F375410

General Info

Members Datasets Scaffolds Average Seq Length
268 171 530 322

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100280076|Ga0075428_1002800762
Length 378
Sequence MGNWGCPLTRPLERIAGYFHVRWALGSWNTRRKGAIMAKIQASGEMRITRRSVLCGALVTAAVTAARTVLAQQMQTHLPPRVVAKAKGPLVFLDYDKDEIDFAYDQAPWAPNAGEVAKRNAQKSAAALARLGPPRRVAYGSADIEKLDIYITKQPNAPINVFIHGGAWRTGNAKGAAYMSETFVDAGAHFVSLDFNNVTDVDGNLIIMAEQVRRAIAWVHKNAASFGGDANRLYVSGTSSGGHLAAVALTTDWQKDFRLPADTLKGGLCCSGMYDLYPVSLSARAGYVKFTPEMIEKLSPQRHLDKLVAPVIVAHGTLETPEFQRQNREFAAAVKGAGKPVTFLIGQGYNHFEMFETLGNPYGLLGRAMLEQMKLKTG

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
103 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
104 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
105 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
106 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0
Rhizoplane 3.36
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 23.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100280076 3300006844 Unclassified 1794
2 JGI25153J46596_10003663 3300003215 Bacteria 8508
3 Ga0070670_100098728 3300005331 Unclassified 2513
4 Ga0070670_100196415 3300005331 Bacteria 1753
5 Ga0070666_10095577 3300005335 Unclassified 2045
6 Ga0068868_100014030 3300005338 Bacteria 5895
7 Ga0068868_100072125 3300005338 Plasmid 2755
8 Ga0070689_100089764 3300005340 Bacteria 2421
9 Ga0070669_100100229 3300005353 Bacteria 2184
10 Ga0070675_100094650 3300005354 Bacteria 2507
11 Ga0070671_100002027 3300005355 Bacteria 15597
12 Ga0070671_100168881 3300005355 Unclassified 1850
13 Ga0070674_100002990 3300005356 Bacteria 9393
14 Ga0070674_100171906 3300005356 Bacteria 1653
15 Ga0070688_100049379 3300005365 Bacteria 2618
16 Ga0070667_100222927 3300005367 Bacteria 1679
17 Ga0070708_100042346 3300005445 Bacteria 3997
18 Ga0070708_100256173 3300005445 Bacteria 1644
19 Ga0070662_100260145 3300005457 Bacteria 1398
20 Ga0070706_100076254 3300005467 Bacteria 3103
21 Ga0070707_100087384 3300005468 Bacteria 3015
22 Ga0070707_100102399 3300005468 Bacteria 2775
23 Ga0070707_100477765 3300005468 Unclassified 1208
24 Ga0070698_100206875 3300005471 Bacteria 1897
25 Ga0070699_100004042 3300005518 Bacteria 12963
26 Ga0070699_100039191 3300005518 Bacteria 4103
27 Ga0070699_100279885 3300005518 Bacteria 1494
28 Ga0070679_100273742 3300005530 Bacteria 1642
29 Ga0070704_100023965 3300005549 Bacteria 3997
30 Ga0070664_100200505 3300005564 Unclassified 1781
31 Ga0068864_100071187 3300005618 Bacteria 3027
32 Ga0068864_100169705 3300005618 Unclassified 1989
33 Ga0068864_100314300 3300005618 Bacteria 1469
34 Ga0068864_100363002 3300005618 Bacteria 1369
35 Ga0068870_10212808 3300005840 Bacteria 1178
36 Ga0068863_100039983 3300005841 Bacteria 4460
37 Ga0068858_100023508 3300005842 Bacteria 5740
38 Ga0068858_100191496 3300005842 Bacteria 1932
39 Ga0068860_100315239 3300005843 Unclassified 1534
40 Ga0081455_10045870 3300005937 Bacteria 3799
41 Ga0081538_10010764 3300005981 Bacteria 7477
42 Ga0075366_10029605 3300006195 Bacteria 3217
43 Ga0097621_100187988 3300006237 Unclassified 1787
44 Ga0068871_100154163 3300006358 Unclassified 1960
45 Ga0075428_100008791 3300006844 Bacteria 11210
46 Ga0075428_100020814 3300006844 Bacteria 7263
47 Ga0075428_100488803 3300006844 Bacteria 1317
48 Ga0075430_100112684 3300006846 Bacteria 2267
49 Ga0075430_100139669 3300006846 Bacteria 2018
