F375810

General Info

Members Datasets Scaffolds Average Seq Length
268 136 536 330

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0106235|Ga0501081_0106235_881_1966
Length 361
Sequence VDHLDLGGGTPPVAAHNRLAVFPGADQDKPMTRSRFLGTGLAVPDRVVTNDELSRLMDTTDEWIRSRTGIQERRWVAEGETGVEMGLRASERALEMAGLQPQDVDAIVYATSSPDHFAPGNGVFLQRLLGIPPIPALDVRAQCSGFIYALSVADAWIRTGQFRRVLVVGSEIQSTGLEVSTAGRHVAVIFADGAGAAVLGPADSGDGGILGFDLHSEGAHAEKLWVDSPGSMYHPRVSREQIDEGRQYLQMDGREVFRHAVVRMPESVRAVLSSSGEKLEDVSLLLAHQANLRIAEVMQKDLGLRDDQVYNNIMWYGNTTAATIPIALDECVRSGRLKRGDLVVLTAFGSGFMWGSAAVRW

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
76 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
77 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
114 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
115 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
120 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
121 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.81
Rhizosphere 86.19
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_0106235 3300049743 Unclassified 1990
2 Ga0070680_100271534 3300005336 Bacteria 1436
3 Ga0070668_100006699 3300005347 Bacteria 8537
4 Ga0070668_100130873 3300005347 Bacteria 2014
5 Ga0070674_100209523 3300005356 Bacteria 1510
6 Ga0070673_100195624 3300005364 Bacteria 1739
7 Ga0070711_100114212 3300005439 Bacteria 1987
8 Ga0070705_100036104 3300005440 Unclassified 2776
9 Ga0070705_100113060 3300005440 Bacteria 1739
10 Ga0070708_100119111 3300005445 Bacteria 2433
11 Ga0070708_100142557 3300005445 Bacteria 2223
12 Ga0070663_100142362 3300005455 Unclassified 1832
13 Ga0070662_100053809 3300005457 Bacteria 2915
14 Ga0070662_100110631 3300005457 Bacteria 2092
15 Ga0070707_100023588 3300005468 Bacteria 5819
16 Ga0070698_100088608 3300005471 Unclassified 3079
17 Ga0070698_100162241 3300005471 Bacteria 2179
18 Ga0070698_100188710 3300005471 Bacteria 1999
19 Ga0070698_100236058 3300005471 Bacteria 1762
20 Ga0070699_100001206 3300005518 Bacteria 23893
21 Ga0070699_100001220 3300005518 Bacteria 23718
22 Ga0070699_100009603 3300005518 Bacteria 8384
23 Ga0070679_100064246 3300005530 Bacteria 3658
24 Ga0070684_100263501 3300005535 Unclassified 1577
25 Ga0070697_100052681 3300005536 Bacteria 3307
26 Ga0070697_100139212 3300005536 Bacteria 2040
27 Ga0070695_100061814 3300005545 Bacteria 2431
28 Ga0070696_100005519 3300005546 Bacteria 8440
29 Ga0070696_100007816 3300005546 Bacteria 7140
30 Ga0070696_100041130 3300005546 Bacteria 3193
31 Ga0070696_100219432 3300005546 Bacteria 1426
32 Ga0070696_100243362 3300005546 Bacteria 1358
33 Ga0070693_100018751 3300005547 Bacteria 3618
34 Ga0070665_100313416 3300005548 Bacteria 1573
35 Ga0070704_100008053 3300005549 Bacteria 6295
36 Ga0070704_100201970 3300005549 Bacteria 1605
37 Ga0070664_100005293 3300005564 Bacteria 10351
38 Ga0070664_100288957 3300005564 Bacteria 1480
39 Ga0070702_100033666 3300005615 Unclassified 2819
40 Ga0068859_100095466 3300005617 Unclassified 3026
41 Ga0068864_100021600 3300005618 Bacteria 5390
42 Ga0068858_100238931 3300005842 Unclassified 1723
43 Ga0068862_100250136 3300005844 Bacteria 1615
44 Ga0081455_10118313 3300005937 Bacteria 2092
45 Ga0070717_10000147 3300006028 Bacteria 52381
46 Ga0070715_10049339 3300006163 Bacteria 1803
47 Ga0068871_100233759 3300006358 Unclassified 1596
48 Ga0075428_100005385 3300006844 Bacteria 14225
