F375607

General Info

Members Datasets Scaffolds Average Seq Length
268 197 536 117

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10000002|Ga0265331_1000000250
Length 145
Sequence VKTASVTWYMVWFDSRAATIPGGKQAHTIMLYLAIKALLSGVIIMAVSEIAKRSPAFGALVASLPLVSVLAIIWLWRDTGDTARIANHAEATFWYVIPSLPMFLAFPYMLRHGIAFWWALSMACALTVALYFVTVLIASRFGISL

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
121 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
193 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.46
Nodule 0
Rhizoplane 1.87
Rhizosphere 86.94
Stem 0
Stem Tuber 0
Unclassified 11.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10000002 3300031250 Bacteria 511481
2 Ga0070658_10564987 3300005327 Unclassified 985
3 Ga0070658_11388282 3300005327 Bacteria 610
4 Ga0070683_100931017 3300005329 Bacteria 834
5 Ga0070670_100566924 3300005331 Bacteria 1014
6 Ga0070670_101841469 3300005331 Bacteria 557
7 Ga0070666_10225352 3300005335 Bacteria 1323
8 Ga0070680_100025803 3300005336 Bacteria 4699
9 Ga0070680_100265092 3300005336 Bacteria 1454
10 Ga0070660_100753796 3300005339 Bacteria 817
11 Ga0070661_100261175 3300005344 Bacteria 1339
12 Ga0070661_101875035 3300005344 Unclassified 509
13 Ga0070668_100343360 3300005347 Bacteria 1262
14 Ga0070668_100481388 3300005347 Bacteria 1072
15 Ga0070675_100781485 3300005354 Bacteria 872
16 Ga0070659_100284555 3300005366 Bacteria 1376
17 Ga0070659_100485957 3300005366 Bacteria 1051
18 Ga0070667_100900361 3300005367 Bacteria 824
19 Ga0070714_100043384 3300005435 Bacteria 3803
20 Ga0070710_10001242 3300005437 Bacteria 12095
21 Ga0070711_100001414 3300005439 Bacteria 13168
22 Ga0070711_100654067 3300005439 Unclassified 881
23 Ga0070700_100085493 3300005441 Bacteria 2046
24 Ga0070681_10154578 3300005458 Bacteria 2219
25 Ga0070681_10535442 3300005458 Bacteria 1085
26 Ga0070679_100188606 3300005530 Bacteria 2031
27 Ga0070679_101422337 3300005530 Bacteria 640
28 Ga0068853_100931680 3300005539 Bacteria 835
29 Ga0070672_101044805 3300005543 Bacteria 725
30 Ga0070665_100230103 3300005548 Bacteria 1854
31 Ga0070665_100889951 3300005548 Unclassified 903
32 Ga0070665_100953841 3300005548 Unclassified 870
33 Ga0068855_100165360 3300005563 Bacteria 2509
34 Ga0068855_100497131 3300005563 Unclassified 1326
35 Ga0070664_100558117 3300005564 Bacteria 1059
36 Ga0068856_100343638 3300005614 Bacteria 1511
37 Ga0068856_101360537 3300005614 Bacteria 725
38 Ga0068859_102270951 3300005617 Bacteria 598
39 Ga0068870_10607901 3300005840 Unclassified 744
40 Ga0068858_101246464 3300005842 Bacteria 731
41 Ga0068860_101955892 3300005843 Unclassified 608
42 Ga0070717_10119997 3300006028 Unclassified 2252
43 Ga0075368_10359129 3300006042 Unclassified 635
44 Ga0075363_100552867 3300006048 Bacteria 687
45 Ga0075364_10274584 3300006051 Bacteria 1146
46 Ga0070716_100007984 3300006173 Bacteria 5240
47 Ga0070716_100207646 3300006173 Bacteria 1306
48 Ga0070712_100047131 3300006175 Bacteria 2982
49 Ga0075367_10013390 3300006178 Bacteria 4407