50 Ga0075431_100029907 3300006847 Bacteria 5608
51 Ga0075431_100049329 3300006847 Bacteria 4341
52 Ga0075431_100099651 3300006847 Unclassified 2998
53 Ga0075431_100105950 3300006847 Bacteria 2901
54 Ga0075433_10042054 3300006852 Unclassified 3963
55 Ga0075433_10100122 3300006852 Bacteria 2566
56 Ga0075433_10320443 3300006852 Bacteria 1371
57 Ga0075434_100179439 3300006871 Bacteria 2137
58 Ga0075429_100000794 3300006880 Bacteria 24824
59 Ga0075429_100019477 3300006880 Bacteria 5879
60 Ga0075429_100041430 3300006880 Bacteria 4010
61 Ga0075429_100187556 3300006880 Bacteria 1812
62 Ga0075429_100213896 3300006880 Bacteria 1689
63 Ga0068865_100299752 3300006881 Bacteria 1286
64 Ga0075435_100021630 3300007076 Bacteria 4951
65 Ga0075435_100041954 3300007076 Bacteria 3658
66 Ga0099794_10062370 3300007265 Bacteria 1813
67 Ga0111539_10082481 3300009094 Unclassified 3782
68 Ga0111539_10248029 3300009094 Bacteria 2073
69 Ga0105245_10018409 3300009098 Bacteria 6107
70 Ga0105245_10042116 3300009098 Unclassified 4073
71 Ga0105245_10137660 3300009098 Unclassified 2296
72 Ga0105247_10061200 3300009101 Unclassified 2334
73 Ga0105247_10176224 3300009101 Bacteria 1424
74 Ga0114129_10007727 3300009147 Bacteria 15296
75 Ga0114129_10018587 3300009147 Bacteria 9896
76 Ga0114129_10037664 3300009147 Bacteria 6827
77 Ga0114129_10072112 3300009147 Bacteria 4815
78 Ga0114129_10174712 3300009147 Bacteria 2926
79 Ga0114129_10245195 3300009147 Unclassified 2407
80 Ga0105242_10212183 3300009176 Unclassified 1726
81 Ga0105248_10151049 3300009177 Unclassified 2620
82 Ga0105248_10263613 3300009177 Bacteria 1940
83 Ga0105248_10326894 3300009177 Bacteria 1727
84 Ga0105238_10048519 3300009551 Bacteria 4279
85 Ga0105238_10278977 3300009551 Unclassified 1652
86 Ga0105249_10096600 3300009553 Unclassified 2772
87 Ga0105246_10005199 3300011119 Bacteria 7913
88 Ga0157374_10018574 3300013296 Bacteria 6139
89 Ga0157374_10347384 3300013296 Bacteria 1474
90 Ga0163162_10229805 3300013306 Bacteria 1985
91 Ga0163162_10524677 3300013306 Unclassified 1314
92 Ga0157375_10062934 3300013308 Plasmid 3689
93 Ga0157375_10413327 3300013308 Bacteria 1515
94 Ga0163163_10054455 3300014325 Bacteria 3953
95 Ga0163163_10082620 3300014325 Bacteria 3216
96 Ga0163163_10273496 3300014325 Bacteria 1740
97 Ga0157380_10023693 3300014326 Unclassified 4634
98 Ga0157380_10125289 3300014326 Bacteria 2182
99 Ga0157379_10031642 3300014968 Bacteria 4715
100 Ga0157379_10186471 3300014968 Bacteria 1875
101 Ga0157376_10015224 3300014969 Bacteria 5803
102 Ga0157376_10124257 3300014969 Bacteria 2292
103 Ga0213872_10057909 3300021361 Bacteria 1754
104 Ga0209758_1000274 3300025297 Bacteria 102644
105 Ga0207680_10015851 3300025903 Unclassified 3943
106 Ga0207680_10128232 3300025903 Bacteria 1669
107 Ga0207685_10030427 3300025905 Bacteria 1922
108 Ga0207645_10043911 3300025907 Bacteria 2860
109 Ga0207645_10176682 3300025907 Bacteria 1400
110 Ga0207684_10014131 3300025910 Bacteria 6893
111 Ga0207684_10019263 3300025910 Bacteria 5839
112 Ga0207684_10111608 3300025910 Bacteria 2340
113 Ga0207662_10067781 3300025918 Bacteria 2153
114 Ga0207657_10065729 3300025919 Unclassified 3090
115 Ga0207646_10135501 3300025922 Bacteria 2217
116 Ga0207646_10257817 3300025922 Unclassified 1576
117 Ga0207681_10037873 3300025923 Unclassified 3191
118 Ga0207681_10042024 3300025923 Bacteria 3051
119 Ga0207650_10061945 3300025925 Bacteria 2794