49 Ga0075428_100047910 3300006844 Bacteria 4693
50 Ga0075428_100084111 3300006844 Unclassified 3471
51 Ga0075428_100165159 3300006844 Bacteria 2402
52 Ga0075431_100104141 3300006847 Bacteria 2928
53 Ga0075431_100185066 3300006847 Bacteria 2136
54 Ga0075431_100336031 3300006847 Unclassified 1521
55 Ga0075433_10017106 3300006852 Bacteria 5997
56 Ga0075433_10069458 3300006852 Unclassified 3094
57 Ga0075433_10078873 3300006852 Bacteria 2902
58 Ga0075434_100003406 3300006871 Bacteria 14234
59 Ga0075434_100211826 3300006871 Bacteria 1958
60 Ga0075429_100041174 3300006880 Unclassified 4023
61 Ga0075429_100116507 3300006880 Bacteria 2335
62 Ga0068865_100073412 3300006881 Bacteria 2433
63 Ga0075436_100004751 3300006914 Bacteria 9325
64 Ga0097620_100095465 3300006931 Unclassified 3026
65 Ga0075435_100000422 3300007076 Bacteria 26136
66 Ga0075435_100311042 3300007076 Bacteria 1348
67 Ga0111539_10126076 3300009094 Bacteria 3000
68 Ga0114129_10001798 3300009147 Bacteria 29219
69 Ga0114129_10045657 3300009147 Bacteria 6158
70 Ga0114129_10267161 3300009147 Bacteria 2290
71 Ga0105248_10034905 3300009177 Bacteria 5628
72 Ga0105237_10105558 3300009545 Unclassified 2808
73 Ga0105239_10004128 3300010375 Bacteria 17443
74 Ga0105246_10092915 3300011119 Bacteria 2178
75 Ga0163163_10035971 3300014325 Bacteria 4807
76 Ga0207645_10231497 3300025907 Bacteria 1220
77 Ga0207684_10466052 3300025910 Bacteria 1084
78 Ga0207707_10004845 3300025912 Bacteria 11807
79 Ga0207663_10185727 3300025916 Bacteria 1488
80 Ga0207652_10016876 3300025921 Bacteria 5969
81 Ga0207646_10094701 3300025922 Unclassified 2674
82 Ga0207646_10264108 3300025922 Bacteria 1556
83 Ga0207646_10505951 3300025922 Bacteria 1088
84 Ga0207706_10105950 3300025933 Bacteria 2474
85 Ga0207706_10144444 3300025933 Bacteria 2093
86 Ga0207669_10114850 3300025937 Bacteria 1813
87 Ga0207691_10274199 3300025940 Bacteria 1452
88 Ga0207711_10057393 3300025941 Bacteria 3347
89 Ga0207668_10015429 3300025972 Bacteria 4746
90 Ga0207641_10168548 3300026088 Bacteria 1997
91 Ga0207648_10064804 3300026089 Bacteria 3185
92 Ga0307408_100036085 3300031548 Bacteria 3473
93 Ga0307408_100079688 3300031548 Bacteria 2444
94 Ga0307405_10008536 3300031731 Bacteria 5202
95 Ga0307413_10005488 3300031824 Bacteria 5667
96 Ga0307413_10008528 3300031824 Bacteria 4846
97 Ga0307413_10008963 3300031824 Bacteria 4758
98 Ga0307413_10034921 3300031824 Bacteria 2879
99 Ga0307413_10035325 3300031824 Bacteria 2866
100 Ga0307413_10102451 3300031824 Bacteria 1895
101 Ga0307413_10131061 3300031824 Bacteria 1716
102 Ga0307410_10002699 3300031852 Bacteria 8663
103 Ga0307410_10004381 3300031852 Bacteria 7290
104 Ga0307410_10017024 3300031852 Bacteria 4352
105 Ga0307410_10019277 3300031852 Bacteria 4145
106 Ga0307410_10028430 3300031852 Bacteria 3547
107 Ga0307406_10013935 3300031901 Bacteria 4616
108 Ga0307406_10014834 3300031901 Bacteria 4492
109 Ga0307406_10341462 3300031901 Bacteria 1166
110 Ga0307412_10053527 3300031911 Bacteria 2676
111 Ga0307412_10099313 3300031911 Bacteria 2055
112 Ga0307409_100002275 3300031995 Bacteria 9945
113 Ga0307409_100005965 3300031995 Bacteria 7096
114 Ga0307409_100058698 3300031995 Bacteria 2990
115 Ga0307409_100089031 3300031995 Bacteria 2522
116 Ga0307409_100322581 3300031995 Bacteria 1446
117 Ga0307409_100421567 3300031995 Unclassified 1280
118 Ga0307416_100000827 3300032002 Bacteria 16252
