F375605

General Info

Members Datasets Scaffolds Average Seq Length
268 198 265 94

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10021217|Ga0265330_100212174
Length 91
Sequence MSTTTIRLPEDLKARVAAAAKRSGTTTHGFILEAIAEKEELRADFDAVAEDRYARIVASGKTIPWQEMRGYLEERLAGKAVKRPAARKLAR

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
3 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
4 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0.75
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0
Rhizoplane 1.49
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F7QKVOU01BI3V2 2088090003 Unclassified 531
2 rootL2_10203383 3300003322 Bacteria 1284
3 Ga0065715_10895331 3300005293 Bacteria 576
4 Ga0070658_10161558 3300005327 Bacteria 1879
5 Ga0070676_10547880 3300005328 Plasmid 828
6 Ga0070676_11334521 3300005328 Plasmid 549
7 Ga0070683_102255261 3300005329 Bacteria 522
8 Ga0070690_100149680 3300005330 Bacteria 1591
9 Ga0070670_100005301 3300005331 Bacteria 10873
10 Ga0070670_100573013 3300005331 Plasmid 1008
11 Ga0070670_101354184 3300005331 Unclassified 652
12 Ga0070677_10026651 3300005333 Bacteria 2169
13 Ga0070666_10021680 3300005335 Bacteria 4163
14 Ga0070680_100670808 3300005336 Plasmid 891
15 Ga0070682_100450889 3300005337 Bacteria 985
16 Ga0070682_100598535 3300005337 Bacteria 870
17 Ga0068868_100555165 3300005338 Bacteria 1013
18 Ga0068868_101771898 3300005338 Unclassified 583
19 Ga0070660_100153181 3300005339 Bacteria 1854
20 Ga0070689_100137557 3300005340 Plasmid 1962
21 Ga0070689_101488257 3300005340 Bacteria 613
22 Ga0070691_10507031 3300005341 Plasmid 698
23 Ga0070687_100851145 3300005343 Bacteria 650
24 Ga0070661_100616189 3300005344 Bacteria 878
25 Ga0070668_100185240 3300005347 Unclassified 1702
26 Ga0070669_100051598 3300005353 Bacteria 3007
27 Ga0070675_100221859 3300005354 Bacteria 1646
28 Ga0070671_100545637 3300005355 Plasmid 999
29 Ga0070674_100192038 3300005356 Bacteria 1572
30 Ga0070674_100729357 3300005356 Bacteria 850
31 Ga0070673_100299832 3300005364 Bacteria 1414
32 Ga0070688_101583733 3300005365 Unclassified 534
33 Ga0070659_100156449 3300005366 Bacteria 1862
34 Ga0070659_100450941 3300005366 Bacteria 1091
35 Ga0070667_100268811 3300005367 Bacteria 1528
36 Ga0070667_101619984 3300005367 Plasmid 608
37 Ga0070714_101846241 3300005435 Bacteria 590
38 Ga0070701_10050468 3300005438 Bacteria 2154
39 Ga0070700_100036473 3300005441 Bacteria 2982
40 Ga0070700_100214349 3300005441 Bacteria 1360
41 Ga0070694_101887518 3300005444 Unclassified 510
42 Ga0070678_100037896 3300005456 Bacteria 3389
43 Ga0070662_100475111 3300005457 Plasmid 1040
44 Ga0070681_10766530 3300005458 Bacteria 881
45 Ga0068867_100067303 3300005459 Bacteria 2670
46 Ga0068867_100154580 3300005459 Bacteria 1804
47 Ga0068867_100301318 3300005459 Bacteria 1321
48 Ga0070685_10045339 3300005466 Bacteria 2521
49 Ga0070685_10650661 3300005466 Plasmid 764
50 Ga0070706_100380245 3300005467 Bacteria 1315
51 Ga0070679_101004216 3300005530 Plasmid 778
52 Ga0068853_100982090 3300005539 Plasmid 812
53 Ga0070672_100604266 3300005543 Plasmid 955
54 Ga0070672_101161495 3300005543 Bacteria 687
55 Ga0070686_100093139 3300005544 Plasmid 2020
56 Ga0070695_100371330 3300005545 Bacteria 1077
57 Ga0070665_101051199 3300005548 Bacteria 826
58 Ga0070665_101596622 3300005548 Unclassified 660
59 Ga0070664_100317618 3300005564 Bacteria 1411
60 Ga0068857_100402701 3300005577 Bacteria 1273
61 Ga0068854_100038702 3300005578 Bacteria 3355
62 Ga0068854_100968349 3300005578 Bacteria 751
63 Ga0068856_100483992 3300005614 Bacteria 1258
64 Ga0070702_100186091 3300005615 Bacteria 1363
65 Ga0068852_100372462 3300005616 Bacteria 1399
66 Ga0068852_102348159 3300005616 Unclassified 554
67 Ga0068859_100328087 3300005617 Bacteria 1624
68 Ga0068864_100060915 3300005618 Bacteria 3268