120 Ga0207650_10200527 3300025925 Unclassified 1598
121 Ga0207687_10050922 3300025927 Unclassified 2885
122 Ga0207687_10074094 3300025927 Unclassified 2439
123 Ga0207644_10044676 3300025931 Bacteria 3149
124 Ga0207644_10133128 3300025931 Unclassified 1906
125 Ga0207706_10023964 3300025933 Bacteria 5476
126 Ga0207686_10065002 3300025934 Bacteria 2324
127 Ga0207709_10140081 3300025935 Bacteria 1661
128 Ga0207709_10160009 3300025935 Bacteria 1569
129 Ga0207670_10038425 3300025936 Bacteria 3126
130 Ga0207670_10040626 3300025936 Bacteria 3054
131 Ga0207669_10051588 3300025937 Bacteria 2465
132 Ga0207669_10084219 3300025937 Bacteria 2048
133 Ga0207704_10128308 3300025938 Bacteria 1751
134 Ga0207711_10014031 3300025941 Bacteria 6656
135 Ga0207711_10151127 3300025941 Unclassified 2095
136 Ga0207668_10060437 3300025972 Bacteria 2660
137 Ga0207658_10105318 3300025986 Bacteria 2218
138 Ga0207677_10031136 3300026023 Bacteria 3414
139 Ga0207677_10174781 3300026023 Unclassified 1683
140 Ga0207703_10068293 3300026035 Unclassified 2928
141 Ga0207703_10103879 3300026035 Bacteria 2413
142 Ga0207641_10094715 3300026088 Unclassified 2619
143 Ga0207676_10057127 3300026095 Bacteria 3072
144 Ga0207676_10114172 3300026095 Bacteria 2265
145 Ga0207683_10013113 3300026121 Bacteria 7069
146 Ga0207683_10063081 3300026121 Bacteria 3264
147 Ga0207428_10010298 3300027907 Bacteria 8357
148 Ga0207428_10061914 3300027907 Unclassified 2961
149 Ga0268264_10126835 3300028381 Unclassified 2256
150 Ga0268264_10168171 3300028381 Bacteria 1981
151 Ga0265332_10025715 3300031238 Bacteria 2583
152 Ga0265340_10007768 3300031247 Bacteria 5816
153 Ga0265339_10006562 3300031249 Bacteria 7624
154 Ga0265316_10231323 3300031344 Bacteria 1361
155 Ga0265342_10000564 3300031712 Bacteria 39142
156 Ga0307409_100409382 3300031995 Bacteria 1298
157 Ga0373923_0002098 3300035111 Bacteria 6038
158 Ga0373953_0023168 3300035117 Unclassified 2348
159 Ga0373954_0022350 3300035118 Unclassified 2868
160 Ga0373946_0021912 3300035171 Unclassified 2482
161 Ga0373955_0083800 3300035172 Unclassified 1806
162 Ga0373961_0015623 3300035241 Bacteria 1945
163 Ga0373931_0126313 3300035691 Bacteria 1467
164 Ga0373935_0076193 3300035692 Bacteria 2171
165 Ga0373927_0115097 3300035695 Bacteria 1753
166 Ga0436365_0142728 3300039437 Bacteria 5192
167 Ga0436361_0599006 3300039447 Bacteria 4753
168 Ga0439453_0003274 3300041408 Bacteria 2316
169 Ga0439443_000161 3300042003 Bacteria 4751
170 Ga0450923_033653 3300042125 Bacteria 1054
171 Ga0439435_0002751 3300042436 Bacteria 3549
172 Ga0439440_0004787 3300042993 Bacteria 2670
173 Ga0466958_0061354 3300045836 Bacteria 2290
174 Ga0495592_0016801 3300046454 Bacteria 5556
175 Ga0495603_0185614 3300046455 Bacteria 1203
176 Ga0495629_0177657 3300046459 Unclassified 1476
177 Ga0495580_0004222 3300046472 Bacteria 12081
178 Ga0495580_0043205 3300046472 Bacteria 3208
179 Ga0495639_0006176 3300046475 Bacteria 5142
180 Ga0495662_0029728 3300046476 Unclassified 2637
181 Ga0495664_0065282 3300046477 Unclassified 2169
182 Ga0495608_0070704 3300046511 Unclassified 2277
183 Ga0495628_0018132 3300046516 Bacteria 5837
184 Ga0495628_0023095 3300046516 Bacteria 5106
185 Ga0495666_0028388 3300046526 Bacteria 2752
186 Ga0495652_0063043 3300046529 Bacteria 3123
187 Ga0495652_0152795 3300046529 Unclassified 1801
188 Ga0495640_0105042 3300046533 Unclassified 1850