50 Ga0097621_100000103 3300006237 Bacteria 47664
51 Ga0068871_100000184 3300006358 Bacteria 42407
52 Ga0068871_100030492 3300006358 Bacteria 4247
53 Ga0068865_100612770 3300006881 Bacteria 921
54 Ga0097620_102272352 3300006931 Bacteria 598
55 Ga0105240_10044795 3300009093 Bacteria 5617
56 Ga0105240_10300489 3300009093 Bacteria 1836
57 Ga0111539_10294456 3300009094 Archaea 1888
58 Ga0111539_11457977 3300009094 Bacteria 794
59 Ga0105245_10129224 3300009098 Bacteria 2368
60 Ga0105245_10629305 3300009098 Bacteria 1102
61 Ga0105245_11630116 3300009098 Bacteria 697
62 Ga0105243_12373181 3300009148 Unclassified 568
63 Ga0105241_10682906 3300009174 Unclassified 936
64 Ga0105241_12567366 3300009174 Bacteria 511
65 Ga0105242_11112801 3300009176 Bacteria 804
66 Ga0105237_10488617 3300009545 Bacteria 1237
67 Ga0105238_10396302 3300009551 Bacteria 1373
68 Ga0105238_10552547 3300009551 Bacteria 1156
69 Ga0105249_12495339 3300009553 Unclassified 589
70 Ga0105239_10335618 3300010375 Bacteria 1706
71 Ga0157373_10231335 3300013100 Bacteria 1305
72 Ga0157369_11386882 3300013105 Bacteria 715
73 Ga0157374_11753800 3300013296 Unclassified 646
74 Ga0157378_10549242 3300013297 Bacteria 1160
75 Ga0157372_12568758 3300013307 Bacteria 585
76 Ga0163163_12335888 3300014325 Unclassified 593
77 Ga0157380_10187137 3300014326 Bacteria 1825
78 Ga0157380_11627126 3300014326 Unclassified 702
79 Ga0157377_11319918 3300014745 Bacteria 565
80 Ga0163161_11459783 3300017792 Unclassified 599
81 Ga0213876_10226145 3300021384 Bacteria 995
82 Ga0207692_10008852 3300025898 Bacteria 4183
83 Ga0207699_10001241 3300025906 Bacteria 12116
84 Ga0207705_10552254 3300025909 Bacteria 895
85 Ga0207707_10352786 3300025912 Bacteria 1267
86 Ga0207695_10019518 3300025913 Bacteria 7803
87 Ga0207663_10038944 3300025916 Bacteria 2877
88 Ga0207660_10182245 3300025917 Bacteria 1631
89 Ga0207660_10260776 3300025917 Bacteria 1370
90 Ga0207657_10009839 3300025919 Bacteria 9576
91 Ga0207649_10309858 3300025920 Bacteria 1157
92 Ga0207652_10215306 3300025921 Bacteria 1730
93 Ga0207681_11131301 3300025923 Bacteria 658
94 Ga0207700_10024480 3300025928 Bacteria 4178
95 Ga0207664_10013521 3300025929 Bacteria 5862
96 Ga0207690_10106868 3300025932 Bacteria 2009
97 Ga0207706_10014568 3300025933 Bacteria 7124
98 Ga0207669_10066108 3300025937 Bacteria 2247
99 Ga0207665_10014099 3300025939 Bacteria 5259
100 Ga0207665_10288394 3300025939 Bacteria 1223
101 Ga0207667_10005812 3300025949 Bacteria 15044
102 Ga0207667_10379447 3300025949 Bacteria 1440
103 Ga0207667_11956328 3300025949 Bacteria 547
104 Ga0207703_11074298 3300026035 Bacteria 773
105 Ga0207639_10019671 3300026041 Bacteria 4819
106 Ga0207678_10038897 3300026067 Bacteria 4130
107 Ga0207708_10211066 3300026075 Unclassified 1552
108 Ga0207702_10885230 3300026078 Bacteria 884
109 Ga0207702_11568626 3300026078 Bacteria 652
110 Ga0207641_10053590 3300026088 Bacteria 3420
111 Ga0207641_11865211 3300026088 Bacteria 603
112 Ga0207675_100653342 3300026118 Unclassified 1058