69 Ga0068866_10217406 3300005718 Bacteria 1151
70 Ga0068861_101119642 3300005719 Plasmid 757
71 Ga0068851_10153249 3300005834 Bacteria 1261
72 Ga0068870_10355197 3300005840 Plasmid 941
73 Ga0068863_100365434 3300005841 Plasmid 1407
74 Ga0068858_100393015 3300005842 Plasmid 1332
75 Ga0068858_101451938 3300005842 Bacteria 676
76 Ga0068860_100919083 3300005843 Plasmid 891
77 Ga0068862_100236740 3300005844 Bacteria 1658
78 Ga0075364_10010833 3300006051 Bacteria 5521
79 Ga0075366_10818571 3300006195 Plasmid 579
80 Ga0097621_100519642 3300006237 Plasmid 1080
81 Ga0068871_100605817 3300006358 Plasmid 996
82 Ga0068865_100327849 3300006881 Bacteria 1234
83 Ga0068865_101121158 3300006881 Unclassified 694
84 Ga0097620_100328081 3300006931 Bacteria 1624
85 Ga0105251_10000181 3300009011 Bacteria 63361
86 Ga0105240_10144793 3300009093 Bacteria 2837
87 Ga0105240_10989162 3300009093 Bacteria 900
88 Ga0105240_12641486 3300009093 Bacteria 519
89 Ga0111539_10939100 3300009094 Bacteria 1006
90 Ga0105245_10766745 3300009098 Bacteria 1001
91 Ga0105247_10335550 3300009101 Plasmid 1059
92 Ga0105247_11058857 3300009101 Plasmid 637
93 Ga0105247_11858555 3300009101 Unclassified 503
94 Ga0114129_12438572 3300009147 Plasmid 626
95 Ga0105243_10621335 3300009148 Plasmid 1043
96 Ga0105243_10842655 3300009148 Plasmid 907
97 Ga0105241_10111534 3300009174 Bacteria 2190
98 Ga0105241_12293407 3300009174 Unclassified 537
99 Ga0105242_10086157 3300009176 Bacteria 2636
100 Ga0105248_10247767 3300009177 Plasmid 2005
101 Ga0105249_10434875 3300009553 Plasmid 1348
102 Ga0105239_10113331 3300010375 Bacteria 3007
103 Ga0105239_10597084 3300010375 Bacteria 1259
104 Ga0157373_10158661 3300013100 Bacteria 1591
105 Ga0157370_10301591 3300013104 Bacteria 1479
106 Ga0157369_11673737 3300013105 Bacteria 647
107 Ga0157374_10126299 3300013296 Bacteria 2473
108 Ga0157374_10297017 3300013296 Plasmid 1597
109 Ga0157378_10176005 3300013297 Bacteria 2010
110 Ga0157378_10266253 3300013297 Plasmid 1646
111 Ga0157378_11148961 3300013297 Bacteria 815
112 Ga0157378_11238265 3300013297 Bacteria 786
113 Ga0163162_10147818 3300013306 Bacteria 2467
114 Ga0163162_10309580 3300013306 Bacteria 1712
115 Ga0163162_12495474 3300013306 Unclassified 594
116 Ga0157372_10419766 3300013307 Bacteria 1559
117 Ga0157375_11074957 3300013308 Plasmid 941
118 Ga0157375_12443462 3300013308 Unclassified 624
119 Ga0163163_10038952 3300014325 Bacteria 4636
120 Ga0163163_12958011 3300014325 Unclassified 530
121 Ga0157380_10252945 3300014326 Bacteria 1596
122 Ga0157377_10036529 3300014745 Bacteria 2703
123 Ga0157379_10122401 3300014968 Plasmid 2341
124 Ga0157379_12558397 3300014968 Unclassified 511
125 Ga0157376_10195882 3300014969 Bacteria 1856
126 Ga0206353_10366862 3300020082 Bacteria 713
127 Ga0207697_10398634 3300025315 Plasmid 611
128 Ga0207713_1000237 3300025735 Bacteria 73733
129 Ga0207682_10004316 3300025893 Bacteria 5977
130 Ga0207680_10084566 3300025903 Plasmid 2002
131 Ga0207645_10055703 3300025907 Plasmid 2524
132 Ga0207705_10061518 3300025909 Plasmid 2712
133 Ga0207654_10433194 3300025911 Bacteria 919
134 Ga0207707_10657743 3300025912 Bacteria 883
135 Ga0207695_10455265 3300025913 Plasmid 1163
136 Ga0207695_10495808 3300025913 Bacteria 1103
137 Ga0207660_10466539 3300025917 Bacteria 1022
138 Ga0207662_10155201 3300025918 Bacteria 1459
139 Ga0207657_10081485 3300025919 Bacteria 2718
140 Ga0207649_10097853 3300025920 Bacteria 1935
141 Ga0207649_10305855 3300025920 Plasmid 1164
142 Ga0207652_10711844 3300025921 Bacteria 895
143 Ga0207681_10271920 3300025923 Bacteria 1330
144 Ga0207694_10327698 3300025924 Bacteria 1265
145 Ga0207650_10001771 3300025925 Bacteria 15276
146 Ga0207650_10041248 3300025925 Bacteria 3381
147 Ga0207659_10497035 3300025926 Plasmid 1032
148 Ga0207664_11719498 3300025929 Bacteria 550