189 Ga0495587_0035366 3300046536 Unclassified 3008
190 Ga0495621_0127484 3300046539 Bacteria 988
191 Ga0495667_0041840 3300046559 Unclassified 3037
192 Ga0495634_0017455 3300046642 Bacteria 5119
193 Ga0495659_0070894 3300046664 Unclassified 1305
194 Ga0495599_0012566 3300046678 Bacteria 5222
195 Ga0495623_0003418 3300046679 Bacteria 10508
196 Ga0495600_0036118 3300046809 Unclassified 3210
197 Ga0495636_0057594 3300047318 Bacteria 1637
198 Ga0495674_0105852 3300047319 Unclassified 2389
199 Ga0495684_0083068 3300047471 Bacteria 2429
200 Ga0496102_0256850 3300048905 Bacteria 1647
201 Ga0496105_0023537 3300048908 Bacteria 4997
202 Ga0496106_0139140 3300048909 Bacteria 1909
203 Ga0496106_0285785 3300048909 Bacteria 1322
204 Ga0496108_0057790 3300048911 Bacteria 3259
205 Ga0496109_0280535 3300048912 Bacteria 1570
206 Ga0496112_0046196 3300048915 Bacteria 4270
207 Ga0496112_0389978 3300048915 Bacteria 1333
208 Ga0496114_0042515 3300048917 Bacteria 3767
209 Ga0501031_0050810 3300049568 Bacteria 2700
210 Ga0501033_0064968 3300049570 Bacteria 2684
211 Ga0501036_0074372 3300049572 Unclassified 2873
212 Ga0501039_0204265 3300049575 Bacteria 1553
213 Ga0501041_0049509 3300049577 Bacteria 2559
214 Ga0501048_0126957 3300049582 Bacteria 1803
215 Ga0501068_0018276 3300049584 Plasmid 4061
216 Ga0501069_0057305 3300049585 Unclassified 2171
217 Ga0501070_0013048 3300049586 Bacteria 7002
218 Ga0501073_0041933 3300049589 Unclassified 3232
219 Ga0501074_0020558 3300049590 Bacteria 4797
220 Ga0501075_0140301 3300049591 Bacteria 1841
221 Ga0501076_0041588 3300049592 Bacteria 3616
222 Ga0501077_0006672 3300049593 Bacteria 7091
223 Ga0501077_0024550 3300049593 Bacteria 3828
224 Ga0501079_0033013 3300049741 Plasmid 3981
225 Ga0501080_0157688 3300049742 Unclassified 2096
226 Ga0501083_0068667 3300049744 Unclassified 2358
227 Ga0501035_0088670 3300049822 Bacteria 2725
228 Ga0501044_0214427 3300049823 Bacteria 1878
229 nmdc:mga0k408_17948_c1 3300050493 Bacteria 3944
230 nmdc:mga05p37_10141_c1 3300050507 Bacteria 11183
231 nmdc:mga05p37_253315_c1 3300050507 Bacteria 2111
232 nmdc:mga05p37_298084_c1 3300050507 Unclassified 1917
233 nmdc:mga05p37_40088_c1 3300050507 Bacteria 5751
234 nmdc:mga05p37_504444_c1 3300050507 Bacteria 1388
235 nmdc:mga05p37_6166_c1 3300050507 Bacteria 14114
236 nmdc:mga05p37_81534_c1 3300050507 Bacteria 3985
237 nmdc:mga09592_122011_c1 3300050508 Bacteria 2239
238 nmdc:mga09592_1525_c1 3300050508 Bacteria 18665
239 nmdc:mga09592_249008_c1 3300050508 Unclassified 1540
240 nmdc:mga09592_72477_c1 3300050508 Bacteria 2925
241 nmdc:mga0qj67_276226_c1 3300050509 Bacteria 1362
242 nmdc:mga06r32_28150_c1 3300050510 Bacteria 5255
243 nmdc:mga06r32_39016_c1 3300050510 Bacteria 4504
244 nmdc:mga06r32_70051_c1 3300050510 Plasmid 3391
245 nmdc:mga08y16_1196_c1 3300050511 Bacteria 25597
246 nmdc:mga08y16_314617_c1 3300050511 Unclassified 1612
247 nmdc:mga08y16_44700_c1 3300050511 Bacteria 4641
248 nmdc:mga0n895_113546_c1 3300050512 Unclassified 2727
249 nmdc:mga0n895_184486_c1 3300050512 Bacteria 2118
250 nmdc:mga0n895_2765_c1 3300050512 Bacteria 13864
251 nmdc:mga0n895_4527_c1 3300050512 Bacteria 11439
252 nmdc:mga0n895_70404_c1 3300050512 Plasmid 3467
253 nmdc:mga0rr50_109088_c1 3300050513 Bacteria 2188
254 nmdc:mga0rr50_11776_c1 3300050513 Bacteria 5615
255 nmdc:mga0rr50_278275_c1 3300050513 Unclassified 1396
