F375716

General Info

Members Datasets Scaffolds Average Seq Length
268 201 259 201

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0001469|Ga0495651_0001469_11433_12158
Length 241
Sequence LAEPESHFILIPANYTGVLKAPMHLTDHEVIAMSQQLSEDGLDLLFFKARTHNAWLEKPVGDDILRRLYDVMKWGPTSANCSPARILFLRTPEAKERLRPALAPGNVDKTMAAPVTAIIGYDGKFYEQLPKLFPHADARAWFADTPELAEVTARRNSSLQGAYFMLAARALGLDCGPMSGFDQVKVDHEFFPVTKPLNFEYEYFPDSHIKTNFLCNLGYGDPDKLFPRSPRLDFDEACKLL

Samples

Sample ID Description Type Environment
1 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
2 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
3 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
4 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
5 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
6 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
7 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
8 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
114 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
121 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
201 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.27
Metatranscriptomes 0.37
Isolates 3.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.97
Nodule 1.12
Rhizoplane 1.12
Rhizosphere 84.33
Stem 0
Stem Tuber 0
Unclassified 7.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10144902 3300003320 Bacteria 3227
2 Ga0007409J51694_1103739 3300003575 Bacteria 830
3 Ga0070666_10000688 3300005335 Bacteria 20504
4 Ga0070680_100143152 3300005336 Bacteria 2005
5 Ga0068868_100701906 3300005338 Bacteria 905
6 Ga0070661_100045087 3300005344 Bacteria 3223
7 Ga0070667_100010970 3300005367 Bacteria 7491
8 Ga0070709_10031499 3300005434 Bacteria 3190
9 Ga0070713_100263215 3300005436 Bacteria 1576
10 Ga0070711_100005665 3300005439 Bacteria 7483
11 Ga0070711_100418625 3300005439 Bacteria 1091
12 Ga0070662_100009659 3300005457 Bacteria 6311
13 Ga0068853_100152689 3300005539 Bacteria 2079
14 Ga0070672_100004136 3300005543 Bacteria 9470
15 Ga0070665_100139921 3300005548 Bacteria 2424
16 Ga0070665_100947328 3300005548 Bacteria 873
17 Ga0070704_100533491 3300005549 Bacteria 1023
18 Ga0068855_100003662 3300005563 Bacteria 18790
19 Ga0068855_100245473 3300005563 Bacteria 1999
20 Ga0068857_100012909 3300005577 Bacteria 7278
21 Ga0068854_100002522 3300005578 Bacteria 11340
22 Ga0068856_100053587 3300005614 Bacteria 3977
23 Ga0068851_10012403 3300005834 Bacteria 4017
24 Ga0070717_10111972 3300006028 Bacteria 2329
25 Ga0075365_10044016 3300006038 Bacteria 2924
26 Ga0075435_100843920 3300007076 Bacteria 798
27 Ga0105240_10000055 3300009093 Bacteria 225380
28 Ga0105240_10001159 3300009093 Bacteria 46178
29 Ga0105240_10004926 3300009093 Bacteria 20074
30 Ga0105240_10084114 3300009093 Bacteria 3902
31 Ga0105240_10094861 3300009093 Bacteria 3639
32 Ga0111539_10743760 3300009094 Bacteria 1141
33 Ga0105247_11057276 3300009101 Bacteria 638
34 Ga0105243_10000294 3300009148 Bacteria 55103
35 Ga0105248_10012231 3300009177 Bacteria 9463
36 Ga0105248_10430804 3300009177 Bacteria 1485
37 Ga0105248_10456772 3300009177 Bacteria 1440
38 Ga0105237_10043063 3300009545 Bacteria 4550
39 Ga0105238_10011994 3300009551 Bacteria 8730
40 Ga0105238_10031939 3300009551 Bacteria 5357
41 Ga0105238_10065565 3300009551 Bacteria 3633
42 Ga0105249_11479242 3300009553 Unclassified 751
43 Ga0105239_10016401 3300010375 Bacteria 8193
44 Ga0105239_10081424 3300010375 Bacteria 3564
45 Ga0105239_10560837 3300010375 Bacteria 1301
46 Ga0157373_10034877 3300013100 Bacteria 3614
47 Ga0157370_10216381 3300013104 Bacteria 1775
48 Ga0157369_10007696 3300013105 Bacteria 12397
49 Ga0157374_10147675 3300013296 Bacteria 2284
50 Ga0157378_10130508 3300013297 Bacteria 2326
51 Ga0157379_10052705 3300014968 Bacteria 3634
52 Ga0182007_10004786 3300015262 Bacteria 6077
53 Ga0213872_10000234 3300021361 Bacteria 48837
54 Ga0213876_10004730 3300021384 Bacteria 7569
55 Ga0213875_10013271 3300021388 Bacteria 4051
56 Ga0209129_1030876 3300025258 Bacteria 895