149 Ga0207690_10531666 3300025932 Bacteria 954
150 Ga0207706_10113414 3300025933 Plasmid 2384
151 Ga0207709_10067824 3300025935 Bacteria 2253
152 Ga0207670_10520634 3300025936 Plasmid 968
153 Ga0207669_10283586 3300025937 Bacteria 1250
154 Ga0207669_10582582 3300025937 Bacteria 907
155 Ga0207704_10332238 3300025938 Bacteria 1177
156 Ga0207691_10598120 3300025940 Plasmid 934
157 Ga0207711_10551396 3300025941 Plasmid 1075
158 Ga0207661_10511056 3300025944 Bacteria 1098
159 Ga0207667_10362054 3300025949 Bacteria 1479
160 Ga0207667_10372013 3300025949 Bacteria 1456
161 Ga0207651_10254486 3300025960 Bacteria 1438
162 Ga0207668_10529317 3300025972 Plasmid 1018
163 Ga0207640_10018335 3300025981 Bacteria 4112
164 Ga0207658_10347587 3300025986 Bacteria 1290
165 Ga0207658_11380983 3300025986 Unclassified 644
166 Ga0207677_10558204 3300026023 Plasmid 999
167 Ga0207677_11543399 3300026023 Unclassified 614
168 Ga0207703_10340512 3300026035 Plasmid 1378
169 Ga0207639_10220044 3300026041 Bacteria 1639
170 Ga0207708_10221970 3300026075 Plasmid 1514
171 Ga0207702_10133408 3300026078 Bacteria 2237
172 Ga0207641_10452179 3300026088 Plasmid 1241
173 Ga0207648_10245558 3300026089 Bacteria 1595
174 Ga0207648_10325640 3300026089 Bacteria 1382
175 Ga0207648_11111696 3300026089 Plasmid 741
176 Ga0207676_10663399 3300026095 Plasmid 1007
177 Ga0207674_10712240 3300026116 Bacteria 969
178 Ga0207675_100283177 3300026118 Plasmid 1611
179 Ga0207683_10195306 3300026121 Bacteria 1838
180 Ga0207698_10062697 3300026142 Bacteria 2905
181 Ga0207698_10893615 3300026142 Bacteria 895
182 Ga0268266_10564348 3300028379 Bacteria 1091
183 Ga0268266_11087435 3300028379 Bacteria 774
184 Ga0268265_10279947 3300028380 Unclassified 1492
185 Ga0268265_12065304 3300028380 Plasmid 577
186 Ga0268264_10109841 3300028381 Plasmid 2413
187 Ga0307515_10018830 3300028794 Bacteria 12464
188 Ga0265324_10037534 3300029957 Bacteria 1683
189 Ga0265324_10128886 3300029957 Bacteria 859
190 Ga0265330_10021217 3300031235 Bacteria 2967
191 Ga0265331_10019353 3300031250 Bacteria 3516
192 Ga0265331_10577609 3300031250 Bacteria 507
193 Ga0265327_10000203 3300031251 Bacteria 124148
194 Ga0265327_10344795 3300031251 Bacteria 651
195 Ga0265316_10209764 3300031344 Bacteria 1441
196 Ga0265316_10925264 3300031344 Bacteria 608
197 Ga0307408_101637885 3300031548 Unclassified 612
198 Ga0265314_10339102 3300031711 Bacteria 830
199 Ga0265314_10376122 3300031711 Bacteria 774
200 Ga0307413_10485774 3300031824 Plasmid 988
201 Ga0307412_10768953 3300031911 Bacteria 833
202 Ga0307416_103173664 3300032002 Bacteria 550
203 Ga0307414_10004905 3300032004 Bacteria 7313
204 Ga0307414_10058920 3300032004 Bacteria 2708
205 Ga0307414_10101941 3300032004 Bacteria 2162
206 Ga0373940_0092492 3300035088 Plasmid 908
207 Ga0373960_0077765 3300035121 Bacteria 1038
208 Ga0373962_0325472 3300035242 Unclassified 550
209 Ga0373931_0620342 3300035691 Plasmid 708
210 Ga0395899_0471713 3300037312 Bacteria 819
211 Ga0395899_0677706 3300037312 Plasmid 649
212 Ga0395900_0073053 3300037418 Bacteria 3526
213 Ga0395905_0218180 3300037471 Bacteria 1786
214 Ga0395905_0736047 3300037471 Bacteria 888
215 Ga0395901_0558666 3300038443 Bacteria 1159
216 Ga0395901_1328643 3300038443 Bacteria 680
217 Ga0439465_0038851 3300041413 Bacteria 1534
218 Ga0451797_0362118 3300041453 Bacteria 1455
219 Ga0451797_0765185 3300041453 Bacteria 709
220 Ga0451797_1053132 3300041453 Plasmid 542
221 Ga0451807_1347270 3300041486 Plasmid 749
222 Ga0451843_0087035 3300041509 Bacteria 527
223 Ga0451853_2535432 3300041512 Plasmid 522
224 Ga0439433_0050751 3300041999 Bacteria 978
225 Ga0439449_0017669 3300042007 Bacteria 2678
226 Ga0451577_0006084 3300042876 Bacteria 12133
227 Ga0451577_0096782 3300042876 Bacteria 2635
228 Ga0451577_0113512 3300042876 Bacteria 2425