119 Ga0307416_100029696 3300032002 Bacteria 4089
120 Ga0307416_100034046 3300032002 Bacteria 3871
121 Ga0307416_100051234 3300032002 Bacteria 3296
122 Ga0307416_100091185 3300032002 Bacteria 2616
123 Ga0307416_100098266 3300032002 Bacteria 2539
124 Ga0307414_10024013 3300032004 Bacteria 3879
125 Ga0307414_10036297 3300032004 Bacteria 3290
126 Ga0307414_10058507 3300032004 Bacteria 2716
127 Ga0307414_10080792 3300032004 Bacteria 2378
128 Ga0307414_10262321 3300032004 Bacteria 1442
129 Ga0307414_10331725 3300032004 Bacteria 1299
130 Ga0307411_10005011 3300032005 Bacteria 6444
131 Ga0307411_10011431 3300032005 Bacteria 4792
132 Ga0307411_10018923 3300032005 Bacteria 3964
133 Ga0307411_10023091 3300032005 Bacteria 3676
134 Ga0307411_10032514 3300032005 Bacteria 3224
135 Ga0307411_10043225 3300032005 Unclassified 2882
136 Ga0307411_10072115 3300032005 Bacteria 2344
137 Ga0307411_10098355 3300032005 Bacteria 2062
138 Ga0307411_10216732 3300032005 Bacteria 1482
139 Ga0307415_100001107 3300032126 Bacteria 12564
140 Ga0307415_100029831 3300032126 Bacteria 3491
141 Ga0307415_100096081 3300032126 Bacteria 2159
142 Ga0307415_100119773 3300032126 Bacteria 1971
143 Ga0307415_100186103 3300032126 Bacteria 1634
144 Ga0316574_0117667 3300035398 Bacteria 1705
145 Ga0395900_0270699 3300037418 Bacteria 1693
146 Ga0395905_0000145 3300037471 Bacteria 116795
147 Ga0395905_0001580 3300037471 Bacteria 27185
148 Ga0395905_0007814 3300037471 Bacteria 10601
149 Ga0439455_0021537 3300042012 Bacteria 1538
150 Ga0439457_006471 3300042014 Bacteria 2869
151 Ga0439462_0020457 3300042015 Bacteria 1726
152 Ga0453683_0064651 3300044673 Bacteria 2287
153 Ga0495580_0056014 3300046472 Bacteria 2777
154 Ga0496100_0053240 3300048903 Bacteria 2635
155 Ga0496100_0090887 3300048903 Bacteria 2083
156 Ga0496102_0001968 3300048905 Bacteria 17728
157 Ga0496102_0019900 3300048905 Bacteria 5919
158 Ga0496102_0120271 3300048905 Bacteria 2453
159 Ga0496102_0234857 3300048905 Bacteria 1728
160 Ga0496102_0348355 3300048905 Bacteria 1395
161 Ga0496103_0003862 3300048906 Bacteria 9117
162 Ga0496103_0195088 3300048906 Bacteria 1302
163 Ga0496104_0016313 3300048907 Bacteria 6743
164 Ga0496104_0040542 3300048907 Bacteria 4365
165 Ga0496104_0142280 3300048907 Bacteria 2304
166 Ga0496105_0121032 3300048908 Bacteria 2158
167 Ga0496106_0034969 3300048909 Bacteria 3755
168 Ga0496106_0232322 3300048909 Bacteria 1473
169 Ga0496106_0388658 3300048909 Bacteria 1121
170 Ga0496107_0114550 3300048910 Bacteria 1984
171 Ga0496108_0000530 3300048911 Bacteria 29778
172 Ga0496108_0005507 3300048911 Bacteria 10243
173 Ga0496108_0022673 3300048911 Bacteria 5164
174 Ga0496109_0010673 3300048912 Bacteria 7858
175 Ga0496109_0027823 3300048912 Bacteria 5052
176 Ga0496109_0086595 3300048912 Bacteria 2893
177 Ga0496110_0012178 3300048913 Bacteria 7065
178 Ga0496110_0025473 3300048913 Bacteria 5055
179 Ga0496110_0041633 3300048913 Bacteria 4009
180 Ga0496110_0248067 3300048913 Bacteria 1620
181 Ga0496111_0002460 3300048914 Bacteria 11174
182 Ga0496111_0005655 3300048914 Bacteria 8050
183 Ga0496112_0000343 3300048915 Bacteria 30294
184 Ga0496112_0003784 3300048915 Bacteria 12638
185 Ga0496112_0039247 3300048915 Bacteria 4626
186 Ga0496112_0119428 3300048915 Bacteria 2606
187 Ga0496113_0000225 3300048916 Bacteria 26482
188 Ga0496113_0001395 3300048916 Bacteria 13437
189 Ga0496113_0194341 3300048916 Bacteria 1611
