F375783

General Info

Members Datasets Scaffolds Average Seq Length
268 194 536 173

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0000010|Ga0496126_0000010_181956_182600
Length 214
Sequence MRGEDGEWMVTFSHLKVRHVFELFFRWVMRMMTIGHSTLELDSFLRALRENGCTTLVDVRRFPGSRRYPQFGQERLFASLEAAKIRAVWREGLGGRRAPLKDSVNTGWKNETFRGYADYMQTAQFAGEIDWLMMLADFDSAVVMCAEAVPWRCHRSLIGDAVLARGGVVEDIFVATGGGSSRRPHAMTEFARVEGTKVWYPGPSREASLFALSD

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
105 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
109 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
112 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
115 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.34
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 5.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0000010 3300048929 Bacteria 744888
2 Ga0070658_10001210 3300005327 Bacteria 22122
3 Ga0070658_10035100 3300005327 Bacteria 4037
4 Ga0070658_10408344 3300005327 Bacteria 1167
5 Ga0070676_10015362 3300005328 Bacteria 4223
6 Ga0070683_100133536 3300005329 Unclassified 2349
7 Ga0070682_100047029 3300005337 Unclassified 2680
8 Ga0070682_100400443 3300005337 Bacteria 1038
9 Ga0068868_100194346 3300005338 Bacteria 1688
10 Ga0068868_100642914 3300005338 Bacteria 944
11 Ga0070660_100020873 3300005339 Bacteria 4821
12 Ga0070660_100073033 3300005339 Bacteria 2682
13 Ga0070691_10172858 3300005341 Bacteria 1120
14 Ga0070692_10413481 3300005345 Bacteria 854
15 Ga0070668_100593934 3300005347 Bacteria 968
16 Ga0070659_100008384 3300005366 Bacteria 7550
17 Ga0070659_100412803 3300005366 Bacteria 1141
18 Ga0070703_10276105 3300005406 Bacteria 691
19 Ga0070709_10040419 3300005434 Bacteria 2867
20 Ga0070709_10068014 3300005434 Bacteria 2289
21 Ga0070714_100597751 3300005435 Bacteria 1059
22 Ga0070713_100017482 3300005436 Bacteria 5424
23 Ga0070713_100759396 3300005436 Bacteria 928
24 Ga0070710_10015159 3300005437 Bacteria 3895
25 Ga0070710_10500866 3300005437 Bacteria 831
26 Ga0070711_100079922 3300005439 Bacteria 2327
27 Ga0070705_100006698 3300005440 Bacteria 5664
28 Ga0070694_100012245 3300005444 Bacteria 5329
29 Ga0070694_100074742 3300005444 Bacteria 2343
30 Ga0070708_100108542 3300005445 Bacteria 2549
31 Ga0070663_100011858 3300005455 Bacteria 5493
32 Ga0070663_100150897 3300005455 Bacteria 1782
33 Ga0070678_100335317 3300005456 Bacteria 1296
34 Ga0070662_100462895 3300005457 Bacteria 1054
35 Ga0070681_10208924 3300005458 Bacteria 1869
36 Ga0070706_100003644 3300005467 Bacteria 15080
37 Ga0070707_100094507 3300005468 Bacteria 2894
38 Ga0070707_100647953 3300005468 Bacteria 1019
39 Ga0070698_100001742 3300005471 Bacteria 24266
40 Ga0070698_100276553 3300005471 Bacteria 1611
41 Ga0070699_100027949 3300005518 Bacteria 4864
42 Ga0070699_100078683 3300005518 Bacteria 2872
43 Ga0070699_100145010 3300005518 Bacteria 2098
44 Ga0070679_100245201 3300005530 Bacteria 1748
45 Ga0070679_101018755 3300005530 Bacteria 772
46 Ga0070684_100089972 3300005535 Unclassified 2728
47 Ga0070697_100156183 3300005536 Bacteria 1926