229 Ga0451577_0699691 3300042876 Plasmid 918
230 Ga0453684_0006093 3300044712 Bacteria 23253
231 Ga0453684_1375055 3300044712 Plasmid 733
232 Ga0453684_1754958 3300044712 Plasmid 632
233 Ga0451576_0103830 3300045051 Bacteria 2956
234 Ga0451576_2031888 3300045051 Plasmid 592
235 Ga0495617_016421 3300046452 Bacteria 2503
236 Ga0495638_0311488 3300046460 Bacteria 844
237 Ga0495585_0089742 3300046492 Bacteria 1656
238 Ga0495607_0056728 3300046501 Bacteria 2247
239 Ga0495656_0569368 3300046615 Bacteria 605
240 Ga0495656_0631608 3300046615 Plasmid 574
241 Ga0495611_0098035 3300046648 Bacteria 1359
242 Ga0495669_0163873 3300046684 Bacteria 1056
243 Ga0495676_0507513 3300047321 Plasmid 791
244 Ga0495673_0264738 3300047469 Plasmid 624
245 Ga0496116_0486585 3300048919 Bacteria 517
246 Ga0496117_0321699 3300048920 Bacteria 810
247 Ga0496118_0015689 3300048921 Bacteria 6996
248 Ga0496118_0025104 3300048921 Bacteria 5121
249 Ga0496122_0001224 3300048925 Bacteria 43437
250 Ga0496123_0000993 3300048926 Bacteria 43586
251 Ga0501037_0414268 3300049573 Plasmid 923
252 Ga0501039_0014135 3300049575 Bacteria 6112
253 Ga0501041_0109443 3300049577 Bacteria 1714
254 Ga0501048_0481125 3300049582 Plasmid 890
255 Ga0501048_0683967 3300049582 Bacteria 737
256 Ga0501071_0569928 3300049587 Bacteria 870
257 Ga0501071_0871768 3300049587 Plasmid 694
258 Ga0501072_1214531 3300049588 Plasmid 585
259 Ga0501076_0929503 3300049592 Bacteria 717
260 Ga0501080_0784949 3300049742 Plasmid 836
261 Ga0501081_0478914 3300049743 Bacteria 926
262 nmdc:mga00v17_421910_c1 3300050491 Bacteria 867
263 nmdc:mga00v17_48630_c1 3300050491 Bacteria 2571
264 nmdc:mga0k408_69411_c2 3300050493 Plasmid 593
265 Ga0587079_234166 3300059647 Bacteria 516

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2842780639 2842783644 90
2 iso_pu_bacteria 2919130084 2919130277 90
3 iso_pu_bacteria 2929195423 2929198728 90
4 3300031235 Ga0265330_10021217 Ga0265330_100212174 91
5 3300005444 Ga0070694_101887518 Ga0070694_1018875181 92
6 3300025949 Ga0207667_10362054 Ga0207667_103620542 92
7 3300037312 Ga0395899_0471713 Ga0395899_0471713_226_504 92
8 3300037418 Ga0395900_0073053 Ga0395900_0073053_2949_3227 92
9 3300037471 Ga0395905_0736047 Ga0395905_0736047_448_726 92
10 3300038443 Ga0395901_0558666 Ga0395901_0558666_690_968 92
11 2088090003 LJN_F7QKVOU01BI3V2 LJN_00746280 94
12 3300003322 rootL2_10203383 rootL2_102033833 94
13 3300005293 Ga0065715_10895331 Ga0065715_108953311 94
14 3300005327 Ga0070658_10161558 Ga0070658_101615584 94
15 3300005328 Ga0070676_10547880 Ga0070676_105478801 94
16 3300005328 Ga0070676_11334521 Ga0070676_113345211 94
17 3300005329 Ga0070683_102255261 Ga0070683_1022552611 94
18 3300005330 Ga0070690_100149680 Ga0070690_1001496803 94
19 3300005331 Ga0070670_100005301 Ga0070670_1000053016 94
20 3300005331 Ga0070670_100573013 Ga0070670_1005730133 94
21 3300005331 Ga0070670_101354184 Ga0070670_1013541841 94
22 3300005333 Ga0070677_10026651 Ga0070677_100266513 94
23 3300005335 Ga0070666_10021680 Ga0070666_100216807 94
24 3300005336 Ga0070680_100670808 Ga0070680_1006708082 94
25 3300005337 Ga0070682_100450889 Ga0070682_1004508892 94
26 3300005337 Ga0070682_100598535 Ga0070682_1005985351 94
27 3300005338 Ga0068868_100555165 Ga0068868_1005551651 94
28 3300005338 Ga0068868_101771898 Ga0068868_1017718981 94
29 3300005339 Ga0070660_100153181 Ga0070660_1001531812 94
30 3300005340 Ga0070689_100137557 Ga0070689_1001375575 94
31 3300005340 Ga0070689_101488257 Ga0070689_1014882572 94
32 3300005341 Ga0070691_10507031 Ga0070691_105070311 94
33 3300005343 Ga0070687_100851145 Ga0070687_1008511452 94
34 3300005344 Ga0070661_100616189 Ga0070661_1006161892 94
35 3300005347 Ga0070668_100185240 Ga0070668_1001852402 94
36 3300005353 Ga0070669_100051598 Ga0070669_1000515983 94