190 Ga0496115_0156467 3300048918 Bacteria 1883
191 Ga0501297_009939 3300049520 Bacteria 1071
192 Ga0501036_0088496 3300049572 Bacteria 2617
193 Ga0501036_0240544 3300049572 Bacteria 1518
194 Ga0501038_0326785 3300049574 Bacteria 1199
195 Ga0501039_0027263 3300049575 Bacteria 4392
196 Ga0501040_0019771 3300049576 Bacteria 4481
197 Ga0501042_0072850 3300049578 Bacteria 2458
198 Ga0501046_0019398 3300049580 Bacteria 5642
199 Ga0501048_0369340 3300049582 Bacteria 1024
200 Ga0501067_0064580 3300049583 Bacteria 2026
201 Ga0501068_0000674 3300049584 Bacteria 17465
202 Ga0501068_0001812 3300049584 Bacteria 11354
203 Ga0501069_0000791 3300049585 Bacteria 14879
204 Ga0501069_0012218 3300049585 Bacteria 4562
205 Ga0501070_0043907 3300049586 Bacteria 3719
206 Ga0501071_0026080 3300049587 Bacteria 4099
207 Ga0501071_0035775 3300049587 Bacteria 3538
208 Ga0501072_0002245 3300049588 Bacteria 14422
209 Ga0501073_0006597 3300049589 Bacteria 8638
210 Ga0501074_0001695 3300049590 Bacteria 15007
211 Ga0501074_0006415 3300049590 Bacteria 8497
212 Ga0501074_0091549 3300049590 Bacteria 2178
213 Ga0501074_0153170 3300049590 Bacteria 1648
214 Ga0501075_0012966 3300049591 Bacteria 5939
215 Ga0501076_0012647 3300049592 Bacteria 6317
216 Ga0501076_0023882 3300049592 Bacteria 4717
217 Ga0501076_0324952 3300049592 Bacteria 1262
218 Ga0501077_0000260 3300049593 Bacteria 31177
219 Ga0501077_0009246 3300049593 Bacteria 6119
220 Ga0501235_041740 3300049669 Bacteria 1050
221 Ga0501239_004133 3300049672 Bacteria 1411
222 Ga0501225_0003489 3300049705 Bacteria 4750
223 Ga0501079_0024801 3300049741 Bacteria 4601
224 Ga0501080_0038328 3300049742 Bacteria 4475
225 Ga0501080_0064420 3300049742 Bacteria 3409
226 Ga0501080_0068095 3300049742 Bacteria 3311
227 Ga0501080_0143528 3300049742 Bacteria 2207
228 Ga0501080_0526865 3300049742 Bacteria 1054
229 Ga0501081_0012620 3300049743 Bacteria 5555
230 Ga0501081_0029248 3300049743 Bacteria 3723
231 Ga0501083_0022980 3300049744 Bacteria 4328
232 Ga0501083_0100018 3300049744 Bacteria 1912
233 Ga0501262_001442 3300049759 Bacteria 2666
234 Ga0501268_010919 3300049765 Bacteria 1424
235 Ga0501270_001646 3300049767 Bacteria 2184
236 Ga0501045_0049482 3300049824 Bacteria 3064
237 Ga0501045_0112844 3300049824 Bacteria 2016
238 Ga0501204_006990 3300049850 Bacteria 1263
239 nmdc:mga05p37_11492_c1 3300050507 Bacteria 10547
240 nmdc:mga05p37_139263_c1 3300050507 Bacteria 2973
241 nmdc:mga05p37_668478_c1 3300050507 Bacteria 1160
242 nmdc:mga09592_338866_c1 3300050508 Unclassified 1302
243 nmdc:mga0qj67_9099_c1 3300050509 Bacteria 7370
244 nmdc:mga06r32_5498_c2 3300050510 Bacteria 7428
245 nmdc:mga06r32_90179_c1 3300050510 Bacteria 2994
246 nmdc:mga08y16_449375_c1 3300050511 Bacteria 1314
247 nmdc:mga0n895_2011_c1 3300050512 Bacteria 15626
248 nmdc:mga0n895_64645_c1 3300050512 Bacteria 3619
249 nmdc:mga0rr50_101639_c1 3300050513 Unclassified 2260
250 nmdc:mga0rr50_17_c1 3300050513 Bacteria 39997
251 nmdc:mga0rr50_295657_c1 3300050513 Bacteria 1354
252 nmdc:mga0rr50_79134_c1 3300050513 Unclassified 2531
253 nmdc:mga0rr50_96648_c1 3300050513 Bacteria 2311
254 nmdc:mga08x19_123673_c1 3300050514 Bacteria 1736
255 nmdc:mga08x19_703_c1 3300050514 Bacteria 21415
256 nmdc:mga0a205_127274_c1 3300050515 Unclassified 2447
257 nmdc:mga0a205_175079_c1 3300050515 Bacteria 2041
258 nmdc:mga0a205_29181_c1 3300050515 Bacteria 5280