113 Ga0207698_10133896 3300026142 Bacteria 2123
114 Ga0209982_1057667 3300027552 Unclassified 630
115 Ga0268266_10032509 3300028379 Bacteria 4432
116 Ga0268266_11679688 3300028379 Unclassified 610
117 Ga0268264_10000187 3300028381 Bacteria 129270
118 Ga0265318_10002067 3300028577 Bacteria 10999
119 Ga0307517_10000102 3300028786 Bacteria 123775
120 Ga0265338_10168960 3300028800 Bacteria 1680
121 Ga0265320_10289157 3300031240 Unclassified 725
122 Ga0265325_10000184 3300031241 Bacteria 44728
123 Ga0265339_10011472 3300031249 Bacteria 5452
124 Ga0265339_10036227 3300031249 Bacteria 2763
125 Ga0265339_10054320 3300031249 Bacteria 2176
126 Ga0265331_10029648 3300031250 Bacteria 2729
127 Ga0265316_10026564 3300031344 Bacteria 4812
128 Ga0265313_10001327 3300031595 Bacteria 23295
129 Ga0265313_10013935 3300031595 Bacteria 4785
130 Ga0265313_10022698 3300031595 Bacteria 3397
131 Ga0265314_10003660 3300031711 Bacteria 14746
132 Ga0265314_10126705 3300031711 Bacteria 1598
133 Ga0265314_10262564 3300031711 Bacteria 985
134 Ga0265342_10000461 3300031712 Bacteria 44177
135 Ga0265342_10065960 3300031712 Bacteria 2121
136 Ga0307516_10101027 3300031730 Bacteria 2700
137 Ga0307413_10705146 3300031824 Unclassified 839
138 Ga0307407_11140040 3300031903 Bacteria 607
139 Ga0307412_10001899 3300031911 Bacteria 11552
140 Ga0307416_100489296 3300032002 Bacteria 1292
141 Ga0307411_11118566 3300032005 Bacteria 711
142 Ga0307415_101883563 3300032126 Bacteria 580
143 Ga0307510_10010837 3300033180 Bacteria 10837
144 Ga0373953_0160602 3300035117 Bacteria 966
145 Ga0373943_0238191 3300035170 Bacteria 1019
146 Ga0373946_0514723 3300035171 Bacteria 615
147 Ga0373955_0178870 3300035172 Bacteria 1258
148 Ga0373935_0107756 3300035692 Bacteria 1845
149 Ga0373927_0077123 3300035695 Bacteria 2158
150 Ga0373927_0088151 3300035695 Bacteria 2014
151 Ga0373933_0168398 3300035724 Bacteria 1394
152 Ga0373937_1158281 3300036401 Bacteria 722
153 Ga0373937_2093935 3300036401 Unclassified 512
154 Ga0395900_0050309 3300037418 Bacteria 4292
155 Ga0395898_0387198 3300037466 Bacteria 1333
156 Ga0395905_0833279 3300037471 Bacteria 825
157 Ga0395901_0179720 3300038443 Bacteria 2219
158 Ga0436365_1621432 3300039437 Unclassified 2259
159 Ga0451793_0419253 3300041452 Bacteria 984
160 Ga0450893_0026629 3300042532 Unclassified 1017
161 Ga0495592_0375498 3300046454 Bacteria 906
162 Ga0495629_0584552 3300046459 Bacteria 748
163 Ga0495638_0023631 3300046460 Bacteria 4017
164 Ga0495638_0256216 3300046460 Bacteria 962
165 Ga0495653_0255568 3300046463 Bacteria 1161
166 Ga0495580_0486990 3300046472 Bacteria 824
167 Ga0495664_0099617 3300046477 Unclassified 1750
168 Ga0495583_0002824 3300046506 Bacteria 14177
169 Ga0495628_0191969 3300046516 Bacteria 1542
170 Ga0495628_0461066 3300046516 Bacteria 922
171 Ga0495630_0396620 3300046517 Bacteria 1057
172 Ga0495648_0030192 3300046524 Bacteria 3588
173 Ga0495640_0802322 3300046533 Bacteria 561
174 Ga0495640_0887512 3300046533 Bacteria 529
175 Ga0495587_0291354 3300046536 Bacteria 914
