300025912 Ga0207707_10021403 Ga0207707_100214032 230
20 3300025921 Ga0207652_10207827 Ga0207652_102078271 230
21 3300039438 Ga0436360_0840642 Ga0436360_0840642_2047_2802 230
22 3300044712 Ga0453684_0144497 Ga0453684_0144497_453_1229 232
23 3300045051 Ga0451576_0000159 Ga0451576_0000159_57157_57933 232
24 3300049581 Ga0501047_0334384 Ga0501047_0334384_573_1343 232
25 3300049823 Ga0501044_0327642 Ga0501044_0327642_315_1085 232
26 3300049744 Ga0501083_0048070 Ga0501083_0048070_1331_2110 233
27 3300025912 Ga0207707_10459078 Ga0207707_104590781 234
28 3300039447 Ga0436361_0461392 Ga0436361_0461392_4682_5428 234
29 3300049572 Ga0501036_0018165 Ga0501036_0018165_743_1525 234
30 3300049574 Ga0501038_0149511 Ga0501038_0149511_1090_1872 234
31 3300049575 Ga0501039_0030021 Ga0501039_0030021_2354_3136 234
32 3300049578 Ga0501042_0023358 Ga0501042_0023358_2635_3417 234
33 3300049579 Ga0501043_0439871 Ga0501043_0439871_120_902 234
34 3300049580 Ga0501046_0431998 Ga0501046_0431998_30_812 234
35 3300049582 Ga0501048_0094808 Ga0501048_0094808_125_907 234
36 3300049588 Ga0501072_0145842 Ga0501072_0145842_357_1139 234
37 3300049590 Ga0501074_0261605 Ga0501074_0261605_361_1143 234
38 3300049591 Ga0501075_0083497 Ga0501075_0083497_98_880 234
39 3300049593 Ga0501077_0042053 Ga0501077_0042053_1341_2123 234
40 3300049741 Ga0501079_0125813 Ga0501079_0125813_94_876 234
41 3300049743 Ga0501081_0152213 Ga0501081_0152213_351_1133 234
42 3300061734 Ga0530510_0026311 Ga0530510_0026311_331_1113 234
43 3300006028 Ga0070717_10111823 Ga0070717_101118232 235
44 3300025939 Ga0207665_10133316 Ga0207665_101333161 235
45 3300035086 Ga0373934_0047744 Ga0373934_0047744_339_1142 235
46 3300035724 Ga0373933_0074719 Ga0373933_0074719_995_1798 235
47 3300036401 Ga0373937_0027872 Ga0373937_0027872_581_1384 235
48 3300039438 Ga0436360_0119295 Ga0436360_0119295_576_1346 235
49 3300049822 Ga0501035_0283527 Ga0501035_0283527_11_790 235
50 3300039437 Ga0436365_1428539 Ga0436365_1428539_231_1004 236
51 3300005458 Ga0070681_10160354 Ga0070681_101603542 237
52 3300005471 Ga0070698_100002604 Ga0070698_1000026045 237
53 3300005536 Ga0070697_100109725 Ga0070697_1001097252 237
54 3300006028 Ga0070717_10000230 Ga0070717_1000023021 237
55 3300035118 Ga0373954_0187233 Ga0373954_0187233_11_787 237
56 3300035170 Ga0373943_0265535 Ga0373943_0265535_140_916 237
57 3300035691 Ga0373931_0236774 Ga0373931_0236774_112_885 237
58 3300035724 Ga0373933_0092012 Ga0373933_0092012_144_920 237
59 3300037068 Ga0373925_0100910 Ga0373925_0100910_121_897 237
60 3300045051 Ga0451576_0388295 Ga0451576_0388295_81_854 237
61 3300046472 Ga0495580_0366172 Ga0495580_0366172_176_952 237
62 3300053085 Ga0495619_0166033 Ga0495619_0166033_81_857 237
63 3300005434 Ga0070709_10005519 Ga0070709_100055196 238
64 3300005435 Ga0070714_100004955 Ga0070714_1000049559 238
65 3300005436 Ga0070713_100069532 Ga0070713_1000695322 238
66 3300005437 Ga0070710_10000601 Ga0070710_100006012 238
67 3300005439 Ga0070711_100000791 Ga0070711_10000079113 238
68 3300005467 Ga0070706_100052118 Ga0070706_1000521182 238
69 3300005518 Ga0070699_100029256 Ga0070699_1000292563 238
70 3300006028 Ga0070717_10008007 Ga0070717_100080072 238
71 3300006173 Ga0070716_100172619 Ga0070716_1001726192 238
72 3300006175 Ga0070712_100001947 Ga0070712_1000019475 238
73 3300025898 Ga0207692_10059782 Ga0207692_100597822 238
74 3300025906 Ga0207699_10001605 Ga0207699_100016056 238
75 3300025910 Ga0207684_10123230 Ga0207684_101232302 238
76 3300025915 Ga0207693_10000460 Ga0207693_100004607 238
77 3300025916 Ga0207663_10013565 Ga0207663_100135652 238
78 3300025928 Ga0207700_10083558 Ga0207700_100835582 238
79 3300025929 Ga0207664_10007945 Ga0207664_100079454 238
80 3300038443 Ga0395901_0434763 Ga0395901_0434763_150_923 238
81 3300049581 Ga0501047_0070542 Ga0501047_0070542_1011_1802 239
