F375605
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 198 | 265 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300031235|Ga0265330_10021217|Ga0265330_100212174 |
| Length | 91 |
| Sequence | MSTTTIRLPEDLKARVAAAAKRSGTTTHGFILEAIAEKEELRADFDAVAEDRYARIVASGKTIPWQEMRGYLEERLAGKAVKRPAARKLAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Metagenome | Rhizosphere |
| 2 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 3 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 4 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 144 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 164 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 167 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 168 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 169 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 170 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 171 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 172 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 173 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 183 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 184 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 185 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 186 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 187 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 197 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 198 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.13 |
| Metatranscriptomes | 0.75 |
| Isolates | 1.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.87 |
| Nodule | 0 |
| Rhizoplane | 1.49 |
| Rhizosphere | 92.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJN_F7QKVOU01BI3V2 | 2088090003 | Unclassified | 531 |
| 2 | rootL2_10203383 | 3300003322 | Bacteria | 1284 |
| 3 | Ga0065715_10895331 | 3300005293 | Bacteria | 576 |
| 4 | Ga0070658_10161558 | 3300005327 | Bacteria | 1879 |
| 5 | Ga0070676_10547880 | 3300005328 | Plasmid | 828 |
| 6 | Ga0070676_11334521 | 3300005328 | Plasmid | 549 |
| 7 | Ga0070683_102255261 | 3300005329 | Bacteria | 522 |
| 8 | Ga0070690_100149680 | 3300005330 | Bacteria | 1591 |
| 9 | Ga0070670_100005301 | 3300005331 | Bacteria | 10873 |
| 10 | Ga0070670_100573013 | 3300005331 | Plasmid | 1008 |
| 11 | Ga0070670_101354184 | 3300005331 | Unclassified | 652 |
| 12 | Ga0070677_10026651 | 3300005333 | Bacteria | 2169 |
| 13 | Ga0070666_10021680 | 3300005335 | Bacteria | 4163 |
| 14 | Ga0070680_100670808 | 3300005336 | Plasmid | 891 |
| 15 | Ga0070682_100450889 | 3300005337 | Bacteria | 985 |
| 16 | Ga0070682_100598535 | 3300005337 | Bacteria | 870 |
| 17 | Ga0068868_100555165 | 3300005338 | Bacteria | 1013 |
| 18 | Ga0068868_101771898 | 3300005338 | Unclassified | 583 |
| 19 | Ga0070660_100153181 | 3300005339 | Bacteria | 1854 |
| 20 | Ga0070689_100137557 | 3300005340 | Plasmid | 1962 |
| 21 | Ga0070689_101488257 | 3300005340 | Bacteria | 613 |
| 22 | Ga0070691_10507031 | 3300005341 | Plasmid | 698 |
| 23 | Ga0070687_100851145 | 3300005343 | Bacteria | 650 |
| 24 | Ga0070661_100616189 | 3300005344 | Bacteria | 878 |
| 25 | Ga0070668_100185240 | 3300005347 | Unclassified | 1702 |
| 26 | Ga0070669_100051598 | 3300005353 | Bacteria | 3007 |
| 27 | Ga0070675_100221859 | 3300005354 | Bacteria | 1646 |
| 28 | Ga0070671_100545637 | 3300005355 | Plasmid | 999 |
| 29 | Ga0070674_100192038 | 3300005356 | Bacteria | 1572 |
| 30 | Ga0070674_100729357 | 3300005356 | Bacteria | 850 |
| 31 | Ga0070673_100299832 | 3300005364 | Bacteria | 1414 |
| 32 | Ga0070688_101583733 | 3300005365 | Unclassified | 534 |
| 33 | Ga0070659_100156449 | 3300005366 | Bacteria | 1862 |
| 34 | Ga0070659_100450941 | 3300005366 | Bacteria | 1091 |
| 35 | Ga0070667_100268811 | 3300005367 | Bacteria | 1528 |
| 36 | Ga0070667_101619984 | 3300005367 | Plasmid | 608 |
| 37 | Ga0070714_101846241 | 3300005435 | Bacteria | 590 |
| 38 | Ga0070701_10050468 | 3300005438 | Bacteria | 2154 |
| 39 | Ga0070700_100036473 | 3300005441 | Bacteria | 2982 |
| 40 | Ga0070700_100214349 | 3300005441 | Bacteria | 1360 |
| 41 | Ga0070694_101887518 | 3300005444 | Unclassified | 510 |
| 42 | Ga0070678_100037896 | 3300005456 | Bacteria | 3389 |
| 43 | Ga0070662_100475111 | 3300005457 | Plasmid | 1040 |
| 44 | Ga0070681_10766530 | 3300005458 | Bacteria | 881 |
| 45 | Ga0068867_100067303 | 3300005459 | Bacteria | 2670 |
| 46 | Ga0068867_100154580 | 3300005459 | Bacteria | 1804 |
| 47 | Ga0068867_100301318 | 3300005459 | Bacteria | 1321 |
| 48 | Ga0070685_10045339 | 3300005466 | Bacteria | 2521 |
| 49 | Ga0070685_10650661 | 3300005466 | Plasmid | 764 |
| 50 | Ga0070706_100380245 | 3300005467 | Bacteria | 1315 |
| 51 | Ga0070679_101004216 | 3300005530 | Plasmid | 778 |