57 Ga0209564_1045659 3300025295 Bacteria 1125
58 Ga0209758_1020531 3300025297 Bacteria 3121
59 Ga0209051_1028457 3300025303 Bacteria 2206
60 Ga0207680_10008577 3300025903 Bacteria 5027
61 Ga0207699_10090962 3300025906 Bacteria 1915
62 Ga0207699_10350536 3300025906 Bacteria 1042
63 Ga0207654_10000811 3300025911 Bacteria 17219
64 Ga0207695_10000012 3300025913 Bacteria 840961
65 Ga0207695_10004350 3300025913 Bacteria 19398
66 Ga0207695_10010357 3300025913 Bacteria 11410
67 Ga0207695_10018535 3300025913 Bacteria 8043
68 Ga0207695_10172304 3300025913 Bacteria 2089
69 Ga0207671_10037907 3300025914 Bacteria 3574
70 Ga0207663_10022761 3300025916 Bacteria 3587
71 Ga0207649_10014906 3300025920 Bacteria 4361
72 Ga0207694_10000006 3300025924 Bacteria 631109
73 Ga0207694_10001415 3300025924 Bacteria 20567
74 Ga0207694_10251621 3300025924 Bacteria 1446
75 Ga0207700_10144781 3300025928 Bacteria 1957
76 Ga0207700_10594603 3300025928 Bacteria 984
77 Ga0207706_10000499 3300025933 Bacteria 41776
78 Ga0207709_10000180 3300025935 Bacteria 84481
79 Ga0207691_10029217 3300025940 Bacteria 5157
80 Ga0207711_10011682 3300025941 Bacteria 7296
81 Ga0207689_10066694 3300025942 Bacteria 2958
82 Ga0207667_10000026 3300025949 Bacteria 343713
83 Ga0207667_10011741 3300025949 Bacteria 10158
84 Ga0207667_11095801 3300025949 Bacteria 780
85 Ga0207658_10037608 3300025986 Bacteria 3479
86 Ga0207639_10191244 3300026041 Bacteria 1748
87 Ga0207678_10214185 3300026067 Bacteria 1648
88 Ga0207702_10000003 3300026078 Bacteria 434196
89 Ga0207674_10009035 3300026116 Bacteria 11446
90 Ga0207698_10021288 3300026142 Bacteria 4481
91 Ga0209588_1012718 3300027671 Bacteria 2558
92 Ga0209974_10118070 3300027876 Bacteria 938
93 Ga0268266_10129625 3300028379 Bacteria 2254
94 Ga0268266_10787246 3300028379 Bacteria 918
95 Ga0265338_10506234 3300028800 Bacteria 850
96 Ga0265330_10113075 3300031235 Bacteria 1159
97 Ga0265325_10045089 3300031241 Bacteria 2292
98 Ga0265340_10054939 3300031247 Bacteria 1920
99 Ga0265339_10001920 3300031249 Bacteria 15256
100 Ga0265339_10037479 3300031249 Bacteria 2709
101 Ga0265331_10111028 3300031250 Bacteria 1257
102 Ga0265327_10004841 3300031251 Bacteria 11669
103 Ga0265313_10004154 3300031595 Bacteria 11251
104 Ga0265313_10125688 3300031595 Bacteria 1115
105 Ga0265314_10006177 3300031711 Bacteria 10639
106 Ga0265314_10218055 3300031711 Bacteria 1115
107 Ga0307516_10058198 3300031730 Bacteria 3763
108 Ga0307516_10737696 3300031730 Bacteria 644
109 Ga0307413_10694238 3300031824 Bacteria 845
110 Ga0307412_10364871 3300031911 Bacteria 1164
111 Ga0307416_100483578 3300032002 Bacteria 1299
112 Ga0316583_10054049 3300032133 Bacteria 1412
113 Ga0373923_0028002 3300035111 Bacteria 2252
114 Ga0373953_0346117 3300035117 Bacteria 651
115 Ga0373954_0144543 3300035118 Bacteria 1161
116 Ga0373956_0054492 3300035119 Bacteria 1802
117 Ga0373957_0042734 3300035120 Bacteria 1711
118 Ga0373955_0150708 3300035172 Bacteria 1369
119 Ga0373935_0280367 3300035692 Bacteria 1173
120 Ga0373927_0017379 3300035695 Bacteria 4733
121 Ga0373933_0238246 3300035724 Bacteria 1170
122 Ga0373937_0032478 3300036401 Bacteria 4735
123 Ga0373937_0243856 3300036401 Bacteria 1693
124 Ga0373937_0321218 3300036401 Bacteria 1465
125 Ga0373925_0019751 3300037068 Bacteria 4904
126 Ga0373925_0197976 3300037068 Bacteria 1597
127 Ga0395899_0028345 3300037312 Bacteria 4218
128 Ga0395900_0033400 3300037418 Bacteria 5295
129 Ga0395900_0087799 3300037418 Bacteria 3196
130 Ga0395898_0179516 3300037466 Bacteria 2023
131 Ga0395898_0227720 3300037466 Bacteria 1778
132 Ga0395898_0633555 3300037466 Bacteria 1012
133 Ga0395905_0000455 3300037471 Bacteria 57161
134 Ga0395905_0099672 3300037471 Bacteria 2728
135 Ga0436364_1264487 3300037853 Bacteria 2161
136 Ga0395901_0003454 3300038443 Bacteria 15926
137 Ga0395901_0014901 3300038443 Bacteria 7899
138 Ga0395901_0107036 3300038443 Bacteria 2935
139 Ga0436365_1798326 3300039437 Bacteria 9165
140 Ga0436362_1026695 3300039453 Bacteria 729