82 3300021384 Ga0213876_10026707 Ga0213876_100267072 240
83 3300021388 Ga0213875_10000145 Ga0213875_1000014527 240
84 3300037853 Ga0436364_0056880 Ga0436364_0056880_27853_28668 240
85 3300039453 Ga0436362_0401702 Ga0436362_0401702_1515_2345 240
86 3300005439 Ga0070711_100024589 Ga0070711_1000245892 241
87 3300025915 Ga0207693_10057638 Ga0207693_100576382 241
88 3300039437 Ga0436365_0934504 Ga0436365_0934504_399_1217 241
89 3300049586 Ga0501070_0067191 Ga0501070_0067191_137_916 241
90 3300049744 Ga0501083_0021391 Ga0501083_0021391_1450_2229 241
91 3300005435 Ga0070714_100285523 Ga0070714_1002855231 242
92 3300005435 Ga0070714_100309153 Ga0070714_1003091531 242
93 3300005436 Ga0070713_100131995 Ga0070713_1001319951 242
94 3300005436 Ga0070713_100157569 Ga0070713_1001575692 242
95 3300005439 Ga0070711_100055814 Ga0070711_1000558142 242
96 3300005467 Ga0070706_100412057 Ga0070706_1004120571 242
97 3300005471 Ga0070698_100289593 Ga0070698_1002895932 242
98 3300005518 Ga0070699_100185592 Ga0070699_1001855922 242
99 3300006175 Ga0070712_100246968 Ga0070712_1002469682 242
100 3300007076 Ga0075435_100238358 Ga0075435_1002383582 242
101 3300025915 Ga0207693_10070123 Ga0207693_100701232 242
102 3300025915 Ga0207693_10313527 Ga0207693_103135272 242
103 3300025928 Ga0207700_10002530 Ga0207700_100025309 242
104 3300025929 Ga0207664_10216185 Ga0207664_102161852 242
105 3300025939 Ga0207665_10021497 Ga0207665_100214972 242
106 3300026078 Ga0207702_10453269 Ga0207702_104532691 242
107 3300035086 Ga0373934_0009311 Ga0373934_0009311_792_1628 242
108 3300035117 Ga0373953_0019747 Ga0373953_0019747_990_1826 242
109 3300035118 Ga0373954_0004047 Ga0373954_0004047_2242_3078 242
110 3300035120 Ga0373957_0005349 Ga0373957_0005349_3009_3845 242
111 3300035172 Ga0373955_0001423 Ga0373955_0001423_422_1258 242
112 3300035410 Ga0373924_0071774 Ga0373924_0071774_376_1212 242
113 3300035691 Ga0373931_0181602 Ga0373931_0181602_338_1165 242
114 3300035724 Ga0373933_0001689 Ga0373933_0001689_2469_3305 242
115 3300036401 Ga0373937_0012902 Ga0373937_0012902_2242_3078 242
116 3300039438 Ga0436360_0254736 Ga0436360_0254736_1284_2099 242
117 3300046533 Ga0495640_0155018 Ga0495640_0155018_122_958 242
118 3300047471 Ga0495684_0227623 Ga0495684_0227623_338_1174 242
119 3300053077 Ga0495601_0161716 Ga0495601_0161716_423_1259 242
120 3300005983 Ga0081540_1038030 Ga0081540_10380301 243
121 3300031251 Ga0265327_10002872 Ga0265327_100028729 243
122 3300031344 Ga0265316_10037137 Ga0265316_100371372 243
123 3300035725 Ga0373947_0127437 Ga0373947_0127437_226_1068 243
124 3300039450 Ga0436363_0064137 Ga0436363_0064137_1464_2279 243
125 3300005536 Ga0070697_100087963 Ga0070697_1000879632 245
126 3300021388 Ga0213875_10011053 Ga0213875_100110533 245
127 3300024227 Ga0228598_1006456 Ga0228598_10064562 245
128 3300037853 Ga0436364_0062844 Ga0436364_0062844_28057_28872 245
129 3300039447 Ga0436361_0075171 Ga0436361_0075171_704_1441 245
130 3300039447 Ga0436361_0287258 Ga0436361_0287258_815_1552 245
131 3300039447 Ga0436361_0681229 Ga0436361_0681229_2124_2861 245
132 3300045836 Ga0466958_0000303 Ga0466958_0000303_10056_10793 245
133 3300013105 Ga0157369_10619198 Ga0157369_106191981 246
134 3300037466 Ga0395898_0073669 Ga0395898_0073669_1229_1969 246
135 3300038443 Ga0395901_0273103 Ga0395901_0273103_378_1118 246
136 3300039453 Ga0436362_0142033 Ga0436362_0142033_698_1513 246
137 3300048905 Ga0496102_0457340 Ga0496102_0457340_333_1073 246
138 3300049569 Ga0501032_0012502 Ga0501032_0012502_3288_4028 246
139 3300049571 Ga0501034_0000013 Ga0501034_0000013_23641_24381 246
140 3300049573 Ga0501037_0013012 Ga0501037_0013012_5217_5957 246
141 3300049574 Ga0501038_0029439 Ga0501038_0029439_956_1696 246
142 3300049575 Ga0501039_0001004 Ga0501039_0001004_3473_4213 246
143 3300049579 Ga0501043_0066349 Ga0501043_0066349_962_1702 246