| 52 | Ga0068853_100982090 | 3300005539 | Plasmid | 812 |
| 53 | Ga0070672_100604266 | 3300005543 | Plasmid | 955 |
| 54 | Ga0070672_101161495 | 3300005543 | Bacteria | 687 |
| 55 | Ga0070686_100093139 | 3300005544 | Plasmid | 2020 |
| 56 | Ga0070695_100371330 | 3300005545 | Bacteria | 1077 |
| 57 | Ga0070665_101051199 | 3300005548 | Bacteria | 826 |
| 58 | Ga0070665_101596622 | 3300005548 | Unclassified | 660 |
| 59 | Ga0070664_100317618 | 3300005564 | Bacteria | 1411 |
| 60 | Ga0068857_100402701 | 3300005577 | Bacteria | 1273 |
| 61 | Ga0068854_100038702 | 3300005578 | Bacteria | 3355 |
| 62 | Ga0068854_100968349 | 3300005578 | Bacteria | 751 |
| 63 | Ga0068856_100483992 | 3300005614 | Bacteria | 1258 |
| 64 | Ga0070702_100186091 | 3300005615 | Bacteria | 1363 |
| 65 | Ga0068852_100372462 | 3300005616 | Bacteria | 1399 |
| 66 | Ga0068852_102348159 | 3300005616 | Unclassified | 554 |
| 67 | Ga0068859_100328087 | 3300005617 | Bacteria | 1624 |
| 68 | Ga0068864_100060915 | 3300005618 | Bacteria | 3268 |
| 69 | Ga0068866_10217406 | 3300005718 | Bacteria | 1151 |
| 70 | Ga0068861_101119642 | 3300005719 | Plasmid | 757 |
| 71 | Ga0068851_10153249 | 3300005834 | Bacteria | 1261 |
| 72 | Ga0068870_10355197 | 3300005840 | Plasmid | 941 |
| 73 | Ga0068863_100365434 | 3300005841 | Plasmid | 1407 |
| 74 | Ga0068858_100393015 | 3300005842 | Plasmid | 1332 |
| 75 | Ga0068858_101451938 | 3300005842 | Bacteria | 676 |
| 76 | Ga0068860_100919083 | 3300005843 | Plasmid | 891 |
| 77 | Ga0068862_100236740 | 3300005844 | Bacteria | 1658 |
| 78 | Ga0075364_10010833 | 3300006051 | Bacteria | 5521 |
| 79 | Ga0075366_10818571 | 3300006195 | Plasmid | 579 |
| 80 | Ga0097621_100519642 | 3300006237 | Plasmid | 1080 |
| 81 | Ga0068871_100605817 | 3300006358 | Plasmid | 996 |
| 82 | Ga0068865_100327849 | 3300006881 | Bacteria | 1234 |
| 83 | Ga0068865_101121158 | 3300006881 | Unclassified | 694 |
| 84 | Ga0097620_100328081 | 3300006931 | Bacteria | 1624 |
| 85 | Ga0105251_10000181 | 3300009011 | Bacteria | 63361 |
| 86 | Ga0105240_10144793 | 3300009093 | Bacteria | 2837 |
| 87 | Ga0105240_10989162 | 3300009093 | Bacteria | 900 |
| 88 | Ga0105240_12641486 | 3300009093 | Bacteria | 519 |
| 89 | Ga0111539_10939100 | 3300009094 | Bacteria | 1006 |
| 90 | Ga0105245_10766745 | 3300009098 | Bacteria | 1001 |
| 91 | Ga0105247_10335550 | 3300009101 | Plasmid | 1059 |
| 92 | Ga0105247_11058857 | 3300009101 | Plasmid | 637 |
| 93 | Ga0105247_11858555 | 3300009101 | Unclassified | 503 |
| 94 | Ga0114129_12438572 | 3300009147 | Plasmid | 626 |
| 95 | Ga0105243_10621335 | 3300009148 | Plasmid | 1043 |
| 96 | Ga0105243_10842655 | 3300009148 | Plasmid | 907 |
| 97 | Ga0105241_10111534 | 3300009174 | Bacteria | 2190 |
| 98 | Ga0105241_12293407 | 3300009174 | Unclassified | 537 |
| 99 | Ga0105242_10086157 | 3300009176 | Bacteria | 2636 |
| 100 | Ga0105248_10247767 | 3300009177 | Plasmid | 2005 |
| 101 | Ga0105249_10434875 | 3300009553 | Plasmid | 1348 |
| 102 | Ga0105239_10113331 | 3300010375 | Bacteria | 3007 |
| 103 | Ga0105239_10597084 | 3300010375 | Bacteria | 1259 |
| 104 | Ga0157373_10158661 | 3300013100 | Bacteria | 1591 |
| 105 | Ga0157370_10301591 | 3300013104 | Bacteria | 1479 |
| 106 | Ga0157369_11673737 | 3300013105 | Bacteria | 647 |
| 107 | Ga0157374_10126299 | 3300013296 | Bacteria | 2473 |
| 108 | Ga0157374_10297017 | 3300013296 | Plasmid | 1597 |
| 109 | Ga0157378_10176005 | 3300013297 | Bacteria | 2010 |
| 110 | Ga0157378_10266253 | 3300013297 | Plasmid | 1646 |
| 111 | Ga0157378_11148961 | 3300013297 | Bacteria | 815 |
| 112 | Ga0157378_11238265 | 3300013297 | Bacteria | 786 |
| 113 | Ga0163162_10147818 | 3300013306 | Bacteria | 2467 |
| 114 | Ga0163162_10309580 | 3300013306 | Bacteria | 1712 |
| 115 | Ga0163162_12495474 | 3300013306 | Unclassified | 594 |
| 116 | Ga0157372_10419766 | 3300013307 | Bacteria | 1559 |
| 117 | Ga0157375_11074957 | 3300013308 | Plasmid | 941 |
| 118 | Ga0157375_12443462 | 3300013308 | Unclassified | 624 |
| 119 | Ga0163163_10038952 | 3300014325 | Bacteria | 4636 |
| 120 | Ga0163163_12958011 | 3300014325 | Unclassified | 530 |
| 121 | Ga0157380_10252945 | 3300014326 | Bacteria | 1596 |
| 122 | Ga0157377_10036529 | 3300014745 | Bacteria | 2703 |
| 123 | Ga0157379_10122401 | 3300014968 | Plasmid | 2341 |
| 124 | Ga0157379_12558397 | 3300014968 | Unclassified | 511 |
| 125 | Ga0157376_10195882 | 3300014969 | Bacteria | 1856 |
| 126 | Ga0206353_10366862 | 3300020082 | Bacteria | 713 |
| 127 | Ga0207697_10398634 | 3300025315 | Plasmid | 611 |
| 128 | Ga0207713_1000237 | 3300025735 | Bacteria | 73733 |
| 129 | Ga0207682_10004316 | 3300025893 | Bacteria | 5977 |
| 130 | Ga0207680_10084566 | 3300025903 | Plasmid | 2002 |
| 131 | Ga0207645_10055703 | 3300025907 | Plasmid | 2524 |