48 Ga0068853_100000613 3300005539 Bacteria 24527
49 Ga0068853_100720989 3300005539 Bacteria 952
50 Ga0070686_100206061 3300005544 Bacteria 1413
51 Ga0070695_100153500 3300005545 Bacteria 1609
52 Ga0070696_100009563 3300005546 Bacteria 6488
53 Ga0070696_100182671 3300005546 Bacteria 1557
54 Ga0070665_100000090 3300005548 Bacteria 175078
55 Ga0070665_100335823 3300005548 Bacteria 1516
56 Ga0070704_100793583 3300005549 Bacteria 846
57 Ga0068855_100143689 3300005563 Unclassified 2717
58 Ga0068855_100151226 3300005563 Bacteria 2639
59 Ga0068854_100005931 3300005578 Bacteria 7740
60 Ga0068854_100501310 3300005578 Unclassified 1022
61 Ga0068856_100299487 3300005614 Bacteria 1625
62 Ga0068866_10171556 3300005718 Bacteria 1274
63 Ga0068861_100132213 3300005719 Bacteria 2026
64 Ga0068851_10012467 3300005834 Bacteria 4009
65 Ga0068862_100173313 3300005844 Bacteria 1932
66 Ga0081455_10005539 3300005937 Bacteria 13828
67 Ga0081538_10020247 3300005981 Bacteria 4908
68 Ga0081538_10176088 3300005981 Unclassified 924
69 Ga0070716_100216624 3300006173 Bacteria 1283
70 Ga0070712_100001495 3300006175 Bacteria 14279
71 Ga0068871_100887566 3300006358 Bacteria 826
72 Ga0075431_100021161 3300006847 Bacteria 6647
73 Ga0075433_10018214 3300006852 Bacteria 5832
74 Ga0075433_10107450 3300006852 Bacteria 2474
75 Ga0075433_10546578 3300006852 Bacteria 1018
76 Ga0075434_100088968 3300006871 Unclassified 3090
77 Ga0075434_100091142 3300006871 Bacteria 3050
78 Ga0075434_100281265 3300006871 Bacteria 1683
79 Ga0075434_100639568 3300006871 Bacteria 1082
80 Ga0075436_100010560 3300006914 Bacteria 6334
81 Ga0075436_100011179 3300006914 Bacteria 6152
82 Ga0075436_100382087 3300006914 Bacteria 1018
83 Ga0075435_100014881 3300007076 Bacteria 5833
84 Ga0075435_100378965 3300007076 Bacteria 1215
85 Ga0075435_100492722 3300007076 Bacteria 1059
86 Ga0075435_100644520 3300007076 Bacteria 919
87 Ga0099795_10133287 3300007788 Bacteria 1004
88 Ga0105240_10060782 3300009093 Bacteria 4710
89 Ga0105240_11041646 3300009093 Bacteria 873
90 Ga0111539_10089930 3300009094 Bacteria 3608
91 Ga0105245_10159340 3300009098 Bacteria 2140
92 Ga0114129_10090337 3300009147 Bacteria 4246
93 Ga0114129_10368408 3300009147 Bacteria 1899
94 Ga0114129_11259331 3300009147 Bacteria 918
95 Ga0105243_10427378 3300009148 Bacteria 1237
96 Ga0105241_10264022 3300009174 Bacteria 1464
97 Ga0105242_11374737 3300009176 Bacteria 732
98 Ga0105237_10444673 3300009545 Unclassified 1302
99 Ga0099796_10188149 3300010159 Bacteria 832
100 Ga0105239_10194563 3300010375 Bacteria 2271
101 Ga0157370_10019152 3300013104 Bacteria 6880
102 Ga0157370_10219866 3300013104 Bacteria 1759
103 Ga0157370_11099022 3300013104 Bacteria 718
104 Ga0157369_10573659 3300013105 Bacteria 1165
105 Ga0157369_10663174 3300013105 Unclassified 1075
106 Ga0157369_10826876 3300013105 Bacteria 951
107 Ga0157378_11489852 3300013297 Unclassified 721
108 Ga0163162_10130687 3300013306 Bacteria 2619
109 Ga0182008_10065206 3300014497 Bacteria 1792
110 Ga0182008_10503232 3300014497 Unclassified 666
111 Ga0157377_10001678 3300014745 Bacteria 9655