259 Ga0495655_0000479 3300053083 Bacteria 6691
260 Ga0501084_0001693 3300054114 Bacteria 17520
261 Ga0501084_0019868 3300054114 Bacteria 5598
262 Ga0501084_0022947 3300054114 Bacteria 5208
263 Ga0501084_0261377 3300054114 Bacteria 1461
264 Ga0501082_0184997 3300060353 Bacteria 1812
265 Ga0501082_0270497 3300060353 Bacteria 1479
266 Ga0501082_0394031 3300060353 Bacteria 1208
267 Ga0530510_0198335 3300061734 Bacteria 1490
268 Ga0530510_0380944 3300061734 Bacteria 1062
269 Ga0501081_0106235
270 Ga0070680_100271534
271 Ga0070668_100006699
272 Ga0070668_100130873
273 Ga0070674_100209523
274 Ga0070673_100195624
275 Ga0070711_100114212
276 Ga0070705_100036104
277 Ga0070705_100113060
278 Ga0070708_100119111
279 Ga0070708_100142557
280 Ga0070663_100142362
281 Ga0070662_100053809
282 Ga0070662_100110631
283 Ga0070707_100023588
284 Ga0070698_100088608
285 Ga0070698_100162241
286 Ga0070698_100188710
287 Ga0070698_100236058
288 Ga0070699_100001206
289 Ga0070699_100001220
290 Ga0070699_100009603
291 Ga0070679_100064246
292 Ga0070684_100263501
293 Ga0070697_100052681
294 Ga0070697_100139212
295 Ga0070695_100061814
296 Ga0070696_100005519
297 Ga0070696_100007816
298 Ga0070696_100041130
299 Ga0070696_100219432
300 Ga0070696_100243362
301 Ga0070693_100018751
302 Ga0070665_100313416
303 Ga0070704_100008053
304 Ga0070704_100201970
305 Ga0070664_100005293
306 Ga0070664_100288957
307 Ga0070702_100033666
308 Ga0068859_100095466
309 Ga0068864_100021600
310 Ga0068858_100238931
311 Ga0068862_100250136
312 Ga0081455_10118313
313 Ga0070717_10000147
314 Ga0070715_10049339
315 Ga0068871_100233759
316 Ga0075428_100005385
317 Ga0075428_100047910
318 Ga0075428_100084111
319 Ga0075428_100165159
320 Ga0075431_100104141
321 Ga0075431_100185066
322 Ga0075431_100336031
323 Ga0075433_10017106
324 Ga0075433_10069458
325 Ga0075433_10078873
326 Ga0075434_100003406
327 Ga0075434_100211826
328 Ga0075429_100041174
329 Ga0075429_100116507
330 Ga0068865_100073412
331 Ga0075436_100004751
332 Ga0097620_100095465
333 Ga0075435_100000422
334 Ga0075435_100311042
335 Ga0111539_10126076
336 Ga0114129_10001798
337 Ga0114129_10045657
338 Ga0114129_10267161
339 Ga0105248_10034905
340 Ga0105237_10105558
341 Ga0105239_10004128
342 Ga0105246_10092915
343 Ga0163163_10035971
344 Ga0207645_10231497
345 Ga0207684_10466052
346 Ga0207707_10004845
347 Ga0207663_10185727
348 Ga0207652_10016876
349 Ga0207646_10094701
350 Ga0207646_10264108
351 Ga0207646_10505951
352 Ga0207706_10105950
353 Ga0207706_10144444
354 Ga0207669_10114850
355 Ga0207691_10274199
356 Ga0207711_10057393
357 Ga0207668_10015429
358 Ga0207641_10168548
359 Ga0207648_10064804
360 Ga0307408_100036085
361 Ga0307408_100079688
362 Ga0307405_10008536
363 Ga0307413_10005488
364 Ga0307413_10008528
365 Ga0307413_10008963
366 Ga0307413_10034921
367 Ga0307413_10035325
368 Ga0307413_10102451
369 Ga0307413_10131061
370 Ga0307410_10002699
371 Ga0307410_10004381
372 Ga0307410_10017024
373 Ga0307410_10019277
374 Ga0307410_10028430
375 Ga0307406_10013935
376 Ga0307406_10014834
377 Ga0307406_10341462
378 Ga0307412_10053527
379 Ga0307412_10099313
380 Ga0307409_100002275
381 Ga0307409_100005965
382 Ga0307409_100058698
383 Ga0307409_100089031
384 Ga0307409_100322581
385 Ga0307409_100421567
386 Ga0307416_100000827
387 Ga0307416_100029696
388 Ga0307416_100034046
389 Ga0307416_100051234
390 Ga0307416_100091185
391 Ga0307416_100098266