256 nmdc:mga0a205_12388_c1 3300050515 Bacteria 7888
257 nmdc:mga0a205_132058_c1 3300050515 Unclassified 2398
258 nmdc:mga0a205_183293_c1 3300050515 Bacteria 1987
259 Ga0495601_0022881 3300053077 Bacteria 3839
260 Ga0495601_0065750 3300053077 Unclassified 2308
261 Ga0495595_0016942 3300053084 Bacteria 3126
262 Ga0495619_0064511 3300053085 Bacteria 2442
263 Ga0500616_0071696 3300053153 Bacteria 1763
264 Ga0501084_0034222 3300054114 Plasmid 4248
265 Ga0501082_0046303 3300060353 Plasmid 3749
266 Ga0075428_100280076
267 JGI25153J46596_10003663
268 Ga0070670_100098728
269 Ga0070670_100196415
270 Ga0070666_10095577
271 Ga0068868_100014030
272 Ga0068868_100072125
273 Ga0070689_100089764
274 Ga0070669_100100229
275 Ga0070675_100094650
276 Ga0070671_100002027
277 Ga0070671_100168881
278 Ga0070674_100002990
279 Ga0070674_100171906
280 Ga0070688_100049379
281 Ga0070667_100222927
282 Ga0070708_100042346
283 Ga0070708_100256173
284 Ga0070662_100260145
285 Ga0070706_100076254
286 Ga0070707_100087384
287 Ga0070707_100102399
288 Ga0070707_100477765
289 Ga0070698_100206875
290 Ga0070699_100004042
291 Ga0070699_100039191
292 Ga0070699_100279885
293 Ga0070679_100273742
294 Ga0070704_100023965
295 Ga0070664_100200505
296 Ga0068864_100071187
297 Ga0068864_100169705
298 Ga0068864_100314300
299 Ga0068864_100363002
300 Ga0068870_10212808
301 Ga0068863_100039983
302 Ga0068858_100023508
303 Ga0068858_100191496
304 Ga0068860_100315239
305 Ga0081455_10045870
306 Ga0081538_10010764
307 Ga0075366_10029605
308 Ga0097621_100187988
309 Ga0068871_100154163
310 Ga0075428_100008791
311 Ga0075428_100020814
312 Ga0075428_100488803
313 Ga0075430_100112684
314 Ga0075430_100139669
315 Ga0075431_100029907
316 Ga0075431_100049329
317 Ga0075431_100099651
318 Ga0075431_100105950
319 Ga0075433_10042054
320 Ga0075433_10100122
321 Ga0075433_10320443
322 Ga0075434_100179439
323 Ga0075429_100000794
324 Ga0075429_100019477
325 Ga0075429_100041430
326 Ga0075429_100187556
327 Ga0075429_100213896
328 Ga0068865_100299752
329 Ga0075435_100021630
330 Ga0075435_100041954
331 Ga0099794_10062370
332 Ga0111539_10082481
333 Ga0111539_10248029
334 Ga0105245_10018409
335 Ga0105245_10042116
336 Ga0105245_10137660
337 Ga0105247_10061200
338 Ga0105247_10176224
339 Ga0114129_10007727
340 Ga0114129_10018587
341 Ga0114129_10037664
342 Ga0114129_10072112
343 Ga0114129_10174712
344 Ga0114129_10245195
345 Ga0105242_10212183
346 Ga0105248_10151049
347 Ga0105248_10263613
348 Ga0105248_10326894
349 Ga0105238_10048519
350 Ga0105238_10278977
351 Ga0105249_10096600
352 Ga0105246_10005199
353 Ga0157374_10018574
354 Ga0157374_10347384
355 Ga0163162_10229805
356 Ga0163162_10524677
357 Ga0157375_10062934
358 Ga0157375_10413327
359 Ga0163163_10054455
360 Ga0163163_10082620
361 Ga0163163_10273496
362 Ga0157380_10023693
363 Ga0157380_10125289
364 Ga0157379_10031642
365 Ga0157379_10186471
366 Ga0157376_10015224
367 Ga0157376_10124257
368 Ga0213872_10057909
369 Ga0209758_1000274
370 Ga0207680_10015851
371 Ga0207680_10128232
372 Ga0207685_10030427
373 Ga0207645_10043911
374 Ga0207645_10176682
375 Ga0207684_10014131
376 Ga0207684_10019263
377 Ga0207684_10111608
378 Ga0207662_10067781
379 Ga0207657_10065729
380 Ga0207646_10135501
381 Ga0207646_10257817
382 Ga0207681_10037873
383 Ga0207681_10042024
384 Ga0207650_10061945
385 Ga0207650_10200527
386 Ga0207687_10050922
387 Ga0207687_10074094
388 Ga0207644_10044676