176 Ga0495587_0297496 3300046536 Bacteria 903
177 Ga0495587_0396892 3300046536 Bacteria 767
178 Ga0495668_0006525 3300046616 Bacteria 7627
179 Ga0495634_0342485 3300046642 Bacteria 896
180 Ga0495611_0244036 3300046648 Bacteria 833
181 Ga0495657_0157632 3300046675 Bacteria 1406
182 Ga0495599_0216267 3300046678 Bacteria 1174
183 Ga0495624_0143242 3300046690 Bacteria 1463
184 Ga0495624_0430273 3300046690 Bacteria 791
185 Ga0495670_0495854 3300046691 Bacteria 663
186 Ga0495600_0469274 3300046809 Bacteria 777
187 Ga0495581_0329981 3300047315 Bacteria 891
188 Ga0495674_0154239 3300047319 Bacteria 1925
189 Ga0495674_0301442 3300047319 Bacteria 1309
190 Ga0495602_0234119 3300048088 Bacteria 1378
191 Ga0495602_0449541 3300048088 Bacteria 910
192 Ga0496102_0723293 3300048905 Bacteria 918
193 Ga0496103_0284002 3300048906 Bacteria 1064
194 Ga0496114_0493648 3300048917 Bacteria 1083
195 Ga0496115_0000646 3300048918 Bacteria 26178
196 Ga0496118_0027451 3300048921 Bacteria 4817
197 Ga0496121_0265303 3300048924 Bacteria 1183
198 Ga0496121_0364484 3300048924 Bacteria 958
199 Ga0496126_0000835 3300048929 Bacteria 54796
200 Ga0496126_0863220 3300048929 Bacteria 689
201 Ga0501031_0615364 3300049568 Bacteria 698
202 Ga0501032_0370451 3300049569 Bacteria 921
203 Ga0501033_0401149 3300049570 Bacteria 956
204 Ga0501033_0565007 3300049570 Bacteria 783
205 Ga0501034_0226437 3300049571 Bacteria 1820
206 Ga0501034_0459482 3300049571 Bacteria 1190
207 Ga0501036_0466422 3300049572 Bacteria 1051
208 Ga0501037_0275369 3300049573 Bacteria 1173
209 Ga0501037_0757690 3300049573 Bacteria 643
210 Ga0501038_0184935 3300049574 Bacteria 1679
211 Ga0501039_0419881 3300049575 Bacteria 1050
212 Ga0501041_0139192 3300049577 Bacteria 1513
213 Ga0501043_0285478 3300049579 Bacteria 1264
214 Ga0501043_0393020 3300049579 Bacteria 1048
215 Ga0501046_0202058 3300049580 Bacteria 1478
216 Ga0501046_0454179 3300049580 Bacteria 921
217 Ga0501047_0302719 3300049581 Bacteria 1441
218 Ga0501047_0535311 3300049581 Bacteria 996
219 Ga0501048_0378708 3300049582 Bacteria 1010
220 Ga0501067_0631440 3300049583 Bacteria 601
221 Ga0501068_0364409 3300049584 Bacteria 930
222 Ga0501069_0284771 3300049585 Bacteria 967
223 Ga0501070_0690100 3300049586 Bacteria 808
224 Ga0501070_1459065 3300049586 Bacteria 518
225 Ga0501071_0442476 3300049587 Bacteria 994
226 Ga0501073_0052536 3300049589 Bacteria 2853
227 Ga0501073_0099906 3300049589 Bacteria 2015
228 Ga0501073_0711762 3300049589 Unclassified 693
229 Ga0501073_0870944 3300049589 Bacteria 620
230 Ga0501074_0246594 3300049590 Bacteria 1270
231 Ga0501074_0260216 3300049590 Bacteria 1234
232 Ga0501075_0058235 3300049591 Bacteria 2910
233 Ga0501075_1501337 3300049591 Bacteria 510
234 Ga0501076_0144322 3300049592 Bacteria 1935
235 Ga0501077_0038653 3300049593 Bacteria 3040
236 Ga0501077_0165543 3300049593 Bacteria 1405
237 Ga0501077_0409293 3300049593 Unclassified 867
238 Ga0501079_0022499 3300049741 Bacteria 4834
239 Ga0501080_0116316 3300049742 Bacteria 2479