| 132 | Ga0207705_10061518 | 3300025909 | Plasmid | 2712 |
| 133 | Ga0207654_10433194 | 3300025911 | Bacteria | 919 |
| 134 | Ga0207707_10657743 | 3300025912 | Bacteria | 883 |
| 135 | Ga0207695_10455265 | 3300025913 | Plasmid | 1163 |
| 136 | Ga0207695_10495808 | 3300025913 | Bacteria | 1103 |
| 137 | Ga0207660_10466539 | 3300025917 | Bacteria | 1022 |
| 138 | Ga0207662_10155201 | 3300025918 | Bacteria | 1459 |
| 139 | Ga0207657_10081485 | 3300025919 | Bacteria | 2718 |
| 140 | Ga0207649_10097853 | 3300025920 | Bacteria | 1935 |
| 141 | Ga0207649_10305855 | 3300025920 | Plasmid | 1164 |
| 142 | Ga0207652_10711844 | 3300025921 | Bacteria | 895 |
| 143 | Ga0207681_10271920 | 3300025923 | Bacteria | 1330 |
| 144 | Ga0207694_10327698 | 3300025924 | Bacteria | 1265 |
| 145 | Ga0207650_10001771 | 3300025925 | Bacteria | 15276 |
| 146 | Ga0207650_10041248 | 3300025925 | Bacteria | 3381 |
| 147 | Ga0207659_10497035 | 3300025926 | Plasmid | 1032 |
| 148 | Ga0207664_11719498 | 3300025929 | Bacteria | 550 |
| 149 | Ga0207690_10531666 | 3300025932 | Bacteria | 954 |
| 150 | Ga0207706_10113414 | 3300025933 | Plasmid | 2384 |
| 151 | Ga0207709_10067824 | 3300025935 | Bacteria | 2253 |
| 152 | Ga0207670_10520634 | 3300025936 | Plasmid | 968 |
| 153 | Ga0207669_10283586 | 3300025937 | Bacteria | 1250 |
| 154 | Ga0207669_10582582 | 3300025937 | Bacteria | 907 |
| 155 | Ga0207704_10332238 | 3300025938 | Bacteria | 1177 |
| 156 | Ga0207691_10598120 | 3300025940 | Plasmid | 934 |
| 157 | Ga0207711_10551396 | 3300025941 | Plasmid | 1075 |
| 158 | Ga0207661_10511056 | 3300025944 | Bacteria | 1098 |
| 159 | Ga0207667_10362054 | 3300025949 | Bacteria | 1479 |
| 160 | Ga0207667_10372013 | 3300025949 | Bacteria | 1456 |
| 161 | Ga0207651_10254486 | 3300025960 | Bacteria | 1438 |
| 162 | Ga0207668_10529317 | 3300025972 | Plasmid | 1018 |
| 163 | Ga0207640_10018335 | 3300025981 | Bacteria | 4112 |
| 164 | Ga0207658_10347587 | 3300025986 | Bacteria | 1290 |
| 165 | Ga0207658_11380983 | 3300025986 | Unclassified | 644 |
| 166 | Ga0207677_10558204 | 3300026023 | Plasmid | 999 |
| 167 | Ga0207677_11543399 | 3300026023 | Unclassified | 614 |
| 168 | Ga0207703_10340512 | 3300026035 | Plasmid | 1378 |
| 169 | Ga0207639_10220044 | 3300026041 | Bacteria | 1639 |
| 170 | Ga0207708_10221970 | 3300026075 | Plasmid | 1514 |
| 171 | Ga0207702_10133408 | 3300026078 | Bacteria | 2237 |
| 172 | Ga0207641_10452179 | 3300026088 | Plasmid | 1241 |
| 173 | Ga0207648_10245558 | 3300026089 | Bacteria | 1595 |
| 174 | Ga0207648_10325640 | 3300026089 | Bacteria | 1382 |
| 175 | Ga0207648_11111696 | 3300026089 | Plasmid | 741 |
| 176 | Ga0207676_10663399 | 3300026095 | Plasmid | 1007 |
| 177 | Ga0207674_10712240 | 3300026116 | Bacteria | 969 |
| 178 | Ga0207675_100283177 | 3300026118 | Plasmid | 1611 |
| 179 | Ga0207683_10195306 | 3300026121 | Bacteria | 1838 |
| 180 | Ga0207698_10062697 | 3300026142 | Bacteria | 2905 |
| 181 | Ga0207698_10893615 | 3300026142 | Bacteria | 895 |
| 182 | Ga0268266_10564348 | 3300028379 | Bacteria | 1091 |
| 183 | Ga0268266_11087435 | 3300028379 | Bacteria | 774 |
| 184 | Ga0268265_10279947 | 3300028380 | Unclassified | 1492 |
| 185 | Ga0268265_12065304 | 3300028380 | Plasmid | 577 |
| 186 | Ga0268264_10109841 | 3300028381 | Plasmid | 2413 |
| 187 | Ga0307515_10018830 | 3300028794 | Bacteria | 12464 |
| 188 | Ga0265324_10037534 | 3300029957 | Bacteria | 1683 |
| 189 | Ga0265324_10128886 | 3300029957 | Bacteria | 859 |
| 190 | Ga0265330_10021217 | 3300031235 | Bacteria | 2967 |
| 191 | Ga0265331_10019353 | 3300031250 | Bacteria | 3516 |
| 192 | Ga0265331_10577609 | 3300031250 | Bacteria | 507 |
| 193 | Ga0265327_10000203 | 3300031251 | Bacteria | 124148 |
| 194 | Ga0265327_10344795 | 3300031251 | Bacteria | 651 |
| 195 | Ga0265316_10209764 | 3300031344 | Bacteria | 1441 |
| 196 | Ga0265316_10925264 | 3300031344 | Bacteria | 608 |
| 197 | Ga0307408_101637885 | 3300031548 | Unclassified | 612 |
| 198 | Ga0265314_10339102 | 3300031711 | Bacteria | 830 |
| 199 | Ga0265314_10376122 | 3300031711 | Bacteria | 774 |
| 200 | Ga0307413_10485774 | 3300031824 | Plasmid | 988 |
| 201 | Ga0307412_10768953 | 3300031911 | Bacteria | 833 |
| 202 | Ga0307416_103173664 | 3300032002 | Bacteria | 550 |
| 203 | Ga0307414_10004905 | 3300032004 | Bacteria | 7313 |
| 204 | Ga0307414_10058920 | 3300032004 | Bacteria | 2708 |
| 205 | Ga0307414_10101941 | 3300032004 | Bacteria | 2162 |
| 206 | Ga0373940_0092492 | 3300035088 | Plasmid | 908 |
| 207 | Ga0373960_0077765 | 3300035121 | Bacteria | 1038 |
| 208 | Ga0373962_0325472 | 3300035242 | Unclassified | 550 |
| 209 | Ga0373931_0620342 | 3300035691 | Plasmid | 708 |
| 210 | Ga0395899_0471713 | 3300037312 | Bacteria | 819 |