141 Ga0439436_0002965 3300041404 Bacteria 5144
142 Ga0439438_002103 3300041405 Bacteria 8588
143 Ga0439447_004532 3300041407 Bacteria 4755
144 Ga0439466_0004409 3300041411 Bacteria 5421
145 Ga0439431_0018041 3300041997 Bacteria 1666
146 Ga0439432_050486 3300042006 Bacteria 1298
147 Ga0439446_0032615 3300042156 Bacteria 1511
148 Ga0439434_0022968 3300042435 Bacteria 1876
149 Ga0439444_0008884 3300042437 Bacteria 1574
150 Ga0439460_0004104 3300042461 Bacteria 3539
151 Ga0466972_0037044 3300044658 Bacteria 2384
152 Ga0466966_0000687 3300044684 Bacteria 21520
153 Ga0466963_0014486 3300044694 Bacteria 4862
154 Ga0466964_0327289 3300044706 Bacteria 780
155 Ga0466971_0009479 3300044719 Bacteria 4250
156 Ga0466968_0387118 3300044735 Bacteria 684
157 Ga0466970_0005981 3300044765 Bacteria 6061
158 Ga0466957_0127096 3300044842 Bacteria 1629
159 Ga0466959_0000287 3300045049 Bacteria 30550
160 Ga0466967_0075043 3300045976 Bacteria 3038
161 Ga0495592_0018724 3300046454 Bacteria 5270
162 Ga0495603_0001359 3300046455 Bacteria 14209
163 Ga0495638_0194415 3300046460 Bacteria 1149
164 Ga0495641_0005981 3300046461 Bacteria 8017
165 Ga0495641_0124496 3300046461 Bacteria 1150
166 Ga0495651_0001469 3300046462 Bacteria 18227
167 Ga0495580_0001360 3300046472 Bacteria 21507
168 Ga0495580_0004454 3300046472 Bacteria 11770
169 Ga0495580_0007757 3300046472 Bacteria 8602
170 Ga0495582_0009737 3300046473 Bacteria 5293
171 Ga0495662_0003877 3300046476 Bacteria 7545
172 Ga0495594_0114738 3300046499 Bacteria 1520
173 Ga0495583_0000247 3300046506 Bacteria 89254
174 Ga0495606_0006132 3300046507 Bacteria 11216
175 Ga0495606_0007056 3300046507 Bacteria 10175
176 Ga0495618_0001711 3300046514 Bacteria 14562
177 Ga0495628_0000750 3300046516 Bacteria 29958
178 Ga0495628_0008784 3300046516 Bacteria 8646
179 Ga0495630_0013697 3300046517 Bacteria 5895
180 Ga0495643_0154917 3300046522 Bacteria 1132
181 Ga0495648_0017131 3300046524 Bacteria 5191
182 Ga0495648_0078261 3300046524 Bacteria 1892
183 Ga0495666_0001217 3300046526 Bacteria 12437
184 Ga0495666_0006958 3300046526 Bacteria 5683
185 Ga0495652_0012363 3300046529 Bacteria 7703
186 Ga0495652_0058269 3300046529 Bacteria 3271
187 Ga0495652_0152745 3300046529 Bacteria 1801
188 Ga0495665_0009512 3300046531 Bacteria 5263
189 Ga0495665_0012417 3300046531 Bacteria 4609
190 Ga0495640_0004292 3300046533 Bacteria 11381
191 Ga0495586_0000966 3300046535 Bacteria 16281
192 Ga0495586_0068355 3300046535 Bacteria 1938
193 Ga0495587_0000560 3300046536 Bacteria 25628
194 Ga0495645_0030027 3300046543 Bacteria 3959
195 Ga0495645_0031730 3300046543 Bacteria 3850
196 Ga0495622_0101876 3300046557 Bacteria 1316
197 Ga0495622_0249612 3300046557 Bacteria 781
198 Ga0495656_0160371 3300046615 Bacteria 1093
199 Ga0495634_0000146 3300046642 Bacteria 63192
200 Ga0495611_0003524 3300046648 Bacteria 6892
201 Ga0495611_0041759 3300046648 Bacteria 2046
202 Ga0495625_0001000 3300046660 Bacteria 37446
203 Ga0495635_0325110 3300046663 Bacteria 1029
204 Ga0495661_0009799 3300046665 Bacteria 6555
205 Ga0495623_0010551 3300046679 Bacteria 5978
206 Ga0495623_0063057 3300046679 Bacteria 2322
207 Ga0495646_0022198 3300046680 Bacteria 4004
208 Ga0495646_0028389 3300046680 Bacteria 3503
209 Ga0495613_0052500 3300046689 Bacteria 3002
210 Ga0495581_0008431 3300047315 Bacteria 5976
211 Ga0495604_0003360 3300047317 Bacteria 12762
212 Ga0495604_0080882 3300047317 Bacteria 2433
213 Ga0495636_0150326 3300047318 Bacteria 1045
214 Ga0495674_0012277 3300047319 Bacteria 8074
215 Ga0495674_0012740 3300047319 Bacteria 7922
216 Ga0495676_0114539 3300047321 Bacteria 1972
217 Ga0495680_0015585 3300047322 Bacteria 6555
218 Ga0495680_0041192 3300047322 Bacteria 3674
219 Ga0495675_0025107 3300047444 Bacteria 3800
220 Ga0495679_002873 3300047446 Bacteria 8536
221 Ga0495684_0008525 3300047471 Bacteria 7937
222 Ga0495684_0063264 3300047471 Bacteria 2813
223 Ga0495684_0201194 3300047471 Bacteria 1468
224 Ga0495602_0005099 3300048088 Bacteria 13757
225 Ga0495602_0244917 3300048088 Bacteria 1339