240 Ga0501081_0676162 3300049743 Unclassified 774
241 Ga0501083_0211401 3300049744 Bacteria 1264
242 Ga0501035_0068271 3300049822 Bacteria 3152
243 Ga0501035_0499112 3300049822 Bacteria 1002
244 Ga0501044_0589910 3300049823 Bacteria 1005
245 nmdc:mga00v17_239983_c1 3300050491 Bacteria 1175
246 nmdc:mga06z11_4868_c1 3300050494 Bacteria 5321
247 nmdc:mga08y16_300165_c1 3300050511 Bacteria 1655
248 nmdc:mga08y16_452292_c1 3300050511 Archaea 1309
249 Ga0495595_0115995 3300053084 Bacteria 1302
250 Ga0500643_000001 3300053087 Bacteria 1440111
251 Ga0500643_000211 3300053087 Bacteria 54924
252 Ga0500556_0271442 3300053104 Bacteria 666
253 Ga0500562_037612 3300053108 Bacteria 1285
254 Ga0500595_072087 3300053119 Bacteria 1023
255 Ga0500608_002006 3300053122 Bacteria 7293
256 Ga0500614_081986 3300053123 Bacteria 904
257 Ga0500559_0002779 3300053136 Bacteria 8855
258 Ga0500559_0056656 3300053136 Bacteria 1740
259 Ga0500559_0240080 3300053136 Bacteria 854
260 Ga0500573_0117432 3300053140 Bacteria 1484
261 Ga0500636_0324153 3300053177 Bacteria 747
262 Ga0500645_095273 3300053730 Bacteria 842
263 Ga0501084_0171479 3300054114 Bacteria 1831
264 Ga0501084_0599233 3300054114 Bacteria 931
265 Ga0500661_000327 3300055283 Bacteria 8658
266 Ga0501082_0000082 3300060353 Bacteria 71065
267 Ga0501082_0073309 3300060353 Bacteria 2949
268 Ga0501082_0351854 3300060353 Bacteria 1284
269 Ga0265331_10000002
270 Ga0070658_10564987
271 Ga0070658_11388282
272 Ga0070683_100931017
273 Ga0070670_100566924
274 Ga0070670_101841469
275 Ga0070666_10225352
276 Ga0070680_100025803
277 Ga0070680_100265092
278 Ga0070660_100753796
279 Ga0070661_100261175
280 Ga0070661_101875035
281 Ga0070668_100343360
282 Ga0070668_100481388
283 Ga0070675_100781485
284 Ga0070659_100284555
285 Ga0070659_100485957
286 Ga0070667_100900361
287 Ga0070714_100043384
288 Ga0070710_10001242
289 Ga0070711_100001414
290 Ga0070711_100654067
291 Ga0070700_100085493
292 Ga0070681_10154578
293 Ga0070681_10535442
294 Ga0070679_100188606
295 Ga0070679_101422337
296 Ga0068853_100931680
297 Ga0070672_101044805
298 Ga0070665_100230103
299 Ga0070665_100889951
300 Ga0070665_100953841
301 Ga0068855_100165360
302 Ga0068855_100497131
303 Ga0070664_100558117
304 Ga0068856_100343638
305 Ga0068856_101360537
306 Ga0068859_102270951
307 Ga0068870_10607901
308 Ga0068858_101246464
309 Ga0068860_101955892
310 Ga0070717_10119997
311 Ga0075368_10359129
312 Ga0075363_100552867
313 Ga0075364_10274584
314 Ga0070716_100007984
315 Ga0070716_100207646
316 Ga0070712_100047131
317 Ga0075367_10013390
318 Ga0097621_100000103
319 Ga0068871_100000184
320 Ga0068871_100030492
321 Ga0068865_100612770
322 Ga0097620_102272352
323 Ga0105240_10044795
324 Ga0105240_10300489
325 Ga0111539_10294456
326 Ga0111539_11457977
327 Ga0105245_10129224
328 Ga0105245_10629305
329 Ga0105245_11630116
330 Ga0105243_12373181
331 Ga0105241_10682906
332 Ga0105241_12567366
333 Ga0105242_11112801
334 Ga0105237_10488617
335 Ga0105238_10396302
336 Ga0105238_10552547