37 3300005354 Ga0070675_100221859 Ga0070675_1002218594 94
38 3300005355 Ga0070671_100545637 Ga0070671_1005456372 94
39 3300005356 Ga0070674_100192038 Ga0070674_1001920381 94
40 3300005356 Ga0070674_100729357 Ga0070674_1007293571 94
41 3300005364 Ga0070673_100299832 Ga0070673_1002998321 94
42 3300005365 Ga0070688_101583733 Ga0070688_1015837331 94
43 3300005366 Ga0070659_100156449 Ga0070659_1001564491 94
44 3300005366 Ga0070659_100450941 Ga0070659_1004509412 94
45 3300005367 Ga0070667_100268811 Ga0070667_1002688113 94
46 3300005367 Ga0070667_101619984 Ga0070667_1016199841 94
47 3300005435 Ga0070714_101846241 Ga0070714_1018462412 94
48 3300005438 Ga0070701_10050468 Ga0070701_100504683 94
49 3300005441 Ga0070700_100036473 Ga0070700_1000364734 94
50 3300005441 Ga0070700_100214349 Ga0070700_1002143493 94
51 3300005456 Ga0070678_100037896 Ga0070678_1000378966 94
52 3300005457 Ga0070662_100475111 Ga0070662_1004751111 94
53 3300005458 Ga0070681_10766530 Ga0070681_107665302 94
54 3300005459 Ga0068867_100067303 Ga0068867_1000673033 94
55 3300005459 Ga0068867_100154580 Ga0068867_1001545802 94
56 3300005459 Ga0068867_100301318 Ga0068867_1003013184 94
57 3300005466 Ga0070685_10045339 Ga0070685_100453392 94
58 3300005466 Ga0070685_10650661 Ga0070685_106506611 94
59 3300005467 Ga0070706_100380245 Ga0070706_1003802452 94
60 3300005530 Ga0070679_101004216 Ga0070679_1010042161 94
61 3300005539 Ga0068853_100982090 Ga0068853_1009820902 94
62 3300005543 Ga0070672_100604266 Ga0070672_1006042662 94
63 3300005543 Ga0070672_101161495 Ga0070672_1011614952 94
64 3300005544 Ga0070686_100093139 Ga0070686_1000931391 94
65 3300005545 Ga0070695_100371330 Ga0070695_1003713303 94
66 3300005548 Ga0070665_101051199 Ga0070665_1010511992 94
67 3300005548 Ga0070665_101596622 Ga0070665_1015966222 94
68 3300005564 Ga0070664_100317618 Ga0070664_1003176181 94
69 3300005577 Ga0068857_100402701 Ga0068857_1004027013 94
70 3300005578 Ga0068854_100038702 Ga0068854_1000387023 94
71 3300005578 Ga0068854_100968349 Ga0068854_1009683491 94
72 3300005614 Ga0068856_100483992 Ga0068856_1004839922 94
73 3300005615 Ga0070702_100186091 Ga0070702_1001860913 94
74 3300005616 Ga0068852_100372462 Ga0068852_1003724623 94
75 3300005616 Ga0068852_102348159 Ga0068852_1023481591 94
76 3300005617 Ga0068859_100328087 Ga0068859_1003280873 94
77 3300005618 Ga0068864_100060915 Ga0068864_1000609152 94
78 3300005718 Ga0068866_10217406 Ga0068866_102174063 94
79 3300005719 Ga0068861_101119642 Ga0068861_1011196422 94
80 3300005834 Ga0068851_10153249 Ga0068851_101532492 94
81 3300005840 Ga0068870_10355197 Ga0068870_103551972 94
82 3300005841 Ga0068863_100365434 Ga0068863_1003654343 94
83 3300005842 Ga0068858_100393015 Ga0068858_1003930151 94
84 3300005842 Ga0068858_101451938 Ga0068858_1014519382 94
85 3300005843 Ga0068860_100919083 Ga0068860_1009190831 94
86 3300005844 Ga0068862_100236740 Ga0068862_1002367403 94
87 3300006051 Ga0075364_10010833 Ga0075364_100108333 94
88 3300006195 Ga0075366_10818571 Ga0075366_108185712 94
89 3300006237 Ga0097621_100519642 Ga0097621_1005196422 94
90 3300006358 Ga0068871_100605817 Ga0068871_1006058173 94
91 3300006881 Ga0068865_100327849 Ga0068865_1003278491 94
92 3300006881 Ga0068865_101121158 Ga0068865_1011211581 94
93 3300006931 Ga0097620_100328081 Ga0097620_1003280811 94
94 3300009011 Ga0105251_10000181 Ga0105251_100001815 94
95 3300009093 Ga0105240_10144793 Ga0105240_101447934 94
96 3300009093 Ga0105240_10989162 Ga0105240_109891621 94
97 3300009093 Ga0105240_12641486 Ga0105240_126414861 94
98 3300009094 Ga0111539_10939100 Ga0111539_109391002 94
99 3300009098 Ga0105245_10766745 Ga0105245_107667453 94
100 3300009101 Ga0105247_10335550 Ga0105247_103355502 94
101 3300009101 Ga0105247_11058857 Ga0105247_110588572 94
102 3300009101 Ga0105247_11858555 Ga0105247_118585551 94