144 3300049580 Ga0501046_0066561 Ga0501046_0066561_1054_1794 246
145 3300049581 Ga0501047_0000212 Ga0501047_0000212_48119_48859 246
146 3300049582 Ga0501048_0000953 Ga0501048_0000953_1271_2011 246
147 3300049583 Ga0501067_0025732 Ga0501067_0025732_1971_2711 246
148 3300049586 Ga0501070_0020729 Ga0501070_0020729_3594_4334 246
149 3300049589 Ga0501073_0107849 Ga0501073_0107849_629_1369 246
150 3300049742 Ga0501080_0000003 Ga0501080_0000003_16148_16888 246
151 3300049822 Ga0501035_0000149 Ga0501035_0000149_34415_35155 246
152 3300049823 Ga0501044_0000392 Ga0501044_0000392_19713_20453 246
153 3300060353 Ga0501082_0021705 Ga0501082_0021705_4624_5364 246
154 3300005336 Ga0070680_100015386 Ga0070680_1000153866 247
155 3300005337 Ga0070682_100005946 Ga0070682_1000059462 247
156 3300005338 Ga0068868_100216766 Ga0068868_1002167661 247
157 3300005339 Ga0070660_100229914 Ga0070660_1002299142 247
158 3300005341 Ga0070691_10064327 Ga0070691_100643273 247
159 3300005366 Ga0070659_100007782 Ga0070659_1000077822 247
160 3300005440 Ga0070705_100014954 Ga0070705_1000149543 247
161 3300005441 Ga0070700_100287656 Ga0070700_1002876561 247
162 3300005444 Ga0070694_100042667 Ga0070694_1000426672 247
163 3300005455 Ga0070663_100001710 Ga0070663_1000017105 247
164 3300005456 Ga0070678_100118476 Ga0070678_1001184761 247
165 3300005458 Ga0070681_10002483 Ga0070681_100024831 247
166 3300005530 Ga0070679_100012334 Ga0070679_1000123343 247
167 3300005535 Ga0070684_100201921 Ga0070684_1002019213 247
168 3300005539 Ga0068853_100021815 Ga0068853_1000218153 247
169 3300005545 Ga0070695_100006171 Ga0070695_1000061714 247
170 3300005548 Ga0070665_100293955 Ga0070665_1002939551 247
171 3300005563 Ga0068855_100037468 Ga0068855_1000374685 247
172 3300005578 Ga0068854_100519578 Ga0068854_1005195781 247
173 3300005615 Ga0070702_100064956 Ga0070702_1000649561 247
174 3300005843 Ga0068860_100061700 Ga0068860_1000617002 247
175 3300009098 Ga0105245_10412789 Ga0105245_104127891 247
176 3300009148 Ga0105243_10005920 Ga0105243_100059202 247
177 3300009174 Ga0105241_10006259 Ga0105241_100062596 247
178 3300009551 Ga0105238_10013850 Ga0105238_100138501 247
179 3300010375 Ga0105239_10023741 Ga0105239_100237415 247
180 3300011119 Ga0105246_10004253 Ga0105246_100042535 247
181 3300013105 Ga0157369_10540329 Ga0157369_105403291 247
182 3300013297 Ga0157378_10144223 Ga0157378_101442231 247
183 3300014968 Ga0157379_10044682 Ga0157379_100446824 247
184 3300021361 Ga0213872_10007283 Ga0213872_100072836 247
185 3300021361 Ga0213872_10040687 Ga0213872_100406872 247
186 3300025904 Ga0207647_10058681 Ga0207647_100586812 247
187 3300025911 Ga0207654_10229335 Ga0207654_102293352 247
188 3300025912 Ga0207707_10041710 Ga0207707_100417101 247
189 3300025917 Ga0207660_10035294 Ga0207660_100352944 247
190 3300025919 Ga0207657_10023037 Ga0207657_100230371 247
191 3300025920 Ga0207649_10180306 Ga0207649_101803062 247
192 3300025921 Ga0207652_10005712 Ga0207652_100057126 247
193 3300025924 Ga0207694_10268114 Ga0207694_102681141 247
194 3300025932 Ga0207690_10065163 Ga0207690_100651633 247
195 3300025949 Ga0207667_10178716 Ga0207667_101787162 247
196 3300025981 Ga0207640_10358701 Ga0207640_103587012 247
197 3300025986 Ga0207658_10246297 Ga0207658_102462972 247
198 3300026023 Ga0207677_10367519 Ga0207677_103675191 247
199 3300026035 Ga0207703_10288206 Ga0207703_102882061 247
200 3300026041 Ga0207639_10008101 Ga0207639_100081015 247
201 3300026067 Ga0207678_10000132 Ga0207678_1000013231 247
202 3300026075 Ga0207708_10319813 Ga0207708_103198132 247
203 3300028379 Ga0268266_10736469 Ga0268266_107364691 247
204 3300035725 Ga0373947_0042815 Ga0373947_0042815_1394_2236 247
205 3300037853 Ga0436364_1493393 Ga0436364_1493393_222_1037 247
206 3300039447 Ga0436361_0049175 Ga0436361_0049175_347_1090 247
207 3300039447 Ga0436361_0719120 Ga0436361_0719120_6600_7346 247