226 Ga0495602_0310471 3300048088 Bacteria 1151
227 Ga0495602_0466947 3300048088 Bacteria 888
228 Ga0495614_0018666 3300048089 Bacteria 3003
229 Ga0495626_0037455 3300048091 Bacteria 2305
230 Ga0496102_0037836 3300048905 Bacteria 4353
231 Ga0496105_0085513 3300048908 Bacteria 2606
232 Ga0496115_0105091 3300048918 Bacteria 2317
233 Ga0496118_0086470 3300048921 Bacteria 2178
234 Ga0496118_0107896 3300048921 Bacteria 1858
235 Ga0496121_0010568 3300048924 Bacteria 10377
236 Ga0496121_0036746 3300048924 Bacteria 4360
237 Ga0496122_0000351 3300048925 Bacteria 99357
238 Ga0496123_0000283 3300048926 Bacteria 99808
239 Ga0496124_0072460 3300048927 Bacteria 2853
240 Ga0496125_0004238 3300048928 Bacteria 16711
241 Ga0496126_0401714 3300048929 Bacteria 1111
242 Ga0495682_0007439 3300049460 Bacteria 4357
243 Ga0495682_0176588 3300049460 Bacteria 759
244 Ga0501075_0140226 3300049591 Bacteria 1842
245 nmdc:mga0rr50_567911_c1 3300050513 Bacteria 966
246 Ga0495601_0573177 3300053077 Bacteria 725
247 Ga0495612_0096232 3300053078 Bacteria 1258
248 Ga0500610_0234702 3300053079 Bacteria 858
249 Ga0500643_006226 3300053087 Bacteria 5015
250 Ga0500643_013224 3300053087 Bacteria 2922
251 Ga0500641_0093114 3300053096 Bacteria 1288
252 Ga0500555_008525 3300053103 Bacteria 2924
253 Ga0500555_012645 3300053103 Bacteria 2431
254 Ga0500595_005906 3300053119 Bacteria 5270
255 Ga0500595_017796 3300053119 Bacteria 2614
256 Ga0500642_0104293 3300053130 Bacteria 1321
257 Ga0500616_0000006 3300053153 Bacteria 944738
258 Ga0500637_0161669 3300053178 Bacteria 1290
259 Ga0530510_0603726 3300061734 Bacteria 835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025906 Ga0207699_10350536 Ga0207699_103505362 158
2 3300044706 Ga0466964_0327289 Ga0466964_0327289_30_518 160
3 3300035172 Ga0373955_0150708 Ga0373955_0150708_647_1201 182
4 3300036401 Ga0373937_0243856 Ga0373937_0243856_225_779 182
5 3300027876 Ga0209974_10118070 Ga0209974_101180702 185
6 3300046557 Ga0495622_0101876 Ga0495622_0101876_26_631 186
7 3300053078 Ga0495612_0096232 Ga0495612_0096232_19_591 189
8 3300005457 Ga0070662_100009659 Ga0070662_1000096596 190
9 3300025933 Ga0207706_10000499 Ga0207706_100004997 190
10 3300037471 Ga0395905_0099672 Ga0395905_0099672_495_1073 190
11 3300044658 Ga0466972_0037044 Ga0466972_0037044_56_634 190
12 3300044684 Ga0466966_0000687 Ga0466966_0000687_4055_4633 190
13 3300044694 Ga0466963_0014486 Ga0466963_0014486_2159_2737 190
14 3300044719 Ga0466971_0009479 Ga0466971_0009479_326_904 190
15 3300044765 Ga0466970_0005981 Ga0466970_0005981_3219_3797 190
16 3300044842 Ga0466957_0127096 Ga0466957_0127096_458_1036 190
17 3300045049 Ga0466959_0000287 Ga0466959_0000287_9836_10414 190
18 3300045976 Ga0466967_0075043 Ga0466967_0075043_1368_1946 190
19 iso_pu_bacteria 2562617112 2563062249 191
20 iso_pu_bacteria 2711768613 2713477900 191
21 3300003575 Ga0007409J51694_1103739 Ga0007409J51694_11037391 192
22 3300021361 Ga0213872_10000234 Ga0213872_1000023421 192
23 iso_pu_bacteria 2884811622 2884811956 192
24 iso_pu_bacteria 2884836552 2884840140 192
25 iso_pu_bacteria 2884852848 2884857093 192
26 iso_pu_bacteria 2896154374 2896157679 192
27 iso_pu_bacteria 8024486573 8024490578 192
28 3300009148 Ga0105243_10000294 Ga0105243_1000029426 193
29 3300013104 Ga0157370_10216381 Ga0157370_102163812 193
30 3300025935 Ga0207709_10000180 Ga0207709_1000018051 193
31 3300031911 Ga0307412_10364871 Ga0307412_103648712 193
32 3300035117 Ga0373953_0346117 Ga0373953_0346117_18_602 193
33 3300035118 Ga0373954_0144543 Ga0373954_0144543_161_745 193
34 3300035119 Ga0373956_0054492 Ga0373956_0054492_1136_1720 193
35 3300035120 Ga0373957_0042734 Ga0373957_0042734_897_1481 193
36 3300035692 Ga0373935_0280367 Ga0373935_0280367_56_640 193
37 3300035695 Ga0373927_0017379 Ga0373927_0017379_1512_2096 193
38 3300035724 Ga0373933_0238246 Ga0373933_0238246_62_646 193
39 3300037068 Ga0373925_0019751 Ga0373925_0019751_1330_1914 193
40 3300037312 Ga0395899_0028345 Ga0395899_0028345_2662_3252 193