112 Ga0163161_10362382 3300017792 Bacteria 1155
113 Ga0207656_10174468 3300025321 Bacteria 1029
114 Ga0207688_10024243 3300025901 Bacteria 3326
115 Ga0207647_10242624 3300025904 Bacteria 1034
116 Ga0207685_10062254 3300025905 Bacteria 1482
117 Ga0207699_10058691 3300025906 Bacteria 2303
118 Ga0207705_10170784 3300025909 Bacteria 1637
119 Ga0207684_10035552 3300025910 Bacteria 4230
120 Ga0207684_10123300 3300025910 Bacteria 2223
121 Ga0207707_10213465 3300025912 Bacteria 1681
122 Ga0207695_10022938 3300025913 Bacteria 7069
123 Ga0207693_10005427 3300025915 Bacteria 10639
124 Ga0207693_10008077 3300025915 Bacteria 8630
125 Ga0207657_10032744 3300025919 Bacteria 4692
126 Ga0207657_10316879 3300025919 Bacteria 1234
127 Ga0207646_10503615 3300025922 Bacteria 1091
128 Ga0207681_10679961 3300025923 Bacteria 855
129 Ga0207687_10708520 3300025927 Bacteria 855
130 Ga0207700_10257267 3300025928 Bacteria 1493
131 Ga0207690_10604665 3300025932 Bacteria 895
132 Ga0207706_10289703 3300025933 Bacteria 1427
133 Ga0207686_10097885 3300025934 Bacteria 1952
134 Ga0207665_10003968 3300025939 Bacteria 9889
135 Ga0207667_10090800 3300025949 Bacteria 3156
136 Ga0207667_10134562 3300025949 Bacteria 2545
137 Ga0207667_10136103 3300025949 Bacteria 2530
138 Ga0207668_10068817 3300025972 Bacteria 2519
139 Ga0207640_10000502 3300025981 Bacteria 23656
140 Ga0207640_10027309 3300025981 Bacteria 3476
141 Ga0207639_10000082 3300026041 Bacteria 82368
142 Ga0207678_10002981 3300026067 Bacteria 15317
143 Ga0207708_10899781 3300026075 Bacteria 766
144 Ga0207676_10431082 3300026095 Bacteria 1239
145 Ga0207675_100067163 3300026118 Bacteria 3351
146 Ga0207675_102064757 3300026118 Unclassified 587
147 Ga0207683_10017785 3300026121 Bacteria 6063
148 Ga0207428_10161297 3300027907 Bacteria 1702
149 Ga0268266_10259258 3300028379 Bacteria 1611
150 Ga0307416_100777612 3300032002 Bacteria 1052
151 Ga0373930_0002829 3300034816 Bacteria 2718
152 Ga0373948_0000699 3300034817 Bacteria 4360
153 Ga0373958_0000792 3300034819 Bacteria 4051
154 Ga0373959_0031090 3300034820 Bacteria 1078
155 Ga0373929_0050380 3300035085 Bacteria 950
156 Ga0373951_0003796 3300035091 Bacteria 3639
157 Ga0373932_0001580 3300035112 Bacteria 6284
158 Ga0373939_0001924 3300035114 Bacteria 4964
159 Ga0373941_0013319 3300035115 Bacteria 2171
160 Ga0373960_0035691 3300035121 Bacteria 1412
161 Ga0373961_0029317 3300035241 Bacteria 1523
162 Ga0373962_0001780 3300035242 Bacteria 5130
163 Ga0373931_0020646 3300035691 Bacteria 3297
164 Ga0395900_0013811 3300037418 Bacteria 8242
165 Ga0395900_0543420 3300037418 Bacteria 1107
166 Ga0395898_0002980 3300037466 Bacteria 19235
167 Ga0395898_0235319 3300037466 Unclassified 1747
168 Ga0395905_0022196 3300037471 Bacteria 6005
169 Ga0395901_0002370 3300038443 Bacteria 19167
170 Ga0395901_0101385 3300038443 Bacteria 3021
171 Ga0395901_0127952 3300038443 Bacteria 2669
172 Ga0395901_0195187 3300038443 Unclassified 2123
173 Ga0395901_1452570 3300038443 Bacteria 643
174 Ga0439436_0032766 3300041404 Bacteria 1506
175 Ga0439433_0001766 3300041999 Bacteria 4487