| 211 | Ga0395899_0677706 | 3300037312 | Plasmid | 649 |
| 212 | Ga0395900_0073053 | 3300037418 | Bacteria | 3526 |
| 213 | Ga0395905_0218180 | 3300037471 | Bacteria | 1786 |
| 214 | Ga0395905_0736047 | 3300037471 | Bacteria | 888 |
| 215 | Ga0395901_0558666 | 3300038443 | Bacteria | 1159 |
| 216 | Ga0395901_1328643 | 3300038443 | Bacteria | 680 |
| 217 | Ga0439465_0038851 | 3300041413 | Bacteria | 1534 |
| 218 | Ga0451797_0362118 | 3300041453 | Bacteria | 1455 |
| 219 | Ga0451797_0765185 | 3300041453 | Bacteria | 709 |
| 220 | Ga0451797_1053132 | 3300041453 | Plasmid | 542 |
| 221 | Ga0451807_1347270 | 3300041486 | Plasmid | 749 |
| 222 | Ga0451843_0087035 | 3300041509 | Bacteria | 527 |
| 223 | Ga0451853_2535432 | 3300041512 | Plasmid | 522 |
| 224 | Ga0439433_0050751 | 3300041999 | Bacteria | 978 |
| 225 | Ga0439449_0017669 | 3300042007 | Bacteria | 2678 |
| 226 | Ga0451577_0006084 | 3300042876 | Bacteria | 12133 |
| 227 | Ga0451577_0096782 | 3300042876 | Bacteria | 2635 |
| 228 | Ga0451577_0113512 | 3300042876 | Bacteria | 2425 |
| 229 | Ga0451577_0699691 | 3300042876 | Plasmid | 918 |
| 230 | Ga0453684_0006093 | 3300044712 | Bacteria | 23253 |
| 231 | Ga0453684_1375055 | 3300044712 | Plasmid | 733 |
| 232 | Ga0453684_1754958 | 3300044712 | Plasmid | 632 |
| 233 | Ga0451576_0103830 | 3300045051 | Bacteria | 2956 |
| 234 | Ga0451576_2031888 | 3300045051 | Plasmid | 592 |
| 235 | Ga0495617_016421 | 3300046452 | Bacteria | 2503 |
| 236 | Ga0495638_0311488 | 3300046460 | Bacteria | 844 |
| 237 | Ga0495585_0089742 | 3300046492 | Bacteria | 1656 |
| 238 | Ga0495607_0056728 | 3300046501 | Bacteria | 2247 |
| 239 | Ga0495656_0569368 | 3300046615 | Bacteria | 605 |
| 240 | Ga0495656_0631608 | 3300046615 | Plasmid | 574 |
| 241 | Ga0495611_0098035 | 3300046648 | Bacteria | 1359 |
| 242 | Ga0495669_0163873 | 3300046684 | Bacteria | 1056 |
| 243 | Ga0495676_0507513 | 3300047321 | Plasmid | 791 |
| 244 | Ga0495673_0264738 | 3300047469 | Plasmid | 624 |
| 245 | Ga0496116_0486585 | 3300048919 | Bacteria | 517 |
| 246 | Ga0496117_0321699 | 3300048920 | Bacteria | 810 |
| 247 | Ga0496118_0015689 | 3300048921 | Bacteria | 6996 |
| 248 | Ga0496118_0025104 | 3300048921 | Bacteria | 5121 |
| 249 | Ga0496122_0001224 | 3300048925 | Bacteria | 43437 |
| 250 | Ga0496123_0000993 | 3300048926 | Bacteria | 43586 |
| 251 | Ga0501037_0414268 | 3300049573 | Plasmid | 923 |
| 252 | Ga0501039_0014135 | 3300049575 | Bacteria | 6112 |
| 253 | Ga0501041_0109443 | 3300049577 | Bacteria | 1714 |
| 254 | Ga0501048_0481125 | 3300049582 | Plasmid | 890 |
| 255 | Ga0501048_0683967 | 3300049582 | Bacteria | 737 |
| 256 | Ga0501071_0569928 | 3300049587 | Bacteria | 870 |
| 257 | Ga0501071_0871768 | 3300049587 | Plasmid | 694 |
| 258 | Ga0501072_1214531 | 3300049588 | Plasmid | 585 |
| 259 | Ga0501076_0929503 | 3300049592 | Bacteria | 717 |
| 260 | Ga0501080_0784949 | 3300049742 | Plasmid | 836 |
| 261 | Ga0501081_0478914 | 3300049743 | Bacteria | 926 |
| 262 | nmdc:mga00v17_421910_c1 | 3300050491 | Bacteria | 867 |
| 263 | nmdc:mga00v17_48630_c1 | 3300050491 | Bacteria | 2571 |
| 264 | nmdc:mga0k408_69411_c2 | 3300050493 | Plasmid | 593 |
| 265 | Ga0587079_234166 | 3300059647 | Bacteria | 516 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2842780639 | 2842783644 | 90 |
| 2 | iso_pu_bacteria | 2919130084 | 2919130277 | 90 |
| 3 | iso_pu_bacteria | 2929195423 | 2929198728 | 90 |
| 4 | 3300031235 | Ga0265330_10021217 | Ga0265330_100212174 | 91 |
| 5 | 3300005444 | Ga0070694_101887518 | Ga0070694_1018875181 | 92 |
| 6 | 3300025949 | Ga0207667_10362054 | Ga0207667_103620542 | 92 |
| 7 | 3300037312 | Ga0395899_0471713 | Ga0395899_0471713_226_504 | 92 |
| 8 | 3300037418 | Ga0395900_0073053 | Ga0395900_0073053_2949_3227 | 92 |
| 9 | 3300037471 | Ga0395905_0736047 | Ga0395905_0736047_448_726 | 92 |
| 10 | 3300038443 | Ga0395901_0558666 | Ga0395901_0558666_690_968 | 92 |
| 11 | 2088090003 | LJN_F7QKVOU01BI3V2 | LJN_00746280 | 94 |
| 12 | 3300003322 | rootL2_10203383 | rootL2_102033833 | 94 |
| 13 | 3300005293 | Ga0065715_10895331 | Ga0065715_108953311 | 94 |
| 14 | 3300005327 | Ga0070658_10161558 | Ga0070658_101615584 | 94 |
| 15 | 3300005328 | Ga0070676_10547880 | Ga0070676_105478801 | 94 |
| 16 | 3300005328 | Ga0070676_11334521 | Ga0070676_113345211 | 94 |
| 17 | 3300005329 | Ga0070683_102255261 | Ga0070683_1022552611 | 94 |
| 18 | 3300005330 | Ga0070690_100149680 | Ga0070690_1001496803 | 94 |
| 19 | 3300005331 | Ga0070670_100005301 | Ga0070670_1000053016 | 94 |
| 20 | 3300005331 | Ga0070670_100573013 | Ga0070670_1005730133 | 94 |
| 21 | 3300005331 | Ga0070670_101354184 | Ga0070670_1013541841 | 94 |
| 22 | 3300005333 | Ga0070677_10026651 | Ga0070677_100266513 | 94 |