389 Ga0207644_10133128
390 Ga0207706_10023964
391 Ga0207686_10065002
392 Ga0207709_10140081
393 Ga0207709_10160009
394 Ga0207670_10038425
395 Ga0207670_10040626
396 Ga0207669_10051588
397 Ga0207669_10084219
398 Ga0207704_10128308
399 Ga0207711_10014031
400 Ga0207711_10151127
401 Ga0207668_10060437
402 Ga0207658_10105318
403 Ga0207677_10031136
404 Ga0207677_10174781
405 Ga0207703_10068293
406 Ga0207703_10103879
407 Ga0207641_10094715
408 Ga0207676_10057127
409 Ga0207676_10114172
410 Ga0207683_10013113
411 Ga0207683_10063081
412 Ga0207428_10010298
413 Ga0207428_10061914
414 Ga0268264_10126835
415 Ga0268264_10168171
416 Ga0265332_10025715
417 Ga0265340_10007768
418 Ga0265339_10006562
419 Ga0265316_10231323
420 Ga0265342_10000564
421 Ga0307409_100409382
422 Ga0373923_0002098
423 Ga0373953_0023168
424 Ga0373954_0022350
425 Ga0373946_0021912
426 Ga0373955_0083800
427 Ga0373961_0015623
428 Ga0373931_0126313
429 Ga0373935_0076193
430 Ga0373927_0115097
431 Ga0436365_0142728
432 Ga0436361_0599006
433 Ga0439453_0003274
434 Ga0439443_000161
435 Ga0450923_033653
436 Ga0439435_0002751
437 Ga0439440_0004787
438 Ga0466958_0061354
439 Ga0495592_0016801
440 Ga0495603_0185614
441 Ga0495629_0177657
442 Ga0495580_0004222
443 Ga0495580_0043205
444 Ga0495639_0006176
445 Ga0495662_0029728
446 Ga0495664_0065282
447 Ga0495608_0070704
448 Ga0495628_0018132
449 Ga0495628_0023095
450 Ga0495666_0028388
451 Ga0495652_0063043
452 Ga0495652_0152795
453 Ga0495640_0105042
454 Ga0495587_0035366
455 Ga0495621_0127484
456 Ga0495667_0041840
457 Ga0495634_0017455
458 Ga0495659_0070894
459 Ga0495599_0012566
460 Ga0495623_0003418
461 Ga0495600_0036118
462 Ga0495636_0057594
463 Ga0495674_0105852
464 Ga0495684_0083068
465 Ga0496102_0256850
466 Ga0496105_0023537
467 Ga0496106_0139140
468 Ga0496106_0285785
469 Ga0496108_0057790
470 Ga0496109_0280535
471 Ga0496112_0046196
472 Ga0496112_0389978
473 Ga0496114_0042515
474 Ga0501031_0050810
475 Ga0501033_0064968
476 Ga0501036_0074372
477 Ga0501039_0204265
478 Ga0501041_0049509
479 Ga0501048_0126957
480 Ga0501068_0018276
481 Ga0501069_0057305
482 Ga0501070_0013048
483 Ga0501073_0041933
484 Ga0501074_0020558
485 Ga0501075_0140301
486 Ga0501076_0041588
487 Ga0501077_0006672
488 Ga0501077_0024550
489 Ga0501079_0033013
490 Ga0501080_0157688
491 Ga0501083_0068667
492 Ga0501035_0088670
493 Ga0501044_0214427
494 nmdc:mga0k408_17948_c1
495 nmdc:mga05p37_10141_c1
496 nmdc:mga05p37_253315_c1
497 nmdc:mga05p37_298084_c1
498 nmdc:mga05p37_40088_c1
499 nmdc:mga05p37_504444_c1
500 nmdc:mga05p37_6166_c1
501 nmdc:mga05p37_81534_c1
502 nmdc:mga09592_122011_c1
503 nmdc:mga09592_1525_c1
504 nmdc:mga09592_249008_c1
505 nmdc:mga09592_72477_c1
506 nmdc:mga0qj67_276226_c1
507 nmdc:mga06r32_28150_c1
508 nmdc:mga06r32_39016_c1
509 nmdc:mga06r32_70051_c1
510 nmdc:mga08y16_1196_c1
511 nmdc:mga08y16_314617_c1
512 nmdc:mga08y16_44700_c1
513 nmdc:mga0n895_113546_c1
514 nmdc:mga0n895_184486_c1
515 nmdc:mga0n895_2765_c1
516 nmdc:mga0n895_4527_c1
517 nmdc:mga0n895_70404_c1
518 nmdc:mga0rr50_109088_c1
519 nmdc:mga0rr50_11776_c1
520 nmdc:mga0rr50_278275_c1
521 nmdc:mga0a205_12388_c1
522 nmdc:mga0a205_132058_c1
523 nmdc:mga0a205_183293_c1
524 Ga0495601_0022881
525 Ga0495601_0065750
526 Ga0495595_0016942
527 Ga0495619_0064511
528 Ga0500616_0071696
529 Ga0501084_0034222
530 Ga0501082_0046303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20434

BD-FAE

BD-FAE

147

266

0.88

PF00135

COesterase

Carboxylesterase family

103

272

0.79

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

160

354

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pbl-assembly4.cif.gz_D crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution 0.8957 24 299
2pbl-assembly4.cif.gz_D crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution 0.8763 24 299
4e14-assembly1.cif.gz_A crystal structure of kynurenine formamidase conjugated with phenylmethylsulfonyl fluoride 0.8446 38 297
4e11-assembly1.cif.gz_A crystal structure of kynurenine formamidase from drosophila melanogaster 0.8326 24 297
7p1p-assembly1.cif.gz_bb crystal structure of human acetylcholinesterase in complex with (e)-3-hydroxy-6-(3-(4-(4-(((2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2h-pyran-2-yl)oxy)butyl)-1h-1,2,3-triazol-1-yl)propyl)picolinaldehyde oxime 0.831 71 190
ID Description Score Start End Superfamily
af_Q566U4_36_288_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9029 44 293 3.40.50.1820
af_Q566U4_36_288_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8892 44 293 3.40.50.1820
af_Q63HM1_47_299_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8855 44 293 3.40.50.1820
af_Q63HM1_47_299_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8722 44 293 3.40.50.1820
af_B4FFC7_103_353_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8674 56 277 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1F9KEI6-F1-model_v4 BD-FAE-like domain-containing protein 0.9861 41 298 GO:0016787
AF-A0A536X300-F1-model_v4 Alpha/beta hydrolase 0.9853 71 300 GO:0016787
AF-A0A4Z1CEG4-F1-model_v4 Alpha/beta hydrolase 0.9798 8 298 GO:0016787
AF-A0A537AE93-F1-model_v4 Alpha/beta hydrolase 0.9781 13 300 GO:0016787
AF-A0A4Q5PPN1-F1-model_v4 Alpha/beta hydrolase 0.9776 13 301 GO:0016787

Map