392 Ga0307414_10024013
393 Ga0307414_10036297
394 Ga0307414_10058507
395 Ga0307414_10080792
396 Ga0307414_10262321
397 Ga0307414_10331725
398 Ga0307411_10005011
399 Ga0307411_10011431
400 Ga0307411_10018923
401 Ga0307411_10023091
402 Ga0307411_10032514
403 Ga0307411_10043225
404 Ga0307411_10072115
405 Ga0307411_10098355
406 Ga0307411_10216732
407 Ga0307415_100001107
408 Ga0307415_100029831
409 Ga0307415_100096081
410 Ga0307415_100119773
411 Ga0307415_100186103
412 Ga0316574_0117667
413 Ga0395900_0270699
414 Ga0395905_0000145
415 Ga0395905_0001580
416 Ga0395905_0007814
417 Ga0439455_0021537
418 Ga0439457_006471
419 Ga0439462_0020457
420 Ga0453683_0064651
421 Ga0495580_0056014
422 Ga0496100_0053240
423 Ga0496100_0090887
424 Ga0496102_0001968
425 Ga0496102_0019900
426 Ga0496102_0120271
427 Ga0496102_0234857
428 Ga0496102_0348355
429 Ga0496103_0003862
430 Ga0496103_0195088
431 Ga0496104_0016313
432 Ga0496104_0040542
433 Ga0496104_0142280
434 Ga0496105_0121032
435 Ga0496106_0034969
436 Ga0496106_0232322
437 Ga0496106_0388658
438 Ga0496107_0114550
439 Ga0496108_0000530
440 Ga0496108_0005507
441 Ga0496108_0022673
442 Ga0496109_0010673
443 Ga0496109_0027823
444 Ga0496109_0086595
445 Ga0496110_0012178
446 Ga0496110_0025473
447 Ga0496110_0041633
448 Ga0496110_0248067
449 Ga0496111_0002460
450 Ga0496111_0005655
451 Ga0496112_0000343
452 Ga0496112_0003784
453 Ga0496112_0039247
454 Ga0496112_0119428
455 Ga0496113_0000225
456 Ga0496113_0001395
457 Ga0496113_0194341
458 Ga0496115_0156467
459 Ga0501297_009939
460 Ga0501036_0088496
461 Ga0501036_0240544
462 Ga0501038_0326785
463 Ga0501039_0027263
464 Ga0501040_0019771
465 Ga0501042_0072850
466 Ga0501046_0019398
467 Ga0501048_0369340
468 Ga0501067_0064580
469 Ga0501068_0000674
470 Ga0501068_0001812
471 Ga0501069_0000791
472 Ga0501069_0012218
473 Ga0501070_0043907
474 Ga0501071_0026080
475 Ga0501071_0035775
476 Ga0501072_0002245
477 Ga0501073_0006597
478 Ga0501074_0001695
479 Ga0501074_0006415
480 Ga0501074_0091549
481 Ga0501074_0153170
482 Ga0501075_0012966
483 Ga0501076_0012647
484 Ga0501076_0023882
485 Ga0501076_0324952
486 Ga0501077_0000260
487 Ga0501077_0009246
488 Ga0501235_041740
489 Ga0501239_004133
490 Ga0501225_0003489
491 Ga0501079_0024801
492 Ga0501080_0038328
493 Ga0501080_0064420
494 Ga0501080_0068095
495 Ga0501080_0143528
496 Ga0501080_0526865
497 Ga0501081_0012620
498 Ga0501081_0029248
499 Ga0501083_0022980
500 Ga0501083_0100018
501 Ga0501262_001442
502 Ga0501268_010919
503 Ga0501270_001646
504 Ga0501045_0049482
505 Ga0501045_0112844
506 Ga0501204_006990
507 nmdc:mga05p37_11492_c1
508 nmdc:mga05p37_139263_c1
509 nmdc:mga05p37_668478_c1
510 nmdc:mga09592_338866_c1
511 nmdc:mga0qj67_9099_c1
512 nmdc:mga06r32_5498_c2
513 nmdc:mga06r32_90179_c1
514 nmdc:mga08y16_449375_c1
515 nmdc:mga0n895_2011_c1
516 nmdc:mga0n895_64645_c1
517 nmdc:mga0rr50_101639_c1
518 nmdc:mga0rr50_17_c1
519 nmdc:mga0rr50_295657_c1
520 nmdc:mga0rr50_79134_c1
521 nmdc:mga0rr50_96648_c1
522 nmdc:mga08x19_123673_c1
523 nmdc:mga08x19_703_c1
524 nmdc:mga0a205_127274_c1
525 nmdc:mga0a205_175079_c1
526 nmdc:mga0a205_29181_c1
527 Ga0495655_0000479
528 Ga0501084_0001693
529 Ga0501084_0019868
530 Ga0501084_0022947
531 Ga0501084_0261377
532 Ga0501082_0184997
533 Ga0501082_0270497
534 Ga0501082_0394031
535 Ga0530510_0198335
536 Ga0530510_0380944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