| 23 | 3300005335 | Ga0070666_10021680 | Ga0070666_100216807 | 94 |
| 24 | 3300005336 | Ga0070680_100670808 | Ga0070680_1006708082 | 94 |
| 25 | 3300005337 | Ga0070682_100450889 | Ga0070682_1004508892 | 94 |
| 26 | 3300005337 | Ga0070682_100598535 | Ga0070682_1005985351 | 94 |
| 27 | 3300005338 | Ga0068868_100555165 | Ga0068868_1005551651 | 94 |
| 28 | 3300005338 | Ga0068868_101771898 | Ga0068868_1017718981 | 94 |
| 29 | 3300005339 | Ga0070660_100153181 | Ga0070660_1001531812 | 94 |
| 30 | 3300005340 | Ga0070689_100137557 | Ga0070689_1001375575 | 94 |
| 31 | 3300005340 | Ga0070689_101488257 | Ga0070689_1014882572 | 94 |
| 32 | 3300005341 | Ga0070691_10507031 | Ga0070691_105070311 | 94 |
| 33 | 3300005343 | Ga0070687_100851145 | Ga0070687_1008511452 | 94 |
| 34 | 3300005344 | Ga0070661_100616189 | Ga0070661_1006161892 | 94 |
| 35 | 3300005347 | Ga0070668_100185240 | Ga0070668_1001852402 | 94 |
| 36 | 3300005353 | Ga0070669_100051598 | Ga0070669_1000515983 | 94 |
| 37 | 3300005354 | Ga0070675_100221859 | Ga0070675_1002218594 | 94 |
| 38 | 3300005355 | Ga0070671_100545637 | Ga0070671_1005456372 | 94 |
| 39 | 3300005356 | Ga0070674_100192038 | Ga0070674_1001920381 | 94 |
| 40 | 3300005356 | Ga0070674_100729357 | Ga0070674_1007293571 | 94 |
| 41 | 3300005364 | Ga0070673_100299832 | Ga0070673_1002998321 | 94 |
| 42 | 3300005365 | Ga0070688_101583733 | Ga0070688_1015837331 | 94 |
| 43 | 3300005366 | Ga0070659_100156449 | Ga0070659_1001564491 | 94 |
| 44 | 3300005366 | Ga0070659_100450941 | Ga0070659_1004509412 | 94 |
| 45 | 3300005367 | Ga0070667_100268811 | Ga0070667_1002688113 | 94 |
| 46 | 3300005367 | Ga0070667_101619984 | Ga0070667_1016199841 | 94 |
| 47 | 3300005435 | Ga0070714_101846241 | Ga0070714_1018462412 | 94 |
| 48 | 3300005438 | Ga0070701_10050468 | Ga0070701_100504683 | 94 |
| 49 | 3300005441 | Ga0070700_100036473 | Ga0070700_1000364734 | 94 |
| 50 | 3300005441 | Ga0070700_100214349 | Ga0070700_1002143493 | 94 |
| 51 | 3300005456 | Ga0070678_100037896 | Ga0070678_1000378966 | 94 |
| 52 | 3300005457 | Ga0070662_100475111 | Ga0070662_1004751111 | 94 |
| 53 | 3300005458 | Ga0070681_10766530 | Ga0070681_107665302 | 94 |
| 54 | 3300005459 | Ga0068867_100067303 | Ga0068867_1000673033 | 94 |
| 55 | 3300005459 | Ga0068867_100154580 | Ga0068867_1001545802 | 94 |
| 56 | 3300005459 | Ga0068867_100301318 | Ga0068867_1003013184 | 94 |
| 57 | 3300005466 | Ga0070685_10045339 | Ga0070685_100453392 | 94 |
| 58 | 3300005466 | Ga0070685_10650661 | Ga0070685_106506611 | 94 |
| 59 | 3300005467 | Ga0070706_100380245 | Ga0070706_1003802452 | 94 |
| 60 | 3300005530 | Ga0070679_101004216 | Ga0070679_1010042161 | 94 |
| 61 | 3300005539 | Ga0068853_100982090 | Ga0068853_1009820902 | 94 |
| 62 | 3300005543 | Ga0070672_100604266 | Ga0070672_1006042662 | 94 |
| 63 | 3300005543 | Ga0070672_101161495 | Ga0070672_1011614952 | 94 |
| 64 | 3300005544 | Ga0070686_100093139 | Ga0070686_1000931391 | 94 |
| 65 | 3300005545 | Ga0070695_100371330 | Ga0070695_1003713303 | 94 |
| 66 | 3300005548 | Ga0070665_101051199 | Ga0070665_1010511992 | 94 |
| 67 | 3300005548 | Ga0070665_101596622 | Ga0070665_1015966222 | 94 |
| 68 | 3300005564 | Ga0070664_100317618 | Ga0070664_1003176181 | 94 |
| 69 | 3300005577 | Ga0068857_100402701 | Ga0068857_1004027013 | 94 |
| 70 | 3300005578 | Ga0068854_100038702 | Ga0068854_1000387023 | 94 |
| 71 | 3300005578 | Ga0068854_100968349 | Ga0068854_1009683491 | 94 |
| 72 | 3300005614 | Ga0068856_100483992 | Ga0068856_1004839922 | 94 |
| 73 | 3300005615 | Ga0070702_100186091 | Ga0070702_1001860913 | 94 |
| 74 | 3300005616 | Ga0068852_100372462 | Ga0068852_1003724623 | 94 |
| 75 | 3300005616 | Ga0068852_102348159 | Ga0068852_1023481591 | 94 |
| 76 | 3300005617 | Ga0068859_100328087 | Ga0068859_1003280873 | 94 |
| 77 | 3300005618 | Ga0068864_100060915 | Ga0068864_1000609152 | 94 |
| 78 | 3300005718 | Ga0068866_10217406 | Ga0068866_102174063 | 94 |
| 79 | 3300005719 | Ga0068861_101119642 | Ga0068861_1011196422 | 94 |
| 80 | 3300005834 | Ga0068851_10153249 | Ga0068851_101532492 | 94 |
| 81 | 3300005840 | Ga0068870_10355197 | Ga0068870_103551972 | 94 |
| 82 | 3300005841 | Ga0068863_100365434 | Ga0068863_1003654343 | 94 |
| 83 | 3300005842 | Ga0068858_100393015 | Ga0068858_1003930151 | 94 |
| 84 | 3300005842 | Ga0068858_101451938 | Ga0068858_1014519382 | 94 |
| 85 | 3300005843 | Ga0068860_100919083 | Ga0068860_1009190831 | 94 |
| 86 | 3300005844 | Ga0068862_100236740 | Ga0068862_1002367403 | 94 |
| 87 | 3300006051 | Ga0075364_10010833 | Ga0075364_100108333 | 94 |
| 88 | 3300006195 | Ga0075366_10818571 | Ga0075366_108185712 | 94 |
| 89 | 3300006237 | Ga0097621_100519642 | Ga0097621_1005196422 | 94 |
| 90 | 3300006358 | Ga0068871_100605817 | Ga0068871_1006058173 | 94 |