103 3300009147 Ga0114129_12438572 Ga0114129_124385722 94
104 3300009148 Ga0105243_10621335 Ga0105243_106213351 94
105 3300009148 Ga0105243_10842655 Ga0105243_108426552 94
106 3300009174 Ga0105241_10111534 Ga0105241_101115342 94
107 3300009174 Ga0105241_12293407 Ga0105241_122934071 94
108 3300009176 Ga0105242_10086157 Ga0105242_100861572 94
109 3300009177 Ga0105248_10247767 Ga0105248_102477672 94
110 3300009553 Ga0105249_10434875 Ga0105249_104348753 94
111 3300010375 Ga0105239_10113331 Ga0105239_101133314 94
112 3300010375 Ga0105239_10597084 Ga0105239_105970841 94
113 3300013100 Ga0157373_10158661 Ga0157373_101586613 94
114 3300013104 Ga0157370_10301591 Ga0157370_103015912 94
115 3300013105 Ga0157369_11673737 Ga0157369_116737371 94
116 3300013296 Ga0157374_10126299 Ga0157374_101262991 94
117 3300013296 Ga0157374_10297017 Ga0157374_102970173 94
118 3300013297 Ga0157378_10176005 Ga0157378_101760053 94
119 3300013297 Ga0157378_10266253 Ga0157378_102662532 94
120 3300013297 Ga0157378_11148961 Ga0157378_111489612 94
121 3300013297 Ga0157378_11238265 Ga0157378_112382652 94
122 3300013306 Ga0163162_10147818 Ga0163162_101478181 94
123 3300013306 Ga0163162_10309580 Ga0163162_103095801 94
124 3300013306 Ga0163162_12495474 Ga0163162_124954742 94
125 3300013307 Ga0157372_10419766 Ga0157372_104197663 94
126 3300013308 Ga0157375_11074957 Ga0157375_110749572 94
127 3300013308 Ga0157375_12443462 Ga0157375_124434621 94
128 3300014325 Ga0163163_10038952 Ga0163163_100389523 94
129 3300014325 Ga0163163_12958011 Ga0163163_129580111 94
130 3300014326 Ga0157380_10252945 Ga0157380_102529454 94
131 3300014745 Ga0157377_10036529 Ga0157377_100365293 94
132 3300014968 Ga0157379_10122401 Ga0157379_101224012 94
133 3300014968 Ga0157379_12558397 Ga0157379_125583972 94
134 3300014969 Ga0157376_10195882 Ga0157376_101958822 94
135 3300020082 Ga0206353_10366862 Ga0206353_103668622 94
136 3300025315 Ga0207697_10398634 Ga0207697_103986341 94
137 3300025735 Ga0207713_1000237 Ga0207713_100023754 94
138 3300025893 Ga0207682_10004316 Ga0207682_100043166 94
139 3300025903 Ga0207680_10084566 Ga0207680_100845662 94
140 3300025907 Ga0207645_10055703 Ga0207645_100557033 94
141 3300025909 Ga0207705_10061518 Ga0207705_100615183 94
142 3300025911 Ga0207654_10433194 Ga0207654_104331941 94
143 3300025912 Ga0207707_10657743 Ga0207707_106577433 94
144 3300025913 Ga0207695_10455265 Ga0207695_104552652 94
145 3300025913 Ga0207695_10495808 Ga0207695_104958081 94
146 3300025917 Ga0207660_10466539 Ga0207660_104665392 94
147 3300025918 Ga0207662_10155201 Ga0207662_101552012 94
148 3300025919 Ga0207657_10081485 Ga0207657_100814852 94
149 3300025920 Ga0207649_10097853 Ga0207649_100978533 94
150 3300025920 Ga0207649_10305855 Ga0207649_103058552 94
151 3300025921 Ga0207652_10711844 Ga0207652_107118443 94
152 3300025923 Ga0207681_10271920 Ga0207681_102719203 94
153 3300025924 Ga0207694_10327698 Ga0207694_103276982 94
154 3300025925 Ga0207650_10001771 Ga0207650_100017716 94
155 3300025925 Ga0207650_10041248 Ga0207650_100412481 94
156 3300025926 Ga0207659_10497035 Ga0207659_104970351 94
157 3300025929 Ga0207664_11719498 Ga0207664_117194981 94
158 3300025932 Ga0207690_10531666 Ga0207690_105316662 94
159 3300025933 Ga0207706_10113414 Ga0207706_101134142 94
160 3300025935 Ga0207709_10067824 Ga0207709_100678243 94
161 3300025936 Ga0207670_10520634 Ga0207670_105206341 94
162 3300025937 Ga0207669_10283586 Ga0207669_102835861 94
163 3300025937 Ga0207669_10582582 Ga0207669_105825822 94
164 3300025938 Ga0207704_10332238 Ga0207704_103322381 94
165 3300025940 Ga0207691_10598120 Ga0207691_105981201 94
166 3300025941 Ga0207711_10551396 Ga0207711_105513962 94
167 3300025944 Ga0207661_10511056 Ga0207661_105110562 94
168 3300025949 Ga0207667_10372013 Ga0207667_103720133 94
169 3300025960 Ga0207651_10254486 Ga0207651_102544863 94