41 3300037418 Ga0395900_0033400 Ga0395900_0033400_3763_4353 193
42 3300037418 Ga0395900_0087799 Ga0395900_0087799_623_1213 193
43 3300037466 Ga0395898_0179516 Ga0395898_0179516_152_742 193
44 3300037471 Ga0395905_0000455 Ga0395905_0000455_22823_23407 193
45 3300038443 Ga0395901_0003454 Ga0395901_0003454_1610_2200 193
46 3300038443 Ga0395901_0014901 Ga0395901_0014901_4981_5571 193
47 3300042437 Ga0439444_0008884 Ga0439444_0008884_772_1359 193
48 3300042461 Ga0439460_0004104 Ga0439460_0004104_2180_2767 193
49 3300044735 Ga0466968_0387118 Ga0466968_0387118_55_639 193
50 3300046472 Ga0495580_0004454 Ga0495580_0004454_8386_8970 193
51 3300046663 Ga0495635_0325110 Ga0495635_0325110_40_624 193
52 3300047471 Ga0495684_0063264 Ga0495684_0063264_1806_2390 193
53 3300046507 Ga0495606_0007056 Ga0495606_0007056_2133_2720 194
54 iso_pu_bacteria 2765235838 2765570414 194
55 iso_pu_bacteria 2839094727 2839097960 194
56 3300005338 Ga0068868_100701906 Ga0068868_1007019061 195
57 3300005543 Ga0070672_100004136 Ga0070672_1000041368 195
58 3300007076 Ga0075435_100843920 Ga0075435_1008439201 195
59 3300009093 Ga0105240_10004926 Ga0105240_1000492611 195
60 3300009177 Ga0105248_10012231 Ga0105248_100122319 195
61 3300010375 Ga0105239_10560837 Ga0105239_105608372 195
62 3300013296 Ga0157374_10147675 Ga0157374_101476752 195
63 3300013297 Ga0157378_10130508 Ga0157378_101305082 195
64 3300015262 Ga0182007_10004786 Ga0182007_100047863 195
65 3300025258 Ga0209129_1030876 Ga0209129_10308761 195
66 3300025295 Ga0209564_1045659 Ga0209564_10456591 195
67 3300025303 Ga0209051_1028457 Ga0209051_10284572 195
68 3300025913 Ga0207695_10018535 Ga0207695_100185352 195
69 3300025940 Ga0207691_10029217 Ga0207691_100292173 195
70 3300025941 Ga0207711_10011682 Ga0207711_100116827 195
71 3300025942 Ga0207689_10066694 Ga0207689_100666942 195
72 3300032133 Ga0316583_10054049 Ga0316583_100540492 195
73 3300037466 Ga0395898_0633555 Ga0395898_0633555_32_730 195
74 3300041404 Ga0439436_0002965 Ga0439436_0002965_1581_2213 195
75 3300041405 Ga0439438_002103 Ga0439438_002103_4178_4810 195
76 3300041407 Ga0439447_004532 Ga0439447_004532_2032_2664 195
77 3300041411 Ga0439466_0004409 Ga0439466_0004409_312_944 195
78 3300041997 Ga0439431_0018041 Ga0439431_0018041_323_955 195
79 3300042006 Ga0439432_050486 Ga0439432_050486_25_657 195
80 3300042156 Ga0439446_0032615 Ga0439446_0032615_578_1210 195
81 3300042435 Ga0439434_0022968 Ga0439434_0022968_368_1000 195
82 3300046454 Ga0495592_0018724 Ga0495592_0018724_2844_3476 195
83 3300046455 Ga0495603_0001359 Ga0495603_0001359_2265_2897 195
84 3300046460 Ga0495638_0194415 Ga0495638_0194415_508_1098 195
85 3300046461 Ga0495641_0005981 Ga0495641_0005981_5323_5955 195
86 3300046462 Ga0495651_0001469 Ga0495651_0001469_11433_12158 195
87 3300046472 Ga0495580_0001360 Ga0495580_0001360_18611_19243 195
88 3300046472 Ga0495580_0007757 Ga0495580_0007757_7484_8146 195
89 3300046473 Ga0495582_0009737 Ga0495582_0009737_2265_2897 195
90 3300046476 Ga0495662_0003877 Ga0495662_0003877_4675_5307 195
91 3300046499 Ga0495594_0114738 Ga0495594_0114738_167_829 195
92 3300046506 Ga0495583_0000247 Ga0495583_0000247_31286_31876 195
93 3300046507 Ga0495606_0006132 Ga0495606_0006132_8155_8745 195
94 3300046514 Ga0495618_0001711 Ga0495618_0001711_2227_2859 195
95 3300046516 Ga0495628_0000750 Ga0495628_0000750_14173_14898 195
96 3300046516 Ga0495628_0008784 Ga0495628_0008784_4357_4989 195
97 3300046517 Ga0495630_0013697 Ga0495630_0013697_2265_2897 195
98 3300046524 Ga0495648_0017131 Ga0495648_0017131_2295_2927 195
99 3300046524 Ga0495648_0078261 Ga0495648_0078261_114_827 195
100 3300046526 Ga0495666_0001217 Ga0495666_0001217_190_852 195
101 3300046526 Ga0495666_0006958 Ga0495666_0006958_2237_2869 195
102 3300046529 Ga0495652_0058269 Ga0495652_0058269_1925_2650 195
103 3300046529 Ga0495652_0152745 Ga0495652_0152745_107_739 195
104 3300046531 Ga0495665_0009512 Ga0495665_0009512_179_841 195
105 3300046531 Ga0495665_0012417 Ga0495665_0012417_2580_3212 195