176 Ga0439445_0057040 3300042004 Unclassified 1063
177 Ga0439446_0004319 3300042156 Bacteria 3598
178 Ga0439458_0011971 3300042157 Bacteria 1943
179 Ga0466966_0224219 3300044684 Bacteria 1134
180 Ga0466961_0124198 3300044693 Bacteria 1620
181 Ga0466963_0162750 3300044694 Bacteria 1553
182 Ga0466963_0531961 3300044694 Bacteria 830
183 Ga0466964_0195158 3300044706 Bacteria 968
184 Ga0466964_0522491 3300044706 Bacteria 640
185 Ga0466957_0015183 3300044842 Bacteria 4496
186 Ga0466967_0028405 3300045976 Bacteria 4669
187 Ga0466967_0186943 3300045976 Bacteria 1956
188 Ga0495580_0036944 3300046472 Bacteria 3507
189 Ga0495585_0014137 3300046492 Bacteria 4659
190 Ga0495583_0024570 3300046506 Bacteria 3025
191 Ga0495606_0231482 3300046507 Bacteria 1035
192 Ga0495630_0024171 3300046517 Bacteria 4494
193 Ga0495644_0000028 3300046523 Bacteria 69977
194 Ga0495663_0239723 3300046525 Bacteria 641
195 Ga0495645_0300848 3300046543 Bacteria 1048
196 Ga0495668_0452241 3300046616 Bacteria 707
197 Ga0495611_0060277 3300046648 Bacteria 1724
198 Ga0495625_0021750 3300046660 Bacteria 4930
199 Ga0495669_0029764 3300046684 Bacteria 2395
200 Ga0495670_0103009 3300046691 Bacteria 1471
201 Ga0495636_0139571 3300047318 Bacteria 1082
202 Ga0495677_0019150 3300047445 Bacteria 2483
203 Ga0496100_0196521 3300048903 Bacteria 1467
204 Ga0496101_0046959 3300048904 Bacteria 3098
205 Ga0496102_0206595 3300048905 Bacteria 1851
206 Ga0496103_0047466 3300048906 Bacteria 2654
207 Ga0496103_0079831 3300048906 Bacteria 2056
208 Ga0496104_0007928 3300048907 Bacteria 9418
209 Ga0496104_1351280 3300048907 Unclassified 616
210 Ga0496106_0027907 3300048909 Bacteria 4202
211 Ga0496106_0050234 3300048909 Bacteria 3143
212 Ga0496107_0021004 3300048910 Bacteria 4614
213 Ga0496107_0034682 3300048910 Bacteria 3615
214 Ga0496108_0018794 3300048911 Bacteria 5664
215 Ga0496109_0453218 3300048912 Bacteria 1211
216 Ga0496110_0032486 3300048913 Bacteria 4508
217 Ga0496112_0475945 3300048915 Bacteria 1186
218 Ga0496113_0355359 3300048916 Bacteria 1175
219 Ga0496115_0007070 3300048918 Bacteria 8243
220 Ga0501031_0010603 3300049568 Bacteria 6000
221 Ga0501031_0033284 3300049568 Bacteria 3361
222 Ga0501032_0003065 3300049569 Bacteria 12927
223 Ga0501036_0001253 3300049572 Bacteria 19454
224 Ga0501036_0032981 3300049572 Bacteria 4378
225 Ga0501037_0016730 3300049573 Bacteria 5396
226 Ga0501038_0031779 3300049574 Bacteria 4663
227 Ga0501039_0008331 3300049575 Bacteria 7899
228 Ga0501039_0144555 3300049575 Bacteria 1869
229 Ga0501040_0008212 3300049576 Bacteria 6788
230 Ga0501040_0053353 3300049576 Bacteria 2769
231 Ga0501041_0006471 3300049577 Bacteria 6859
232 Ga0501043_0139387 3300049579 Bacteria 1900
233 Ga0501043_0435250 3300049579 Bacteria 987
234 Ga0501046_0000076 3300049580 Bacteria 103321
235 Ga0501046_0023633 3300049580 Bacteria 5052
236 Ga0501047_0000781 3300049581 Bacteria 33324
237 Ga0501067_0055144 3300049583 Bacteria 2202
238 Ga0501070_0058859 3300049586 Bacteria 3185
239 Ga0501071_0011851 3300049587 Bacteria 5886
240 Ga0501072_0007576 3300049588 Bacteria 8236
241 Ga0501073_0001348 3300049589 Bacteria 18090
242 Ga0501079_0021489 3300049741 Bacteria 4936
243 Ga0501080_0029873 3300049742 Bacteria 5073
244 Ga0501081_0032737 3300049743 Bacteria 3528
245 Ga0501083_0122213 3300049744 Bacteria 1708
246 Ga0501035_0005681 3300049822 Bacteria 11774
247 Ga0501035_0068964 3300049822 Bacteria 3135
248 Ga0501045_0002308 3300049824 Bacteria 12932
249 nmdc:mga05p37_170313_c1 3300050507 Bacteria 2656
250 nmdc:mga05p37_71090_c1 3300050507 Bacteria 4281
251 nmdc:mga05p37_80977_c1 3300050507 Bacteria 2300
252 nmdc:mga06r32_60421_c1 3300050510 Bacteria 3647
253 nmdc:mga08y16_17623_c1 3300050511 Bacteria 7522
254 nmdc:mga0n895_1081631_c1 3300050512 Bacteria 780
255 nmdc:mga0n895_147699_c1 3300050512 Bacteria 2381
256 nmdc:mga0rr50_109320_c1 3300050513 Bacteria 2185
257 nmdc:mga0rr50_260886_c1 3300050513 Bacteria 1442
258 nmdc:mga0rr50_44882_c1 3300050513 Bacteria 3245
259 nmdc:mga08x19_203218_c1 3300050514 Bacteria 1359
260 nmdc:mga08x19_295515_c1 3300050514 Bacteria 1124
261 nmdc:mga0a205_298743_c1 3300050515 Bacteria 1484
262 nmdc:mga0a205_731388_c1 3300050515 Bacteria 839
263 Ga0590071_045913 3300059421 Bacteria 1055
264 Ga0590075_012872 3300059424 Bacteria 2034
265 Ga0590077_096267 3300059426 Bacteria 690
266 Ga0501082_0014417 3300060353 Bacteria 6802
267 Ga0466962_0002955 3300061719 Bacteria 8111
268 Ga0530510_0004494 3300061734 Bacteria 9652
269 Ga0496126_0000010
270 Ga0070658_10001210
271 Ga0070658_10035100
272 Ga0070658_10408344
273 Ga0070676_10015362
274 Ga0070683_100133536
275 Ga0070682_100047029
276 Ga0070682_100400443
277 Ga0068868_100194346
278 Ga0068868_100642914
279 Ga0070660_100020873
280 Ga0070660_100073033
281 Ga0070691_10172858
282 Ga0070692_10413481
283 Ga0070668_100593934
284 Ga0070659_100008384
285 Ga0070659_100412803
286 Ga0070703_10276105
287 Ga0070709_10040419
288 Ga0070709_10068014
289 Ga0070714_100597751
290 Ga0070713_100017482
291 Ga0070713_100759396
292 Ga0070710_10015159
293 Ga0070710_10500866
294 Ga0070711_100079922
295 Ga0070705_100006698
296 Ga0070694_100012245
297 Ga0070694_100074742
298 Ga0070708_100108542
299 Ga0070663_100011858
300 Ga0070663_100150897
301 Ga0070678_100335317
302 Ga0070662_100462895
303 Ga0070681_10208924
304 Ga0070706_100003644
305 Ga0070707_100094507
306 Ga0070707_100647953
307 Ga0070698_100001742
308 Ga0070698_100276553
309 Ga0070699_100027949
310 Ga0070699_100078683
311 Ga0070699_100145010
312 Ga0070679_100245201
313 Ga0070679_101018755
314 Ga0070684_100089972
315 Ga0070697_100156183
316 Ga0068853_100000613
317 Ga0068853_100720989
318 Ga0070686_100206061
319 Ga0070695_100153500
320 Ga0070696_100009563
321 Ga0070696_100182671
322 Ga0070665_100000090
323 Ga0070665_100335823
324 Ga0070704_100793583
325 Ga0068855_100143689
326 Ga0068855_100151226
327 Ga0068854_100005931
328 Ga0068854_100501310
329 Ga0068856_100299487
330 Ga0068866_10171556
331 Ga0068861_100132213
332 Ga0068851_10012467
333 Ga0068862_100173313
334 Ga0081455_10005539
335 Ga0081538_10020247
336 Ga0081538_10176088
337 Ga0070716_100216624
338 Ga0070712_100001495
339 Ga0068871_100887566
340 Ga0075431_100021161
341 Ga0075433_10018214
342 Ga0075433_10107450
343 Ga0075433_10546578
344 Ga0075434_100088968
345 Ga0075434_100091142
346 Ga0075434_100281265
347 Ga0075434_100639568
348 Ga0075436_100010560
349 Ga0075436_100011179
350 Ga0075436_100382087
351 Ga0075435_100014881
352 Ga0075435_100378965
353 Ga0075435_100492722
354 Ga0075435_100644520
355 Ga0099795_10133287
356 Ga0105240_10060782
357 Ga0105240_11041646
358 Ga0111539_10089930
359 Ga0105245_10159340
360 Ga0114129_10090337
361 Ga0114129_10368408
362 Ga0114129_11259331
363 Ga0105243_10427378
364 Ga0105241_10264022
365 Ga0105242_11374737
366 Ga0105237_10444673
367 Ga0099796_10188149
368 Ga0105239_10194563
369 Ga0157370_10019152
370 Ga0157370_10219866
371 Ga0157370_11099022
372 Ga0157369_10573659
373 Ga0157369_10663174
374 Ga0157369_10826876
375 Ga0157378_11489852
376 Ga0163162_10130687
377 Ga0182008_10065206
378 Ga0182008_10503232
379 Ga0157377_10001678
380 Ga0163161_10362382
381 Ga0207656_10174468
382 Ga0207688_10024243
383 Ga0207647_10242624
384 Ga0207685_10062254
385 Ga0207699_10058691
386 Ga0207705_10170784
387 Ga0207684_10035552
388 Ga0207684_10123300
389 Ga0207707_10213465
390 Ga0207695_10022938
391 Ga0207693_10005427
392 Ga0207693_10008077
393 Ga0207657_10032744
394 Ga0207657_10316879
395 Ga0207646_10503615
396 Ga0207681_10679961
397 Ga0207687_10708520
398 Ga0207700_10257267
399 Ga0207690_10604665
400 Ga0207706_10289703
401 Ga0207686_10097885
402 Ga0207665_10003968
403 Ga0207667_10090800
404 Ga0207667_10134562
405 Ga0207667_10136103
406 Ga0207668_10068817
407 Ga0207640_10000502
408 Ga0207640_10027309
409 Ga0207639_10000082
410 Ga0207678_10002981
411 Ga0207708_10899781
412 Ga0207676_10431082
413 Ga0207675_100067163
414 Ga0207675_102064757
415 Ga0207683_10017785
416 Ga0207428_10161297
417 Ga0268266_10259258
418 Ga0307416_100777612
419 Ga0373930_0002829
420 Ga0373948_0000699
421 Ga0373958_0000792
422 Ga0373959_0031090
423 Ga0373929_0050380
424 Ga0373951_0003796
425 Ga0373932_0001580
426 Ga0373939_0001924
427 Ga0373941_0013319
428 Ga0373960_0035691
429 Ga0373961_0029317
430 Ga0373962_0001780
431 Ga0373931_0020646
432 Ga0395900_0013811
433 Ga0395900_0543420
434 Ga0395898_0002980
435 Ga0395898_0235319
436 Ga0395905_0022196
437 Ga0395901_0002370
438 Ga0395901_0101385
439 Ga0395901_0127952
440 Ga0395901_0195187
441 Ga0395901_1452570
442 Ga0439436_0032766
443 Ga0439433_0001766
444 Ga0439445_0057040
445 Ga0439446_0004319
446 Ga0439458_0011971
447 Ga0466966_0224219
448 Ga0466961_0124198
449 Ga0466963_0162750
450 Ga0466963_0531961
451 Ga0466964_0195158
452 Ga0466964_0522491
453 Ga0466957_0015183
454 Ga0466967_0028405
455 Ga0466967_0186943
456 Ga0495580_0036944
457 Ga0495585_0014137
458 Ga0495583_0024570
459 Ga0495606_0231482
460 Ga0495630_0024171
461 Ga0495644_0000028
462 Ga0495663_0239723
463 Ga0495645_0300848
464 Ga0495668_0452241
465 Ga0495611_0060277
466 Ga0495625_0021750
467 Ga0495669_0029764
468 Ga0495670_0103009
469 Ga0495636_0139571
470 Ga0495677_0019150
471 Ga0496100_0196521
472 Ga0496101_0046959
473 Ga0496102_0206595
474 Ga0496103_0047466
475 Ga0496103_0079831
476 Ga0496104_0007928
477 Ga0496104_1351280
478 Ga0496106_0027907
479 Ga0496106_0050234
480 Ga0496107_0021004
481 Ga0496107_0034682
482 Ga0496108_0018794
483 Ga0496109_0453218
484 Ga0496110_0032486
485 Ga0496112_0475945
486 Ga0496113_0355359
487 Ga0496115_0007070
488 Ga0501031_0010603
489 Ga0501031_0033284
490 Ga0501032_0003065
491 Ga0501036_0001253
492 Ga0501036_0032981
493 Ga0501037_0016730
494 Ga0501038_0031779
495 Ga0501039_0008331
496 Ga0501039_0144555
497 Ga0501040_0008212
498 Ga0501040_0053353
499 Ga0501041_0006471
500 Ga0501043_0139387
501 Ga0501043_0435250
502 Ga0501046_0000076
503 Ga0501046_0023633
504 Ga0501047_0000781
505 Ga0501067_0055144
506 Ga0501070_0058859
507 Ga0501071_0011851
508 Ga0501072_0007576
509 Ga0501073_0001348
510 Ga0501079_0021489
511 Ga0501080_0029873
512 Ga0501081_0032737
513 Ga0501083_0122213
514 Ga0501035_0005681
515 Ga0501035_0068964
516 Ga0501045_0002308
517 nmdc:mga05p37_170313_c1
518 nmdc:mga05p37_71090_c1
519 nmdc:mga05p37_80977_c1
520 nmdc:mga06r32_60421_c1
521 nmdc:mga08y16_17623_c1
522 nmdc:mga0n895_1081631_c1
523 nmdc:mga0n895_147699_c1
524 nmdc:mga0rr50_109320_c1
525 nmdc:mga0rr50_260886_c1
526 nmdc:mga0rr50_44882_c1
527 nmdc:mga08x19_203218_c1
528 nmdc:mga08x19_295515_c1
529 nmdc:mga0a205_298743_c1
530 nmdc:mga0a205_731388_c1
531 Ga0590071_045913
532 Ga0590075_012872
533 Ga0590077_096267
534 Ga0501082_0014417
535 Ga0466962_0002955
536 Ga0530510_0004494

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

40

162

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x2q-assembly1.cif.gz_B crystal structure of the medaka fish taste receptor t1r2a-t1r3 ligand binding domains in complex with glycine 0.7273 13 61
3drf-assembly1.cif.gz_A lactococcal oppa complexed with an endogenous peptide in the closed conformation 0.6722 26 62
8jd2-assembly1.cif.gz_3 cryo-em structure of g protein-free mglu2-mglu3 heterodimer in acc state 0.6705 13 61
2f46-assembly2.cif.gz_B crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution 0.6543 5 136
7uka-assembly1.cif.gz_A ygic from escherichia coli k-12 in complex with adp 0.639 13 62
ID Description Score Start End Superfamily
af_Q2G0A6_1_127_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8203 11 62 3.40.50.620
af_Q2FWL2_132_323_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7716 13 62 3.30.420.40
af_Q58167_1_260_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6966 13 62 3.40.50.2000
af_O45814_242_435_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6858 17 65 3.30.420.40
af_Q4E0P7_114_265_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.6816 13 62 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A537ZJX0-F1-model_v4 DUF488 domain-containing protein 0.9961 3 172
AF-A0A537TVU7-F1-model_v4 DUF488 domain-containing protein 0.9951 1 172 GO:0016020
AF-A0A538KX44-F1-model_v4 DUF488 domain-containing protein 0.9947 1 172
AF-A0A538ERW0-F1-model_v4 DUF488 domain-containing protein 0.9933 3 172
AF-A0A537TVU7-F1-model_v4 DUF488 domain-containing protein 0.9894 1 172 GO:0016020

Map