170 3300025972 Ga0207668_10529317 Ga0207668_105293171 94
171 3300025981 Ga0207640_10018335 Ga0207640_100183353 94
172 3300025986 Ga0207658_10347587 Ga0207658_103475873 94
173 3300025986 Ga0207658_11380983 Ga0207658_113809831 94
174 3300026023 Ga0207677_10558204 Ga0207677_105582042 94
175 3300026023 Ga0207677_11543399 Ga0207677_115433991 94
176 3300026035 Ga0207703_10340512 Ga0207703_103405122 94
177 3300026041 Ga0207639_10220044 Ga0207639_102200441 94
178 3300026075 Ga0207708_10221970 Ga0207708_102219701 94
179 3300026078 Ga0207702_10133408 Ga0207702_101334084 94
180 3300026088 Ga0207641_10452179 Ga0207641_104521793 94
181 3300026089 Ga0207648_10245558 Ga0207648_102455583 94
182 3300026089 Ga0207648_10325640 Ga0207648_103256402 94
183 3300026089 Ga0207648_11111696 Ga0207648_111116961 94
184 3300026095 Ga0207676_10663399 Ga0207676_106633992 94
185 3300026116 Ga0207674_10712240 Ga0207674_107122403 94
186 3300026118 Ga0207675_100283177 Ga0207675_1002831772 94
187 3300026121 Ga0207683_10195306 Ga0207683_101953062 94
188 3300026142 Ga0207698_10062697 Ga0207698_100626973 94
189 3300026142 Ga0207698_10893615 Ga0207698_108936153 94
190 3300028379 Ga0268266_10564348 Ga0268266_105643481 94
191 3300028379 Ga0268266_11087435 Ga0268266_110874352 94
192 3300028380 Ga0268265_10279947 Ga0268265_102799472 94
193 3300028380 Ga0268265_12065304 Ga0268265_120653042 94
194 3300028381 Ga0268264_10109841 Ga0268264_101098411 94
195 3300028794 Ga0307515_10018830 Ga0307515_1001883015 94
196 3300029957 Ga0265324_10037534 Ga0265324_100375342 94
197 3300029957 Ga0265324_10128886 Ga0265324_101288862 94
198 3300031250 Ga0265331_10019353 Ga0265331_100193533 94
199 3300031250 Ga0265331_10577609 Ga0265331_105776092 94
200 3300031251 Ga0265327_10000203 Ga0265327_1000020366 94
201 3300031251 Ga0265327_10344795 Ga0265327_103447952 94
202 3300031344 Ga0265316_10209764 Ga0265316_102097642 94
203 3300031344 Ga0265316_10925264 Ga0265316_109252642 94
204 3300031548 Ga0307408_101637885 Ga0307408_1016378851 94
205 3300031711 Ga0265314_10339102 Ga0265314_103391022 94
206 3300031711 Ga0265314_10376122 Ga0265314_103761223 94
207 3300031824 Ga0307413_10485774 Ga0307413_104857742 94
208 3300031911 Ga0307412_10768953 Ga0307412_107689533 94
209 3300032002 Ga0307416_103173664 Ga0307416_1031736641 94
210 3300032004 Ga0307414_10004905 Ga0307414_100049056 94
211 3300032004 Ga0307414_10058920 Ga0307414_100589202 94
212 3300032004 Ga0307414_10101941 Ga0307414_101019413 94
213 3300035088 Ga0373940_0092492 Ga0373940_0092492_522_806 94
214 3300035121 Ga0373960_0077765 Ga0373960_0077765_316_600 94
215 3300035242 Ga0373962_0325472 Ga0373962_0325472_178_462 94
216 3300035691 Ga0373931_0620342 Ga0373931_0620342_408_692 94
217 3300037312 Ga0395899_0677706 Ga0395899_0677706_326_610 94
218 3300037471 Ga0395905_0218180 Ga0395905_0218180_1367_1651 94
219 3300038443 Ga0395901_1328643 Ga0395901_1328643_273_557 94
220 3300041413 Ga0439465_0038851 Ga0439465_0038851_448_732 94
221 3300041453 Ga0451797_0362118 Ga0451797_0362118_534_818 94
222 3300041453 Ga0451797_0765185 Ga0451797_0765185_46_330 94
223 3300041453 Ga0451797_1053132 Ga0451797_1053132_156_446 94
224 3300041486 Ga0451807_1347270 Ga0451807_1347270_208_492 94
225 3300041509 Ga0451843_0087035 Ga0451843_0087035_20_304 94
226 3300041512 Ga0451853_2535432 Ga0451853_2535432_146_466 94
227 3300041999 Ga0439433_0050751 Ga0439433_0050751_680_964 94
228 3300042007 Ga0439449_0017669 Ga0439449_0017669_374_658 94
229 3300042876 Ga0451577_0006084 Ga0451577_0006084_2900_3187 94
230 3300042876 Ga0451577_0096782 Ga0451577_0096782_1456_1740 94
231 3300042876 Ga0451577_0113512 Ga0451577_0113512_100_387 94
232 3300042876 Ga0451577_0699691 Ga0451577_0699691_533_817 94
233 3300044712 Ga0453684_0006093 Ga0453684_0006093_4030_4314 94
234 3300044712 Ga0453684_1375055 Ga0453684_1375055_158_445 94
235 3300044712 Ga0453684_1754958 Ga0453684_1754958_192_476 94
236 3300045051 Ga0451576_0103830 Ga0451576_0103830_259_546 94
237 3300045051 Ga0451576_2031888 Ga0451576_2031888_178_462 94
238 3300046452 Ga0495617_016421 Ga0495617_016421_1625_1909 94
239 3300046460 Ga0495638_0311488 Ga0495638_0311488_133_417 94
240 3300046492 Ga0495585_0089742 Ga0495585_0089742_609_893 94
241 3300046501 Ga0495607_0056728 Ga0495607_0056728_1211_1495 94
242 3300046615 Ga0495656_0569368 Ga0495656_0569368_18_302 94
243 3300046615 Ga0495656_0631608 Ga0495656_0631608_149_433 94
244 3300046648 Ga0495611_0098035 Ga0495611_0098035_487_771 94
245 3300046684 Ga0495669_0163873 Ga0495669_0163873_667_951 94
246 3300047321 Ga0495676_0507513 Ga0495676_0507513_354_638 94
247 3300047469 Ga0495673_0264738 Ga0495673_0264738_138_422 94
248 3300048919 Ga0496116_0486585 Ga0496116_0486585_170_454 94
249 3300048920 Ga0496117_0321699 Ga0496117_0321699_63_347 94
250 3300048921 Ga0496118_0015689 Ga0496118_0015689_3052_3336 94
251 3300048921 Ga0496118_0025104 Ga0496118_0025104_4334_4618 94
252 3300048925 Ga0496122_0001224 Ga0496122_0001224_9453_9737 94
253 3300048926 Ga0496123_0000993 Ga0496123_0000993_9603_9887 94
254 3300049573 Ga0501037_0414268 Ga0501037_0414268_389_673 94
255 3300049575 Ga0501039_0014135 Ga0501039_0014135_3303_3587 94
256 3300049577 Ga0501041_0109443 Ga0501041_0109443_1126_1410 94
257 3300049582 Ga0501048_0481125 Ga0501048_0481125_485_769 94
258 3300049582 Ga0501048_0683967 Ga0501048_0683967_298_582 94
259 3300049587 Ga0501071_0569928 Ga0501071_0569928_405_689 94
260 3300049587 Ga0501071_0871768 Ga0501071_0871768_341_625 94
261 3300049588 Ga0501072_1214531 Ga0501072_1214531_92_376 94
262 3300049592 Ga0501076_0929503 Ga0501076_0929503_100_384 94
263 3300049742 Ga0501080_0784949 Ga0501080_0784949_94_378 94
264 3300049743 Ga0501081_0478914 Ga0501081_0478914_501_785 94
265 3300050491 nmdc:mga00v17_421910_c1 nmdc:mga00v17_421910_c1_133_417 94
266 3300050491 nmdc:mga00v17_48630_c1 nmdc:mga00v17_48630_c1_526_810 94
267 3300050493 nmdc:mga0k408_69411_c2 nmdc:mga0k408_69411_c2_228_515 94
268 3300059647 Ga0587079_234166 Ga0587079_234166_99_383 94

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01402

RHH_1

Ribbon-helix-helix protein, copG family

3

41

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gpe-assembly1.cif.gz_A structure of the dna-binding domain of e. coli proline utilization a (puta) 0.9564 1 41
1u9p-assembly1.cif.gz_A permuted single-chain arc 0.9527 6 42
2ay0-assembly3.cif.gz_E structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain. 0.9484 1 41
2ay0-assembly2.cif.gz_C structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain. 0.9416 1 41
6ajm-assembly1.cif.gz_E crystal structure of apo atatr 0.9392 1 62
ID Description Score Start End Superfamily
2ba3B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9773 9 35 1.10.1220.10
af_O07227_9_73_1.10.1220.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9619 8 39 1.10.1220.10
2ba3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.955 9 35 1.10.1220.10
1u9pA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.9527 6 42 1.10.1220.10
1q5vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.933 1 44 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A6A9T6M9-F1-model_v4 Ribbon-helix-helix protein, CopG family 0.972 1 38
AF-A0A1G7ZD28-F1-model_v4 HicB family protein 0.9613 1 49
AF-A0A2N1VFF9-F1-model_v4 Arc family DNA binding domain-containing protein 0.9573 1 42 GO:0006355
AF-A0A1W6MR18-F1-model_v4 Toxin-antitoxin system HicB family antitoxin 0.9558 1 41 GO:0006355
AF-A0A3D4K7T9-F1-model_v4 Antitoxin 0.9553 1 38

Feature Viewer

pLDDT pTM Quality
92.54 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map