272

361

0.97

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

137

218

0.96

PF00195

Chal_sti_synt_N

Chalcone and stilbene synthases, N-terminal domain

47

203

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9787 4 330
6x7r-assembly1.cif.gz_A e. coli beta-ketoacyl-[acyl carrier protein] synthase iii (fabh) in complex with oxa(dethia)-coenzyme a 0.976 1 330
1zow-assembly1.cif.gz_A crystal structure of s. aureus fabh, beta-ketoacyl carrier protein synthase iii 0.9757 3 330
8d1u-assembly1.cif.gz_A e. coli beta-ketoacyl-[acyl carrier protein] synthase iii (fabh) with an acetylated cysteine and in complex with oxa(dethia)-coenzyme a 0.975 1 330
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9732 3 330
ID Description Score Start End Superfamily
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9739 3 330 3.40.47.10
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9735 3 173 3.40.47.10
1zowB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9714 3 175 3.40.47.10
4x9oB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9706 1 330 3.40.47.10
af_P0A6R0_1_317_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9664 3 330 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A354BKT2-F1-model_v4 3-oxoacyl-ACP synthase 0.9944 229 330 GO:0016746
AF-A0A524HPL9-F1-model_v4 Beta-ketoacyl-ACP synthase 3 (EC 2.3.1.180) 0.9917 68 330 GO:0004315
GO:0006633
GO:0033818
AF-A0A847X4G8-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III C-terminal domain-containing protein 0.9891 220 329 GO:0016746
AF-A0A3C0EH07-F1-model_v4 3-oxoacyl-ACP synthase 0.9888 236 330 GO:0016020
GO:0016746
GO:0044550
AF-A0A7X7UH04-F1-model_v4 Beta-ketoacyl-ACP synthase 3 (EC 2.3.1.180) 0.9882 1 330 GO:0004315
GO:0005737
GO:0006633
GO:0033818
GO:0044550

Map