| 91 | 3300006881 | Ga0068865_100327849 | Ga0068865_1003278491 | 94 |
| 92 | 3300006881 | Ga0068865_101121158 | Ga0068865_1011211581 | 94 |
| 93 | 3300006931 | Ga0097620_100328081 | Ga0097620_1003280811 | 94 |
| 94 | 3300009011 | Ga0105251_10000181 | Ga0105251_100001815 | 94 |
| 95 | 3300009093 | Ga0105240_10144793 | Ga0105240_101447934 | 94 |
| 96 | 3300009093 | Ga0105240_10989162 | Ga0105240_109891621 | 94 |
| 97 | 3300009093 | Ga0105240_12641486 | Ga0105240_126414861 | 94 |
| 98 | 3300009094 | Ga0111539_10939100 | Ga0111539_109391002 | 94 |
| 99 | 3300009098 | Ga0105245_10766745 | Ga0105245_107667453 | 94 |
| 100 | 3300009101 | Ga0105247_10335550 | Ga0105247_103355502 | 94 |
| 101 | 3300009101 | Ga0105247_11058857 | Ga0105247_110588572 | 94 |
| 102 | 3300009101 | Ga0105247_11858555 | Ga0105247_118585551 | 94 |
| 103 | 3300009147 | Ga0114129_12438572 | Ga0114129_124385722 | 94 |
| 104 | 3300009148 | Ga0105243_10621335 | Ga0105243_106213351 | 94 |
| 105 | 3300009148 | Ga0105243_10842655 | Ga0105243_108426552 | 94 |
| 106 | 3300009174 | Ga0105241_10111534 | Ga0105241_101115342 | 94 |
| 107 | 3300009174 | Ga0105241_12293407 | Ga0105241_122934071 | 94 |
| 108 | 3300009176 | Ga0105242_10086157 | Ga0105242_100861572 | 94 |
| 109 | 3300009177 | Ga0105248_10247767 | Ga0105248_102477672 | 94 |
| 110 | 3300009553 | Ga0105249_10434875 | Ga0105249_104348753 | 94 |
| 111 | 3300010375 | Ga0105239_10113331 | Ga0105239_101133314 | 94 |
| 112 | 3300010375 | Ga0105239_10597084 | Ga0105239_105970841 | 94 |
| 113 | 3300013100 | Ga0157373_10158661 | Ga0157373_101586613 | 94 |
| 114 | 3300013104 | Ga0157370_10301591 | Ga0157370_103015912 | 94 |
| 115 | 3300013105 | Ga0157369_11673737 | Ga0157369_116737371 | 94 |
| 116 | 3300013296 | Ga0157374_10126299 | Ga0157374_101262991 | 94 |
| 117 | 3300013296 | Ga0157374_10297017 | Ga0157374_102970173 | 94 |
| 118 | 3300013297 | Ga0157378_10176005 | Ga0157378_101760053 | 94 |
| 119 | 3300013297 | Ga0157378_10266253 | Ga0157378_102662532 | 94 |
| 120 | 3300013297 | Ga0157378_11148961 | Ga0157378_111489612 | 94 |
| 121 | 3300013297 | Ga0157378_11238265 | Ga0157378_112382652 | 94 |
| 122 | 3300013306 | Ga0163162_10147818 | Ga0163162_101478181 | 94 |
| 123 | 3300013306 | Ga0163162_10309580 | Ga0163162_103095801 | 94 |
| 124 | 3300013306 | Ga0163162_12495474 | Ga0163162_124954742 | 94 |
| 125 | 3300013307 | Ga0157372_10419766 | Ga0157372_104197663 | 94 |
| 126 | 3300013308 | Ga0157375_11074957 | Ga0157375_110749572 | 94 |
| 127 | 3300013308 | Ga0157375_12443462 | Ga0157375_124434621 | 94 |
| 128 | 3300014325 | Ga0163163_10038952 | Ga0163163_100389523 | 94 |
| 129 | 3300014325 | Ga0163163_12958011 | Ga0163163_129580111 | 94 |
| 130 | 3300014326 | Ga0157380_10252945 | Ga0157380_102529454 | 94 |
| 131 | 3300014745 | Ga0157377_10036529 | Ga0157377_100365293 | 94 |
| 132 | 3300014968 | Ga0157379_10122401 | Ga0157379_101224012 | 94 |
| 133 | 3300014968 | Ga0157379_12558397 | Ga0157379_125583972 | 94 |
| 134 | 3300014969 | Ga0157376_10195882 | Ga0157376_101958822 | 94 |
| 135 | 3300020082 | Ga0206353_10366862 | Ga0206353_103668622 | 94 |
| 136 | 3300025315 | Ga0207697_10398634 | Ga0207697_103986341 | 94 |
| 137 | 3300025735 | Ga0207713_1000237 | Ga0207713_100023754 | 94 |
| 138 | 3300025893 | Ga0207682_10004316 | Ga0207682_100043166 | 94 |
| 139 | 3300025903 | Ga0207680_10084566 | Ga0207680_100845662 | 94 |
| 140 | 3300025907 | Ga0207645_10055703 | Ga0207645_100557033 | 94 |
| 141 | 3300025909 | Ga0207705_10061518 | Ga0207705_100615183 | 94 |
| 142 | 3300025911 | Ga0207654_10433194 | Ga0207654_104331941 | 94 |
| 143 | 3300025912 | Ga0207707_10657743 | Ga0207707_106577433 | 94 |
| 144 | 3300025913 | Ga0207695_10455265 | Ga0207695_104552652 | 94 |
| 145 | 3300025913 | Ga0207695_10495808 | Ga0207695_104958081 | 94 |
| 146 | 3300025917 | Ga0207660_10466539 | Ga0207660_104665392 | 94 |
| 147 | 3300025918 | Ga0207662_10155201 | Ga0207662_101552012 | 94 |
| 148 | 3300025919 | Ga0207657_10081485 | Ga0207657_100814852 | 94 |
| 149 | 3300025920 | Ga0207649_10097853 | Ga0207649_100978533 | 94 |
| 150 | 3300025920 | Ga0207649_10305855 | Ga0207649_103058552 | 94 |
| 151 | 3300025921 | Ga0207652_10711844 | Ga0207652_107118443 | 94 |
| 152 | 3300025923 | Ga0207681_10271920 | Ga0207681_102719203 | 94 |
| 153 | 3300025924 | Ga0207694_10327698 | Ga0207694_103276982 | 94 |
| 154 | 3300025925 | Ga0207650_10001771 | Ga0207650_100017716 | 94 |
| 155 | 3300025925 | Ga0207650_10041248 | Ga0207650_100412481 | 94 |
| 156 | 3300025926 | Ga0207659_10497035 | Ga0207659_104970351 | 94 |
| 157 | 3300025929 | Ga0207664_11719498 | Ga0207664_117194981 | 94 |
| 158 | 3300025932 | Ga0207690_10531666 | Ga0207690_105316662 | 94 |
| 159 | 3300025933 | Ga0207706_10113414 | Ga0207706_101134142 | 94 |