106 3300046533 Ga0495640_0004292 Ga0495640_0004292_1861_2493 195
107 3300046535 Ga0495586_0000966 Ga0495586_0000966_6560_7192 195
108 3300046536 Ga0495587_0000560 Ga0495587_0000560_22746_23378 195
109 3300046543 Ga0495645_0030027 Ga0495645_0030027_2217_2849 195
110 3300046543 Ga0495645_0031730 Ga0495645_0031730_1047_1676 195
111 3300046642 Ga0495634_0000146 Ga0495634_0000146_60371_61003 195
112 3300046648 Ga0495611_0003524 Ga0495611_0003524_2255_2887 195
113 3300046648 Ga0495611_0041759 Ga0495611_0041759_105_695 195
114 3300046665 Ga0495661_0009799 Ga0495661_0009799_2265_2897 195
115 3300046679 Ga0495623_0010551 Ga0495623_0010551_5090_5722 195
116 3300046679 Ga0495623_0063057 Ga0495623_0063057_1184_1909 195
117 3300046680 Ga0495646_0022198 Ga0495646_0022198_1108_1740 195
118 3300046680 Ga0495646_0028389 Ga0495646_0028389_2444_3073 195
119 3300046689 Ga0495613_0052500 Ga0495613_0052500_106_738 195
120 3300047315 Ga0495581_0008431 Ga0495581_0008431_3080_3712 195
121 3300047317 Ga0495604_0003360 Ga0495604_0003360_10050_10682 195
122 3300047317 Ga0495604_0080882 Ga0495604_0080882_176_838 195
123 3300047318 Ga0495636_0150326 Ga0495636_0150326_308_979 195
124 3300047319 Ga0495674_0012277 Ga0495674_0012277_4357_4989 195
125 3300047319 Ga0495674_0012740 Ga0495674_0012740_2317_2949 195
126 3300047321 Ga0495676_0114539 Ga0495676_0114539_843_1475 195
127 3300047322 Ga0495680_0015585 Ga0495680_0015585_2265_2897 195
128 3300047444 Ga0495675_0025107 Ga0495675_0025107_106_738 195
129 3300047446 Ga0495679_002873 Ga0495679_002873_5655_6287 195
130 3300047471 Ga0495684_0008525 Ga0495684_0008525_2237_2869 195
131 3300048088 Ga0495602_0005099 Ga0495602_0005099_2237_2869 195
132 3300048088 Ga0495602_0244917 Ga0495602_0244917_406_1035 195
133 3300048088 Ga0495602_0310471 Ga0495602_0310471_63_788 195
134 3300048088 Ga0495602_0466947 Ga0495602_0466947_179_841 195
135 3300048089 Ga0495614_0018666 Ga0495614_0018666_2265_2897 195
136 3300048905 Ga0496102_0037836 Ga0496102_0037836_2426_3118 195
137 3300048908 Ga0496105_0085513 Ga0496105_0085513_1328_2020 195
138 3300049460 Ga0495682_0176588 Ga0495682_0176588_34_624 195
139 3300049591 Ga0501075_0140226 Ga0501075_0140226_975_1568 195
140 3300050513 nmdc:mga0rr50_567911_c1 nmdc:mga0rr50_567911_c1_234_926 195
141 3300053103 Ga0500555_008525 Ga0500555_008525_2254_2844 195
142 3300061734 Ga0530510_0603726 Ga0530510_0603726_13_606 195
143 3300003320 rootH2_10144902 rootH2_101449021 196
144 3300005335 Ga0070666_10000688 Ga0070666_100006885 196
145 3300005336 Ga0070680_100143152 Ga0070680_1001431523 196
146 3300005344 Ga0070661_100045087 Ga0070661_1000450874 196
147 3300005367 Ga0070667_100010970 Ga0070667_1000109705 196
148 3300005434 Ga0070709_10031499 Ga0070709_100314991 196
149 3300005436 Ga0070713_100263215 Ga0070713_1002632152 196
150 3300005439 Ga0070711_100005665 Ga0070711_1000056652 196
151 3300005439 Ga0070711_100418625 Ga0070711_1004186251 196
152 3300005539 Ga0068853_100152689 Ga0068853_1001526893 196
153 3300005548 Ga0070665_100139921 Ga0070665_1001399214 196
154 3300005548 Ga0070665_100947328 Ga0070665_1009473281 196
155 3300005549 Ga0070704_100533491 Ga0070704_1005334912 196
156 3300005563 Ga0068855_100003662 Ga0068855_10000366215 196
157 3300005563 Ga0068855_100245473 Ga0068855_1002454733 196
158 3300005577 Ga0068857_100012909 Ga0068857_1000129093 196
159 3300005578 Ga0068854_100002522 Ga0068854_1000025225 196
160 3300005614 Ga0068856_100053587 Ga0068856_1000535872 196
161 3300005834 Ga0068851_10012403 Ga0068851_100124032 196
162 3300006028 Ga0070717_10111972 Ga0070717_101119722 196
163 3300006038 Ga0075365_10044016 Ga0075365_100440161 196
164 3300009093 Ga0105240_10000055 Ga0105240_1000005566 196
165 3300009093 Ga0105240_10001159 Ga0105240_1000115951 196
166 3300009093 Ga0105240_10084114 Ga0105240_100841144 196
167 3300009093 Ga0105240_10094861 Ga0105240_100948612 196
168 3300009094 Ga0111539_10743760 Ga0111539_107437602 196
169 3300009101 Ga0105247_11057276 Ga0105247_110572761 196