208 3300044684 Ga0466966_0015514 Ga0466966_0015514_605_1348 247
209 3300044842 Ga0466957_0005329 Ga0466957_0005329_728_1471 247
210 3300048903 Ga0496100_0008386 Ga0496100_0008386_975_1718 247
211 3300048906 Ga0496103_0004702 Ga0496103_0004702_2410_3153 247
212 3300048909 Ga0496106_0022233 Ga0496106_0022233_631_1374 247
213 3300048910 Ga0496107_0004994 Ga0496107_0004994_4950_5693 247
214 3300048918 Ga0496115_0010175 Ga0496115_0010175_972_1715 247
215 3300049742 Ga0501080_0094159 Ga0501080_0094159_725_1504 247
216 3300005435 Ga0070714_100185298 Ga0070714_1001852982 248
217 3300005564 Ga0070664_100168300 Ga0070664_1001683002 248
218 3300005614 Ga0068856_100029512 Ga0068856_1000295122 248
219 3300025928 Ga0207700_10317066 Ga0207700_103170661 248
220 3300026078 Ga0207702_10065971 Ga0207702_100659712 248
221 3300048916 Ga0496113_0282033 Ga0496113_0282033_202_1029 248
222 3300049823 Ga0501044_0075955 Ga0501044_0075955_1960_2715 248
223 3300050512 nmdc:mga0n895_266633_c1 nmdc:mga0n895_266633_c1_46_873 248
224 3300025986 Ga0207658_10032844 Ga0207658_100328445 249
225 3300049822 Ga0501035_0192161 Ga0501035_0192161_512_1285 249
226 3300042157 Ga0439458_0009445 Ga0439458_0009445_1035_1790 251
227 iso_pu_bacteria 2883354860 2883355846 251
228 iso_pu_bacteria 2883291878 2883292876 252
229 3300039438 Ga0436360_0770041 Ga0436360_0770041_158_946 253
230 3300005331 Ga0070670_100851332 Ga0070670_1008513321 254
231 3300005347 Ga0070668_100034566 Ga0070668_1000345664 254
232 3300005457 Ga0070662_100272801 Ga0070662_1002728011 254
233 3300005548 Ga0070665_100600105 Ga0070665_1006001052 254
234 3300005719 Ga0068861_100194351 Ga0068861_1001943513 254
235 3300025972 Ga0207668_10220965 Ga0207668_102209652 254
236 3300028379 Ga0268266_10545199 Ga0268266_105451992 254
237 3300042438 Ga0439459_0013482 Ga0439459_0013482_437_1201 254
238 3300005545 Ga0070695_100050978 Ga0070695_1000509782 255
239 3300005546 Ga0070696_100036056 Ga0070696_1000360563 255
240 3300005471 Ga0070698_100147324 Ga0070698_1001473243 256
241 3300031242 Ga0265329_10040410 Ga0265329_100404102 256
242 3300031712 Ga0265342_10084069 Ga0265342_100840691 256
243 3300036401 Ga0373937_0097054 Ga0373937_0097054_319_1089 256
244 3300021361 Ga0213872_10000606 Ga0213872_1000060622 257
245 3300021361 Ga0213872_10004997 Ga0213872_100049972 257
246 3300021361 Ga0213872_10009639 Ga0213872_100096394 257
247 3300021361 Ga0213872_10016819 Ga0213872_100168192 257
248 3300021361 Ga0213872_10021556 Ga0213872_100215562 257
249 3300021361 Ga0213872_10079835 Ga0213872_100798352 257
250 3300021388 Ga0213875_10007933 Ga0213875_100079332 257
251 3300037853 Ga0436364_0414080 Ga0436364_0414080_4066_4839 257
252 3300039447 Ga0436361_0242926 Ga0436361_0242926_27420_28193 257
253 3300039447 Ga0436361_0248942 Ga0436361_0248942_5552_6325 257
254 3300039447 Ga0436361_0963791 Ga0436361_0963791_14560_15333 257
255 3300047471 Ga0495684_0276516 Ga0495684_0276516_158_940 257
256 3300049581 Ga0501047_0136022 Ga0501047_0136022_337_1119 257
257 3300014968 Ga0157379_10100690 Ga0157379_101006903 261
258 3300005842 Ga0068858_100718254 Ga0068858_1007182541 264
259 3300026035 Ga0207703_10245530 Ga0207703_102455301 264
260 3300003187 JGI25151J46595_10000290 JGI25151J46595_1000029014 265
261 3300025294 Ga0209025_1000212 Ga0209025_100021276 265
262 3300025297 Ga0209758_1005134 Ga0209758_10051346 265
263 3300002987 JGI25159J45721_1008648 JGI25159J45721_10086481 267
264 3300003354 JGI25160J50197_1004214 JGI25160J50197_10042145 267
265 3300025284 Ga0209130_1001424 Ga0209130_100142411 267
266 3300025302 Ga0207426_1000102 Ga0207426_100010238 267
267 3300041997 Ga0439431_0004418 Ga0439431_0004418_38_856 267
268 3300046512 Ga0495610_0040783 Ga0495610_0040783_510_1313 267
269 iso_pu_bacteria 2844533157 2844535716 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