337 Ga0105249_12495339
338 Ga0105239_10335618
339 Ga0157373_10231335
340 Ga0157369_11386882
341 Ga0157374_11753800
342 Ga0157378_10549242
343 Ga0157372_12568758
344 Ga0163163_12335888
345 Ga0157380_10187137
346 Ga0157380_11627126
347 Ga0157377_11319918
348 Ga0163161_11459783
349 Ga0213876_10226145
350 Ga0207692_10008852
351 Ga0207699_10001241
352 Ga0207705_10552254
353 Ga0207707_10352786
354 Ga0207695_10019518
355 Ga0207663_10038944
356 Ga0207660_10182245
357 Ga0207660_10260776
358 Ga0207657_10009839
359 Ga0207649_10309858
360 Ga0207652_10215306
361 Ga0207681_11131301
362 Ga0207700_10024480
363 Ga0207664_10013521
364 Ga0207690_10106868
365 Ga0207706_10014568
366 Ga0207669_10066108
367 Ga0207665_10014099
368 Ga0207665_10288394
369 Ga0207667_10005812
370 Ga0207667_10379447
371 Ga0207667_11956328
372 Ga0207703_11074298
373 Ga0207639_10019671
374 Ga0207678_10038897
375 Ga0207708_10211066
376 Ga0207702_10885230
377 Ga0207702_11568626
378 Ga0207641_10053590
379 Ga0207641_11865211
380 Ga0207675_100653342
381 Ga0207698_10133896
382 Ga0209982_1057667
383 Ga0268266_10032509
384 Ga0268266_11679688
385 Ga0268264_10000187
386 Ga0265318_10002067
387 Ga0307517_10000102
388 Ga0265338_10168960
389 Ga0265320_10289157
390 Ga0265325_10000184
391 Ga0265339_10011472
392 Ga0265339_10036227
393 Ga0265339_10054320
394 Ga0265331_10029648
395 Ga0265316_10026564
396 Ga0265313_10001327
397 Ga0265313_10013935
398 Ga0265313_10022698
399 Ga0265314_10003660
400 Ga0265314_10126705
401 Ga0265314_10262564
402 Ga0265342_10000461
403 Ga0265342_10065960
404 Ga0307516_10101027
405 Ga0307413_10705146
406 Ga0307407_11140040
407 Ga0307412_10001899
408 Ga0307416_100489296
409 Ga0307411_11118566
410 Ga0307415_101883563
411 Ga0307510_10010837
412 Ga0373953_0160602
413 Ga0373943_0238191
414 Ga0373946_0514723
415 Ga0373955_0178870
416 Ga0373935_0107756
417 Ga0373927_0077123
418 Ga0373927_0088151
419 Ga0373933_0168398
420 Ga0373937_1158281
421 Ga0373937_2093935
422 Ga0395900_0050309
423 Ga0395898_0387198
424 Ga0395905_0833279
425 Ga0395901_0179720
426 Ga0436365_1621432
427 Ga0451793_0419253
428 Ga0450893_0026629
429 Ga0495592_0375498
430 Ga0495629_0584552
431 Ga0495638_0023631
432 Ga0495638_0256216
433 Ga0495653_0255568
434 Ga0495580_0486990
435 Ga0495664_0099617
436 Ga0495583_0002824
437 Ga0495628_0191969
438 Ga0495628_0461066
439 Ga0495630_0396620
440 Ga0495648_0030192
441 Ga0495640_0802322
442 Ga0495640_0887512
443 Ga0495587_0291354
444 Ga0495587_0297496
445 Ga0495587_0396892
446 Ga0495668_0006525
447 Ga0495634_0342485
448 Ga0495611_0244036
449 Ga0495657_0157632
450 Ga0495599_0216267
451 Ga0495624_0143242
452 Ga0495624_0430273
453 Ga0495670_0495854
454 Ga0495600_0469274
455 Ga0495581_0329981
456 Ga0495674_0154239
457 Ga0495674_0301442
458 Ga0495602_0234119
459 Ga0495602_0449541
460 Ga0496102_0723293
461 Ga0496103_0284002
462 Ga0496114_0493648
463 Ga0496115_0000646
464 Ga0496118_0027451
465 Ga0496121_0265303
466 Ga0496121_0364484
467 Ga0496126_0000835
468 Ga0496126_0863220
469 Ga0501031_0615364