| 160 | 3300025935 | Ga0207709_10067824 | Ga0207709_100678243 | 94 |
| 161 | 3300025936 | Ga0207670_10520634 | Ga0207670_105206341 | 94 |
| 162 | 3300025937 | Ga0207669_10283586 | Ga0207669_102835861 | 94 |
| 163 | 3300025937 | Ga0207669_10582582 | Ga0207669_105825822 | 94 |
| 164 | 3300025938 | Ga0207704_10332238 | Ga0207704_103322381 | 94 |
| 165 | 3300025940 | Ga0207691_10598120 | Ga0207691_105981201 | 94 |
| 166 | 3300025941 | Ga0207711_10551396 | Ga0207711_105513962 | 94 |
| 167 | 3300025944 | Ga0207661_10511056 | Ga0207661_105110562 | 94 |
| 168 | 3300025949 | Ga0207667_10372013 | Ga0207667_103720133 | 94 |
| 169 | 3300025960 | Ga0207651_10254486 | Ga0207651_102544863 | 94 |
| 170 | 3300025972 | Ga0207668_10529317 | Ga0207668_105293171 | 94 |
| 171 | 3300025981 | Ga0207640_10018335 | Ga0207640_100183353 | 94 |
| 172 | 3300025986 | Ga0207658_10347587 | Ga0207658_103475873 | 94 |
| 173 | 3300025986 | Ga0207658_11380983 | Ga0207658_113809831 | 94 |
| 174 | 3300026023 | Ga0207677_10558204 | Ga0207677_105582042 | 94 |
| 175 | 3300026023 | Ga0207677_11543399 | Ga0207677_115433991 | 94 |
| 176 | 3300026035 | Ga0207703_10340512 | Ga0207703_103405122 | 94 |
| 177 | 3300026041 | Ga0207639_10220044 | Ga0207639_102200441 | 94 |
| 178 | 3300026075 | Ga0207708_10221970 | Ga0207708_102219701 | 94 |
| 179 | 3300026078 | Ga0207702_10133408 | Ga0207702_101334084 | 94 |
| 180 | 3300026088 | Ga0207641_10452179 | Ga0207641_104521793 | 94 |
| 181 | 3300026089 | Ga0207648_10245558 | Ga0207648_102455583 | 94 |
| 182 | 3300026089 | Ga0207648_10325640 | Ga0207648_103256402 | 94 |
| 183 | 3300026089 | Ga0207648_11111696 | Ga0207648_111116961 | 94 |
| 184 | 3300026095 | Ga0207676_10663399 | Ga0207676_106633992 | 94 |
| 185 | 3300026116 | Ga0207674_10712240 | Ga0207674_107122403 | 94 |
| 186 | 3300026118 | Ga0207675_100283177 | Ga0207675_1002831772 | 94 |
| 187 | 3300026121 | Ga0207683_10195306 | Ga0207683_101953062 | 94 |
| 188 | 3300026142 | Ga0207698_10062697 | Ga0207698_100626973 | 94 |
| 189 | 3300026142 | Ga0207698_10893615 | Ga0207698_108936153 | 94 |
| 190 | 3300028379 | Ga0268266_10564348 | Ga0268266_105643481 | 94 |
| 191 | 3300028379 | Ga0268266_11087435 | Ga0268266_110874352 | 94 |
| 192 | 3300028380 | Ga0268265_10279947 | Ga0268265_102799472 | 94 |
| 193 | 3300028380 | Ga0268265_12065304 | Ga0268265_120653042 | 94 |
| 194 | 3300028381 | Ga0268264_10109841 | Ga0268264_101098411 | 94 |
| 195 | 3300028794 | Ga0307515_10018830 | Ga0307515_1001883015 | 94 |
| 196 | 3300029957 | Ga0265324_10037534 | Ga0265324_100375342 | 94 |
| 197 | 3300029957 | Ga0265324_10128886 | Ga0265324_101288862 | 94 |
| 198 | 3300031250 | Ga0265331_10019353 | Ga0265331_100193533 | 94 |
| 199 | 3300031250 | Ga0265331_10577609 | Ga0265331_105776092 | 94 |
| 200 | 3300031251 | Ga0265327_10000203 | Ga0265327_1000020366 | 94 |
| 201 | 3300031251 | Ga0265327_10344795 | Ga0265327_103447952 | 94 |
| 202 | 3300031344 | Ga0265316_10209764 | Ga0265316_102097642 | 94 |
| 203 | 3300031344 | Ga0265316_10925264 | Ga0265316_109252642 | 94 |
| 204 | 3300031548 | Ga0307408_101637885 | Ga0307408_1016378851 | 94 |
| 205 | 3300031711 | Ga0265314_10339102 | Ga0265314_103391022 | 94 |
| 206 | 3300031711 | Ga0265314_10376122 | Ga0265314_103761223 | 94 |
| 207 | 3300031824 | Ga0307413_10485774 | Ga0307413_104857742 | 94 |
| 208 | 3300031911 | Ga0307412_10768953 | Ga0307412_107689533 | 94 |
| 209 | 3300032002 | Ga0307416_103173664 | Ga0307416_1031736641 | 94 |
| 210 | 3300032004 | Ga0307414_10004905 | Ga0307414_100049056 | 94 |
| 211 | 3300032004 | Ga0307414_10058920 | Ga0307414_100589202 | 94 |
| 212 | 3300032004 | Ga0307414_10101941 | Ga0307414_101019413 | 94 |
| 213 | 3300035088 | Ga0373940_0092492 | Ga0373940_0092492_522_806 | 94 |
| 214 | 3300035121 | Ga0373960_0077765 | Ga0373960_0077765_316_600 | 94 |
| 215 | 3300035242 | Ga0373962_0325472 | Ga0373962_0325472_178_462 | 94 |
| 216 | 3300035691 | Ga0373931_0620342 | Ga0373931_0620342_408_692 | 94 |
| 217 | 3300037312 | Ga0395899_0677706 | Ga0395899_0677706_326_610 | 94 |
| 218 | 3300037471 | Ga0395905_0218180 | Ga0395905_0218180_1367_1651 | 94 |
| 219 | 3300038443 | Ga0395901_1328643 | Ga0395901_1328643_273_557 | 94 |
| 220 | 3300041413 | Ga0439465_0038851 | Ga0439465_0038851_448_732 | 94 |
| 221 | 3300041453 | Ga0451797_0362118 | Ga0451797_0362118_534_818 | 94 |
| 222 | 3300041453 | Ga0451797_0765185 | Ga0451797_0765185_46_330 | 94 |
| 223 | 3300041453 | Ga0451797_1053132 | Ga0451797_1053132_156_446 | 94 |
| 224 | 3300041486 | Ga0451807_1347270 | Ga0451807_1347270_208_492 | 94 |
| 225 | 3300041509 | Ga0451843_0087035 | Ga0451843_0087035_20_304 | 94 |
| 226 | 3300041512 | Ga0451853_2535432 | Ga0451853_2535432_146_466 | 94 |