170 3300009177 Ga0105248_10430804 Ga0105248_104308043 196
171 3300009177 Ga0105248_10456772 Ga0105248_104567722 196
172 3300009545 Ga0105237_10043063 Ga0105237_100430633 196
173 3300009551 Ga0105238_10011994 Ga0105238_100119947 196
174 3300009551 Ga0105238_10031939 Ga0105238_100319395 196
175 3300009551 Ga0105238_10065565 Ga0105238_100655654 196
176 3300009553 Ga0105249_11479242 Ga0105249_114792421 196
177 3300010375 Ga0105239_10016401 Ga0105239_100164016 196
178 3300010375 Ga0105239_10081424 Ga0105239_100814244 196
179 3300013100 Ga0157373_10034877 Ga0157373_100348774 196
180 3300013105 Ga0157369_10007696 Ga0157369_100076966 196
181 3300014968 Ga0157379_10052705 Ga0157379_100527052 196
182 3300021384 Ga0213876_10004730 Ga0213876_100047307 196
183 3300021388 Ga0213875_10013271 Ga0213875_100132714 196
184 3300025297 Ga0209758_1020531 Ga0209758_10205313 196
185 3300025903 Ga0207680_10008577 Ga0207680_100085775 196
186 3300025906 Ga0207699_10090962 Ga0207699_100909622 196
187 3300025911 Ga0207654_10000811 Ga0207654_1000081114 196
188 3300025913 Ga0207695_10000012 Ga0207695_10000012270 196
189 3300025913 Ga0207695_10004350 Ga0207695_100043506 196
190 3300025913 Ga0207695_10010357 Ga0207695_1001035712 196
191 3300025913 Ga0207695_10172304 Ga0207695_101723042 196
192 3300025914 Ga0207671_10037907 Ga0207671_100379073 196
193 3300025916 Ga0207663_10022761 Ga0207663_100227613 196
194 3300025920 Ga0207649_10014906 Ga0207649_100149063 196
195 3300025924 Ga0207694_10000006 Ga0207694_10000006395 196
196 3300025924 Ga0207694_10001415 Ga0207694_1000141515 196
197 3300025924 Ga0207694_10251621 Ga0207694_102516212 196
198 3300025928 Ga0207700_10144781 Ga0207700_101447812 196
199 3300025928 Ga0207700_10594603 Ga0207700_105946032 196
200 3300025949 Ga0207667_10000026 Ga0207667_1000002695 196
201 3300025949 Ga0207667_10011741 Ga0207667_100117419 196
202 3300025949 Ga0207667_11095801 Ga0207667_110958012 196
203 3300025986 Ga0207658_10037608 Ga0207658_100376086 196
204 3300026041 Ga0207639_10191244 Ga0207639_101912442 196
205 3300026067 Ga0207678_10214185 Ga0207678_102141853 196
206 3300026078 Ga0207702_10000003 Ga0207702_1000000326 196
207 3300026116 Ga0207674_10009035 Ga0207674_1000903512 196
208 3300026142 Ga0207698_10021288 Ga0207698_100212885 196
209 3300027671 Ga0209588_1012718 Ga0209588_10127182 196
210 3300028379 Ga0268266_10129625 Ga0268266_101296254 196
211 3300028379 Ga0268266_10787246 Ga0268266_107872462 196
212 3300028800 Ga0265338_10506234 Ga0265338_105062342 196
213 3300031235 Ga0265330_10113075 Ga0265330_101130751 196
214 3300031241 Ga0265325_10045089 Ga0265325_100450892 196
215 3300031247 Ga0265340_10054939 Ga0265340_100549393 196
216 3300031249 Ga0265339_10001920 Ga0265339_100019202 196
217 3300031249 Ga0265339_10037479 Ga0265339_100374792 196
218 3300031250 Ga0265331_10111028 Ga0265331_101110282 196
219 3300031251 Ga0265327_10004841 Ga0265327_100048416 196
220 3300031595 Ga0265313_10004154 Ga0265313_100041544 196
221 3300031595 Ga0265313_10125688 Ga0265313_101256881 196
222 3300031711 Ga0265314_10006177 Ga0265314_100061776 196
223 3300031711 Ga0265314_10218055 Ga0265314_102180552 196
224 3300031730 Ga0307516_10058198 Ga0307516_100581984 196
225 3300031730 Ga0307516_10737696 Ga0307516_107376961 196
226 3300031824 Ga0307413_10694238 Ga0307413_106942382 196
227 3300032002 Ga0307416_100483578 Ga0307416_1004835782 196
228 3300035111 Ga0373923_0028002 Ga0373923_0028002_356_949 196
229 3300036401 Ga0373937_0032478 Ga0373937_0032478_2676_3269 196
230 3300036401 Ga0373937_0321218 Ga0373937_0321218_445_1038 196
231 3300037068 Ga0373925_0197976 Ga0373925_0197976_735_1328 196
232 3300037466 Ga0395898_0227720 Ga0395898_0227720_587_1186 196
233 3300037853 Ga0436364_1264487 Ga0436364_1264487_1203_1832 196
234 3300038443 Ga0395901_0107036 Ga0395901_0107036_1725_2324 196
235 3300039437 Ga0436365_1798326 Ga0436365_1798326_2363_2956 196
236 3300039453 Ga0436362_1026695 Ga0436362_1026695_124_717 196
237 3300046461 Ga0495641_0124496 Ga0495641_0124496_109_702 196
238 3300046522 Ga0495643_0154917 Ga0495643_0154917_252_893 196
239 3300046529 Ga0495652_0012363 Ga0495652_0012363_1343_1933 196
240 3300046535 Ga0495586_0068355 Ga0495586_0068355_436_1026 196
241 3300046557 Ga0495622_0249612 Ga0495622_0249612_49_639 196
242 3300046615 Ga0495656_0160371 Ga0495656_0160371_32_625 196
243 3300046660 Ga0495625_0001000 Ga0495625_0001000_5564_6157 196
244 3300047322 Ga0495680_0041192 Ga0495680_0041192_210_803 196
245 3300047471 Ga0495684_0201194 Ga0495684_0201194_560_1153 196
246 3300048091 Ga0495626_0037455 Ga0495626_0037455_1529_2170 196
247 3300048918 Ga0496115_0105091 Ga0496115_0105091_1178_1771 196
248 3300048921 Ga0496118_0086470 Ga0496118_0086470_952_1545 196
249 3300048921 Ga0496118_0107896 Ga0496118_0107896_197_790 196
250 3300048924 Ga0496121_0010568 Ga0496121_0010568_6562_7155 196
251 3300048924 Ga0496121_0036746 Ga0496121_0036746_462_1055 196
252 3300048925 Ga0496122_0000351 Ga0496122_0000351_5108_5701 196
253 3300048926 Ga0496123_0000283 Ga0496123_0000283_5244_5837 196
254 3300048927 Ga0496124_0072460 Ga0496124_0072460_875_1468 196
255 3300048928 Ga0496125_0004238 Ga0496125_0004238_11700_12293 196
256 3300048929 Ga0496126_0401714 Ga0496126_0401714_417_1010 196
257 3300049460 Ga0495682_0007439 Ga0495682_0007439_3361_3951 196
258 3300053077 Ga0495601_0573177 Ga0495601_0573177_53_646 196
259 3300053079 Ga0500610_0234702 Ga0500610_0234702_125_718 196
260 3300053087 Ga0500643_006226 Ga0500643_006226_1324_1917 196
261 3300053087 Ga0500643_013224 Ga0500643_013224_833_1426 196
262 3300053096 Ga0500641_0093114 Ga0500641_0093114_605_1198 196
263 3300053103 Ga0500555_012645 Ga0500555_012645_969_1562 196
264 3300053119 Ga0500595_005906 Ga0500595_005906_3610_4203 196
265 3300053119 Ga0500595_017796 Ga0500595_017796_1200_1793 196
266 3300053130 Ga0500642_0104293 Ga0500642_0104293_631_1224 196
267 3300053153 Ga0500616_0000006 Ga0500616_0000006_8273_8866 196
268 3300053178 Ga0500637_0161669 Ga0500637_0161669_589_1182 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

48

200

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vqk-assembly1.cif.gz_B catalytic manifolds of a fmn-dependent oxidoreductase rube7, expanding the functional diversity of the flavoenzyme superfamily 0.9614 3 196
7vqk-assembly1.cif.gz_B catalytic manifolds of a fmn-dependent oxidoreductase rube7, expanding the functional diversity of the flavoenzyme superfamily 0.9519 3 196
3bem-assembly1.cif.gz_A crystal structure of putative nitroreductase ydfn (2632848) from bacillus subtilis at 1.65 a resolution 0.9032 6 196
3ge6-assembly1.cif.gz_B crystal structure of a putative nitroreductase in complex with fmn (exig_2970) from exiguobacterium sibiricum 255-15 at 1.85 a resolution 0.8814 4 196
3bem-assembly1.cif.gz_A crystal structure of putative nitroreductase ydfn (2632848) from bacillus subtilis at 1.65 a resolution 0.8772 6 196
ID Description Score Start End Superfamily
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9724 9 194 3.40.109.10
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9622 9 194 3.40.109.10
3bemA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8687 13 195 3.40.109.10
af_Q2G0Z5_3_251_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8405 17 195 3.40.109.10
1noxA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8398 4 196 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A2V6ZR43-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase DME00_11260 (EC 1.-.-.-) 0.9817 3 196 GO:0016491
AF-A0A4R6AEN0-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase E2L05_20320 (EC 1.-.-.-) 0.9817 2 196 GO:0016491
AF-A0A523FXZ3-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase E2O89_03170 (EC 1.-.-.-) 0.9801 1 196 GO:0016491
AF-A0A522J036-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase EPN72_13485 (EC 1.-.-.-) 0.98 3 196 GO:0016491
AF-A0A2V6UYS3-F1-model_v4 Malonic semialdehyde reductase 0.9787 1 182 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map