470 Ga0501032_0370451
471 Ga0501033_0401149
472 Ga0501033_0565007
473 Ga0501034_0226437
474 Ga0501034_0459482
475 Ga0501036_0466422
476 Ga0501037_0275369
477 Ga0501037_0757690
478 Ga0501038_0184935
479 Ga0501039_0419881
480 Ga0501041_0139192
481 Ga0501043_0285478
482 Ga0501043_0393020
483 Ga0501046_0202058
484 Ga0501046_0454179
485 Ga0501047_0302719
486 Ga0501047_0535311
487 Ga0501048_0378708
488 Ga0501067_0631440
489 Ga0501068_0364409
490 Ga0501069_0284771
491 Ga0501070_0690100
492 Ga0501070_1459065
493 Ga0501071_0442476
494 Ga0501073_0052536
495 Ga0501073_0099906
496 Ga0501073_0711762
497 Ga0501073_0870944
498 Ga0501074_0246594
499 Ga0501074_0260216
500 Ga0501075_0058235
501 Ga0501075_1501337
502 Ga0501076_0144322
503 Ga0501077_0038653
504 Ga0501077_0165543
505 Ga0501077_0409293
506 Ga0501079_0022499
507 Ga0501080_0116316
508 Ga0501081_0676162
509 Ga0501083_0211401
510 Ga0501035_0068271
511 Ga0501035_0499112
512 Ga0501044_0589910
513 nmdc:mga00v17_239983_c1
514 nmdc:mga06z11_4868_c1
515 nmdc:mga08y16_300165_c1
516 nmdc:mga08y16_452292_c1
517 Ga0495595_0115995
518 Ga0500643_000001
519 Ga0500643_000211
520 Ga0500556_0271442
521 Ga0500562_037612
522 Ga0500595_072087
523 Ga0500608_002006
524 Ga0500614_081986
525 Ga0500559_0002779
526 Ga0500559_0056656
527 Ga0500559_0240080
528 Ga0500573_0117432
529 Ga0500636_0324153
530 Ga0500645_095273
531 Ga0501084_0171479
532 Ga0501084_0599233
533 Ga0500661_000327
534 Ga0501082_0000082
535 Ga0501082_0073309
536 Ga0501082_0351854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c5q-assembly1.cif.gz_B crystal structure of yeast yer010cp 0.7287 52 99
8ap6-assembly1.cif.gz_O trypanosoma brucei mitochondrial f1fo atp synthase dimer 0.5762 66 104
6vvo-assembly1.cif.gz_D structure of the human clamp loader (replication factor c, rfc) bound to the sliding clamp (proliferating cell nuclear antigen, pcna) 0.5091 43 103
1pix-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme a decarboxylase 0.4974 65 103
1skv-assembly2.cif.gz_C crystal structure of d-63 from sulfolobus spindle virus 1 0.4751 66 113
ID Description Score Start End Superfamily
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8165 5 108 1.10.10.1740
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7763 5 110 1.10.10.1740
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7656 5 108 1.10.10.1740
af_B3DFT1_26_110_1.10.110.10 Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein;Plant lipid-transfer and hydrophobic proteins 0.7644 63 106 1.10.110.10
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7529 5 110 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A2E6RSZ9-F1-model_v4 DUF3147 family protein 0.9689 1 116 GO:0016020
AF-A0A6N6VJZ1-F1-model_v4 DUF3147 family protein 0.9638 1 116 GO:0016020
AF-A0A3S0R4L8-F1-model_v4 DUF3147 family protein 0.96 1 116 GO:0016020
AF-B0T6A3-F1-model_v4 Peptide ABC transporter permease 0.9595 1 116 GO:0016020
AF-A0A2D8D3J3-F1-model_v4 Peptide ABC transporter permease 0.9589 1 114 GO:0016020

Map