215

0.97

PF08659

KR

KR domain

24

147

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

258

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bt9-assembly3.cif.gz_C crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.9708 18 259
5tgd-assembly1.cif.gz_D crystal structure of folm alternative dihydrofolate reductase 1 from brucella suis in complex with nadp 0.9684 18 260
5bt9-assembly5.cif.gz_D crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.9649 18 260
5tgd-assembly1.cif.gz_B crystal structure of folm alternative dihydrofolate reductase 1 from brucella suis in complex with nadp 0.9648 19 260
5bt9-assembly5.cif.gz_B crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.9641 18 260
ID Description Score Start End Superfamily
5bt9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9641 18 260 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9371 18 251 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9358 15 253 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9356 15 254 3.40.50.720
2c7vC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.933 15 254 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2H0QYZ1-F1-model_v4 Short-chain dehydrogenase 0.9797 15 254
AF-A0A7V4E1S1-F1-model_v4 SDR family oxidoreductase 0.9673 17 254
AF-A0A2M8MWT1-F1-model_v4 Short chain dehydrogenase 0.9618 18 259 GO:0016491
AF-A0A2R7NZP1-F1-model_v4 Short chain dehydrogenase 0.9569 20 254
AF-A0A520VU29-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9548 17 254

Feature Viewer

pLDDT pTM Quality
90.56 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map