| 227 | 3300041999 | Ga0439433_0050751 | Ga0439433_0050751_680_964 | 94 |
| 228 | 3300042007 | Ga0439449_0017669 | Ga0439449_0017669_374_658 | 94 |
| 229 | 3300042876 | Ga0451577_0006084 | Ga0451577_0006084_2900_3187 | 94 |
| 230 | 3300042876 | Ga0451577_0096782 | Ga0451577_0096782_1456_1740 | 94 |
| 231 | 3300042876 | Ga0451577_0113512 | Ga0451577_0113512_100_387 | 94 |
| 232 | 3300042876 | Ga0451577_0699691 | Ga0451577_0699691_533_817 | 94 |
| 233 | 3300044712 | Ga0453684_0006093 | Ga0453684_0006093_4030_4314 | 94 |
| 234 | 3300044712 | Ga0453684_1375055 | Ga0453684_1375055_158_445 | 94 |
| 235 | 3300044712 | Ga0453684_1754958 | Ga0453684_1754958_192_476 | 94 |
| 236 | 3300045051 | Ga0451576_0103830 | Ga0451576_0103830_259_546 | 94 |
| 237 | 3300045051 | Ga0451576_2031888 | Ga0451576_2031888_178_462 | 94 |
| 238 | 3300046452 | Ga0495617_016421 | Ga0495617_016421_1625_1909 | 94 |
| 239 | 3300046460 | Ga0495638_0311488 | Ga0495638_0311488_133_417 | 94 |
| 240 | 3300046492 | Ga0495585_0089742 | Ga0495585_0089742_609_893 | 94 |
| 241 | 3300046501 | Ga0495607_0056728 | Ga0495607_0056728_1211_1495 | 94 |
| 242 | 3300046615 | Ga0495656_0569368 | Ga0495656_0569368_18_302 | 94 |
| 243 | 3300046615 | Ga0495656_0631608 | Ga0495656_0631608_149_433 | 94 |
| 244 | 3300046648 | Ga0495611_0098035 | Ga0495611_0098035_487_771 | 94 |
| 245 | 3300046684 | Ga0495669_0163873 | Ga0495669_0163873_667_951 | 94 |
| 246 | 3300047321 | Ga0495676_0507513 | Ga0495676_0507513_354_638 | 94 |
| 247 | 3300047469 | Ga0495673_0264738 | Ga0495673_0264738_138_422 | 94 |
| 248 | 3300048919 | Ga0496116_0486585 | Ga0496116_0486585_170_454 | 94 |
| 249 | 3300048920 | Ga0496117_0321699 | Ga0496117_0321699_63_347 | 94 |
| 250 | 3300048921 | Ga0496118_0015689 | Ga0496118_0015689_3052_3336 | 94 |
| 251 | 3300048921 | Ga0496118_0025104 | Ga0496118_0025104_4334_4618 | 94 |
| 252 | 3300048925 | Ga0496122_0001224 | Ga0496122_0001224_9453_9737 | 94 |
| 253 | 3300048926 | Ga0496123_0000993 | Ga0496123_0000993_9603_9887 | 94 |
| 254 | 3300049573 | Ga0501037_0414268 | Ga0501037_0414268_389_673 | 94 |
| 255 | 3300049575 | Ga0501039_0014135 | Ga0501039_0014135_3303_3587 | 94 |
| 256 | 3300049577 | Ga0501041_0109443 | Ga0501041_0109443_1126_1410 | 94 |
| 257 | 3300049582 | Ga0501048_0481125 | Ga0501048_0481125_485_769 | 94 |
| 258 | 3300049582 | Ga0501048_0683967 | Ga0501048_0683967_298_582 | 94 |
| 259 | 3300049587 | Ga0501071_0569928 | Ga0501071_0569928_405_689 | 94 |
| 260 | 3300049587 | Ga0501071_0871768 | Ga0501071_0871768_341_625 | 94 |
| 261 | 3300049588 | Ga0501072_1214531 | Ga0501072_1214531_92_376 | 94 |
| 262 | 3300049592 | Ga0501076_0929503 | Ga0501076_0929503_100_384 | 94 |
| 263 | 3300049742 | Ga0501080_0784949 | Ga0501080_0784949_94_378 | 94 |
| 264 | 3300049743 | Ga0501081_0478914 | Ga0501081_0478914_501_785 | 94 |
| 265 | 3300050491 | nmdc:mga00v17_421910_c1 | nmdc:mga00v17_421910_c1_133_417 | 94 |
| 266 | 3300050491 | nmdc:mga00v17_48630_c1 | nmdc:mga00v17_48630_c1_526_810 | 94 |
| 267 | 3300050493 | nmdc:mga0k408_69411_c2 | nmdc:mga0k408_69411_c2_228_515 | 94 |
| 268 | 3300059647 | Ga0587079_234166 | Ga0587079_234166_99_383 | 94 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gpe-assembly1.cif.gz_A | structure of the dna-binding domain of e. coli proline utilization a (puta) | 0.9564 | 1 | 41 |
| 1u9p-assembly1.cif.gz_A | permuted single-chain arc | 0.9527 | 6 | 42 |
| 2ay0-assembly3.cif.gz_E | structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain. | 0.9484 | 1 | 41 |
| 2ay0-assembly2.cif.gz_C | structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain. | 0.9416 | 1 | 41 |
| 6ajm-assembly1.cif.gz_E | crystal structure of apo atatr | 0.9392 | 1 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ba3B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.9773 | 9 | 35 | 1.10.1220.10 |
| af_O07227_9_73_1.10.1220.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.9619 | 8 | 39 | 1.10.1220.10 |
| 2ba3A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.955 | 9 | 35 | 1.10.1220.10 |
| 1u9pA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.9527 | 6 | 42 | 1.10.1220.10 |
| 1q5vA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like | 0.933 | 1 | 44 | 1.10.1220.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A9T6M9-F1-model_v4 | Ribbon-helix-helix protein, CopG family | 0.972 | 1 | 38 |
|
| AF-A0A1G7ZD28-F1-model_v4 | HicB family protein | 0.9613 | 1 | 49 |
|
| AF-A0A2N1VFF9-F1-model_v4 | Arc family DNA binding domain-containing protein | 0.9573 | 1 | 42 |
GO:0006355
|
| AF-A0A1W6MR18-F1-model_v4 | Toxin-antitoxin system HicB family antitoxin | 0.9558 | 1 | 41 |
GO:0006355
|
| AF-A0A3D4K7T9-F1-model_v4 | Antitoxin | 0.9553 | 1 | 38 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar