F375370

General Info

Members Datasets Scaffolds Average Seq Length
268 192 268 152

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_101389272|Ga0068863_1013892721
Length 152
Sequence MVEINGVAHTFITAGDFEASRAFYRQLLPFLGLKEVADSPDTYYCVGGRTGFGIRRPDPKHAGMAYEQFRVGSLHHQCWRVRDLAAVDAVHDFLVSIGAKIVHAPQIDAFAPGYYSVLFEDPDGIRLEVNHVPGRGLFDTKEQKVFGTLDER

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0
Rhizoplane 5.22
Rhizosphere 87.31
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10022408 3300003215 Bacteria 2329
2 Ga0055530_10001964 3300003791 Bacteria 14001
3 Ga0055531_10001208 3300003794 Bacteria 19802
4 Ga0065165_1000741 3300005262 Bacteria 45124
5 Ga0070658_10687567 3300005327 Bacteria 888
6 Ga0070680_100033064 3300005336 Bacteria 4166
7 Ga0070689_100000218 3300005340 Bacteria 34123
8 Ga0070671_101344823 3300005355 Unclassified 630
9 Ga0070709_10319754 3300005434 Bacteria 1139
10 Ga0070714_100113532 3300005435 Bacteria 2402
11 Ga0070714_100208504 3300005435 Bacteria 1790
12 Ga0070713_100027107 3300005436 Bacteria 4507
13 Ga0070713_100068117 3300005436 Bacteria 2999
14 Ga0070713_100166802 3300005436 Bacteria 1970
15 Ga0070713_101836752 3300005436 Unclassified 588
16 Ga0070710_10068393 3300005437 Bacteria 2040
17 Ga0070711_100053142 3300005439 Bacteria 2790
18 Ga0070711_100123618 3300005439 Bacteria 1918
19 Ga0070711_100155757 3300005439 Bacteria 1727
20 Ga0070681_10025688 3300005458 Bacteria 5923
21 Ga0070681_10877724 3300005458 Bacteria 815
22 Ga0070706_100490786 3300005467 Bacteria 1143
23 Ga0070707_100013322 3300005468 Bacteria 7691
24 Ga0068853_100245789 3300005539 Bacteria 1641
25 Ga0070665_100303702 3300005548 Bacteria 1599
26 Ga0070665_101332129 3300005548 Unclassified 728
27 Ga0068855_100061698 3300005563 Bacteria 4379
28 Ga0068854_100102925 3300005578 Bacteria 2143
29 Ga0068856_100000055 3300005614 Bacteria 104152
30 Ga0068856_100257919 3300005614 Bacteria 1759
31 Ga0068852_100019381 3300005616 Bacteria 5382
32 Ga0068852_100453261 3300005616 Bacteria 1270
33 Ga0068863_101389272 3300005841 Bacteria 710
34 Ga0068860_100942750 3300005843 Unclassified 880
35 Ga0081455_10362703 3300005937 Bacteria 1018
36 Ga0070717_10099788 3300006028 Bacteria 2464
37 Ga0070716_100017137 3300006173 Bacteria 3751
38 Ga0070716_100180505 3300006173 Bacteria 1385
39 Ga0070716_100885345 3300006173 Bacteria 698
40 Ga0070712_100000314 3300006175 Bacteria 27319
41 Ga0070712_100129930 3300006175 Bacteria 1908
42 Ga0075362_10117079 3300006177 Bacteria 1258
43 Ga0075433_10187497 3300006852 Bacteria 1840
44 Ga0075434_100228502 3300006871 Bacteria 1880
45 Ga0068865_100001871 3300006881 Bacteria 12372
46 Ga0105240_10216323 3300009093 Bacteria 2235
47 Ga0105240_11966378 3300009093 Bacteria 608
48 Ga0105241_10180339 3300009174 Bacteria 1751
49 Ga0105241_10857372 3300009174 Bacteria 841
50 Ga0105248_10010745 3300009177 Bacteria 10105
51 Ga0105237_10220879 3300009545 Bacteria 1895
52 Ga0105238_10127374 3300009551 Bacteria 2525
53 Ga0105238_10470957 3300009551 Bacteria 1255
54 Ga0105238_11166243 3300009551 Bacteria 794
55 Ga0105239_10414915 3300010375 Bacteria 1525
56 Ga0105246_10707501 3300011119 Bacteria 884
57 Ga0157370_10084911 3300013104 Bacteria 2974
58 Ga0157369_10360902 3300013105 Bacteria 1508
59 Ga0157369_10569656 3300013105 Bacteria 1170
60 Ga0157378_12427610 3300013297 Bacteria 576
61 Ga0163162_10093131 3300013306 Bacteria 3098
62 Ga0157372_10090252 3300013307 Bacteria 3483
63 Ga0157372_10978244 3300013307 Bacteria 980
64 Ga0157375_12097699 3300013308 Bacteria 673
65 Ga0163163_12584619 3300014325 Bacteria 565
66 Ga0157380_11612675 3300014326 Bacteria 704
67 Ga0157379_10034604 3300014968 Bacteria 4504
68 Ga0157376_11787904 3300014969 Unclassified 651
69 Ga0209026_1011020 3300025250 Bacteria 1654
70 Ga0209148_1024379 3300025254 Bacteria 956
71 Ga0209148_1026875 3300025254 Bacteria 890
72 Ga0209758_1001910 3300025297 Bacteria 22687
73 Ga0209050_1000121 3300025298 Bacteria 196019
74 Ga0209257_1000125 3300025304 Bacteria 218126
75 Ga0209257_1000888 3300025304 Bacteria 41959
76 Ga0207692_10059748 3300025898 Bacteria 1970
77 Ga0207699_10004986 3300025906 Bacteria 6348
78 Ga0207684_10356635 3300025910 Bacteria 1258
79 Ga0207654_10066875 3300025911 Bacteria 2121
80 Ga0207654_10205982 3300025911 Bacteria 1298
81 Ga0207707_10286650 3300025912 Bacteria 1425
82 Ga0207695_10356300 3300025913 Bacteria 1350
83 Ga0207671_10357110 3300025914 Bacteria 1159
84 Ga0207693_10000276 3300025915 Bacteria 47566
85 Ga0207693_10010222 3300025915 Bacteria 7619
86 Ga0207693_10335222 3300025915 Bacteria 1184
87 Ga0207693_10836098 3300025915 Bacteria 708
88 Ga0207663_10041345 3300025916 Bacteria 2809
89 Ga0207663_10082446 3300025916 Bacteria 2110
90 Ga0207663_10717028 3300025916 Bacteria 793
91 Ga0207660_10534598 3300025917 Bacteria 953
92 Ga0207660_10855311 3300025917 Bacteria 742
93 Ga0207694_10028484 3300025924 Bacteria 4259
94 Ga0207694_10174707 3300025924 Bacteria 1740
95 Ga0207700_10122141 3300025928 Bacteria 2114
96 Ga0207700_10641710 3300025928 Unclassified 946
97 Ga0207664_10332202 3300025929 Bacteria 1343
98 Ga0207644_10957894 3300025931 Unclassified 718
99 Ga0207670_10003672 3300025936 Bacteria 8142
100 Ga0207669_10333881 3300025937 Bacteria 1165
101 Ga0207704_10002011 3300025938 Bacteria 9122
102 Ga0207665_10008780 3300025939 Bacteria 6645
103 Ga0207665_10070165 3300025939 Bacteria 2390
104 Ga0207711_10000424 3300025941 Bacteria 44295
105 Ga0207667_10085113 3300025949 Bacteria 3273
106 Ga0207668_10245942 3300025972 Bacteria 1450
107 Ga0207640_10163445 3300025981 Bacteria 1650
108 Ga0207677_10652842 3300026023 Bacteria 929
109 Ga0207678_10095404 3300026067 Bacteria 2542
110 Ga0207702_10000287 3300026078 Bacteria 58488
111 Ga0207676_10951220 3300026095 Bacteria 845
112 Ga0207674_11435370 3300026116 Bacteria 659
113 Ga0207675_100965412 3300026118 Bacteria 870
114 Ga0207698_10037122 3300026142 Bacteria 3585
115 Ga0268266_10098538 3300028379 Bacteria 2572
116 Ga0268265_11443626 3300028380 Bacteria 691
117 Ga0265334_10022661 3300028573 Unclassified 2557
118 Ga0265338_10064043 3300028800 Bacteria 3201
119 Ga0265338_10120519 3300028800 Bacteria 2092
120 Ga0307511_10290626 3300030521 Bacteria 747
121 Ga0265328_10299107 3300031239 Bacteria 621
122 Ga0265325_10000094 3300031241 Bacteria 62066
123 Ga0265325_10084243 3300031241 Bacteria 1576
124 Ga0265329_10286261 3300031242 Bacteria 555
125 Ga0265339_10007213 3300031249 Bacteria 7203
126 Ga0265339_10019365 3300031249 Bacteria 3997
127 Ga0265339_10021626 3300031249 Bacteria 3738
128 Ga0265331_10010737 3300031250 Bacteria 5046
129 Ga0265327_10000998 3300031251 Bacteria 40192
130 Ga0265316_10010117 3300031344 Bacteria 8616
131 Ga0265316_10059787 3300031344 Bacteria 2963
132 Ga0265316_10617386 3300031344 Bacteria 768
133 Ga0265313_10005358 3300031595 Bacteria 9468
134 Ga0265313_10086475 3300031595 Unclassified 1415
135 Ga0265314_10207569 3300031711 Bacteria 1153
136 Ga0265314_10361956 3300031711 Bacteria 795
137 Ga0307407_10430489 3300031903 Bacteria 953
138 Ga0307510_10079410 3300033180 Bacteria 3200
139 Ga0373945_0183742 3300035116 Bacteria 862
140 Ga0373931_1295750 3300035691 Bacteria 501
141 Ga0373935_0701502 3300035692 Bacteria 744
142 Ga0373927_0272126 3300035695 Bacteria 1114
143 Ga0373927_0428177 3300035695 Bacteria 874
144 Ga0373947_0048319 3300035725 Bacteria 2553
145 Ga0373947_0093036 3300035725 Bacteria 1883
146 Ga0373937_0341322 3300036401 Bacteria 1418
147 Ga0373925_0485820 3300037068 Bacteria 1013
148 Ga0395899_0001662 3300037312 Bacteria 18535
149 Ga0395899_0093505 3300037312 Bacteria 2176
150 Ga0395899_0274192 3300037312 Bacteria 1150
151 Ga0395900_0000052 3300037418 Bacteria 223910
152 Ga0395900_0254398 3300037418 Bacteria 1756
153 Ga0395900_0572576 3300037418 Bacteria 1072
154 Ga0395898_0014051 3300037466 Bacteria 8227
155 Ga0395898_0062211 3300037466 Bacteria 3625
156 Ga0395898_0397910 3300037466 Bacteria 1313
157 Ga0395905_0036952 3300037471 Bacteria 4588
158 Ga0395905_0114281 3300037471 Bacteria 2537
159 Ga0395905_0232726 3300037471 Bacteria 1723
160 Ga0395905_0399676 3300037471 Bacteria 1269
161 Ga0436364_0568932 3300037853 Bacteria 617
162 Ga0395901_0000001 3300038443 Bacteria 800383
163 Ga0395901_0135317 3300038443 Bacteria 2590
164 Ga0395901_1139459 3300038443 Bacteria 748
165 Ga0395901_1309659 3300038443 Bacteria 686
166 Ga0436363_0062555 3300039450 Bacteria 4551
167 Ga0466961_0230762 3300044693 Unclassified 1139
168 Ga0466970_0193531 3300044765 Bacteria 1131
169 Ga0466957_0721310 3300044842 Bacteria 705
170 Ga0466957_0972030 3300044842 Bacteria 609
171 Ga0466960_0025382 3300044901 Bacteria 2682
172 Ga0466958_0181952 3300045836 Bacteria 1334
173 Ga0466958_0792675 3300045836 Bacteria 618
174 Ga0466967_0524442 3300045976 Bacteria 1164
175 Ga0495603_0281718 3300046455 Bacteria 955
176 Ga0495638_0289517 3300046460 Bacteria 887
177 Ga0495641_0345183 3300046461 Unclassified 673
178 Ga0495580_0826995 3300046472 Unclassified 599
179 Ga0495605_0315750 3300046474 Unclassified 659
180 Ga0495639_0166650 3300046475 Bacteria 1068
181 Ga0495585_0089933 3300046492 Bacteria 1654
182 Ga0495585_0488330 3300046492 Unclassified 586
183 Ga0495594_0101413 3300046499 Bacteria 1619
184 Ga0495594_0166853 3300046499 Bacteria 1252
185 Ga0495630_1371418 3300046517 Bacteria 532
186 Ga0495632_0042321 3300046519 Bacteria 2283
187 Ga0495663_0039837 3300046525 Bacteria 1425
188 Ga0495666_0041149 3300046526 Bacteria 2239
189 Ga0495654_0102260 3300046530 Bacteria 1317
190 Ga0495598_0146684 3300046537 Bacteria 820
191 Ga0495645_0313013 3300046543 Bacteria 1022
192 Ga0495622_0253445 3300046557 Bacteria 774
193 Ga0495633_0091328 3300046558 Bacteria 1415
194 Ga0495656_0087730 3300046615 Bacteria 1417
195 Ga0495668_0079536 3300046616 Bacteria 1799
196 Ga0495668_0140740 3300046616 Bacteria 1320
197 Ga0495668_0375126 3300046616 Bacteria 781
198 Ga0495611_0054946 3300046648 Bacteria 1801
199 Ga0495625_0210553 3300046660 Bacteria 1278
200 Ga0495625_0363386 3300046660 Bacteria 912
201 Ga0495659_0200415 3300046664 Bacteria 818
202 Ga0495661_0203311 3300046665 Bacteria 1036
203 Ga0495588_0154122 3300046674 Bacteria 1214
204 Ga0495588_0161150 3300046674 Bacteria 1186
205 Ga0495670_0550611 3300046691 Bacteria 628
206 Ga0495589_0157340 3300046794 Bacteria 1083
207 Ga0495636_0110327 3300047318 Bacteria 1210
208 Ga0495674_0423864 3300047319 Bacteria 1072
209 Ga0495674_0937166 3300047319 Unclassified 667
210 Ga0495676_0295681 3300047321 Bacteria 1093
211 Ga0495677_0190487 3300047445 Unclassified 796
212 Ga0495685_162447 3300047447 Unclassified 723
213 Ga0495681_0280522 3300047470 Unclassified 650
214 Ga0495686_0023047 3300047472 Bacteria 4113
215 Ga0496101_0979533 3300048904 Bacteria 665
216 Ga0496101_1147241 3300048904 Unclassified 610
217 Ga0496105_0128545 3300048908 Bacteria 2089
218 Ga0496105_0519286 3300048908 Unclassified 933
219 Ga0496106_0321602 3300048909 Bacteria 1242
220 Ga0496106_0708990 3300048909 Bacteria 802
221 Ga0496107_0764891 3300048910 Unclassified 708
222 Ga0496108_0943739 3300048911 Bacteria 739
223 Ga0496111_0079390 3300048914 Bacteria 2394
224 Ga0496112_0346883 3300048915 Bacteria 1427
225 Ga0496112_0388636 3300048915 Bacteria 1336
226 Ga0496112_0520660 3300048915 Bacteria 1124
227 Ga0496112_0553856 3300048915 Bacteria 1084
228 Ga0496115_1263937 3300048918 Unclassified 552
229 Ga0501031_0001400 3300049568 Bacteria 14900
230 Ga0501032_0000088 3300049569 Bacteria 79913
231 Ga0501033_0000724 3300049570 Bacteria 30292
232 Ga0501034_0000332 3300049571 Bacteria 82900
233 Ga0501036_0000233 3300049572 Bacteria 37220
234 Ga0501037_0000421 3300049573 Bacteria 35090
235 Ga0501038_0000049 3300049574 Bacteria 100279
236 Ga0501039_0007740 3300049575 Bacteria 8198
237 Ga0501043_0000740 3300049579 Bacteria 28916
238 Ga0501043_0798565 3300049579 Bacteria 683
239 Ga0501046_0000087 3300049580 Bacteria 99252
240 Ga0501047_0001375 3300049581 Bacteria 23892
241 Ga0501047_0056305 3300049581 Bacteria 3802
242 Ga0501047_0138445 3300049581 Bacteria 2313
243 Ga0501048_0000665 3300049582 Bacteria 24850
244 Ga0501067_0000497 3300049583 Bacteria 21556
245 Ga0501068_0001170 3300049584 Bacteria 13935
246 Ga0501069_0046794 3300049585 Bacteria 2400
247 Ga0501069_0551983 3300049585 Bacteria 689
248 Ga0501070_0004024 3300049586 Bacteria 12625
249 Ga0501070_0097509 3300049586 Bacteria 2432
250 Ga0501072_0000535 3300049588 Bacteria 27273
251 Ga0501073_0000112 3300049589 Bacteria 52280
252 Ga0501074_0000225 3300049590 Bacteria 31306
253 Ga0501079_0002907 3300049741 Bacteria 12517
254 Ga0501080_0052221 3300049742 Bacteria 3804
255 Ga0501083_0005430 3300049744 Bacteria 9027
256 Ga0501035_0001854 3300049822 Bacteria 21280
257 Ga0501044_0000182 3300049823 Bacteria 78052
258 Ga0501044_0658134 3300049823 Bacteria 936
259 Ga0501044_0719273 3300049823 Bacteria 883
260 Ga0501045_0194774 3300049824 Bacteria 1510
261 nmdc:mga0yw44_682628_c1 3300050492 Bacteria 698
262 nmdc:mga07m45_318569_c1 3300050496 Bacteria 904
263 nmdc:mga0n895_215769_c1 3300050512 Bacteria 1948
264 nmdc:mga0n895_906176_c1 3300050512 Bacteria 867
265 nmdc:mga0a205_248580_c1 3300050515 Bacteria 1658
266 Ga0500595_007942 3300053119 Bacteria 4361
267 Ga0500645_003949 3300053730 Bacteria 5839
268 Ga0501084_0009033 3300054114 Bacteria 8251

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10187497 Ga0075433_101874972 139
2 3300006871 Ga0075434_100228502 Ga0075434_1002285022 139
3 3300050512 nmdc:mga0n895_906176_c1 nmdc:mga0n895_906176_c1_83_502 139
4 3300050515 nmdc:mga0a205_248580_c1 nmdc:mga0a205_248580_c1_627_1046 139
5 3300005843 Ga0068860_100942750 Ga0068860_1009427502 143
6 3300035691 Ga0373931_1295750 Ga0373931_1295750_49_480 143
7 3300005458 Ga0070681_10877724 Ga0070681_108777241 145
8 3300013297 Ga0157378_12427610 Ga0157378_124276101 145
9 3300028573 Ga0265334_10022661 Ga0265334_100226612 145
10 3300031239 Ga0265328_10299107 Ga0265328_102991071 145
11 3300031249 Ga0265339_10021626 Ga0265339_100216262 145
12 3300031711 Ga0265314_10361956 Ga0265314_103619561 145
13 3300037853 Ga0436364_0568932 Ga0436364_0568932_107_562 145
14 3300005937 Ga0081455_10362703 Ga0081455_103627032 146
15 3300031903 Ga0307407_10430489 Ga0307407_104304892 146
16 3300005340 Ga0070689_100000218 Ga0070689_10000021811 147
17 3300025254 Ga0209148_1026875 Ga0209148_10268751 147
18 3300025936 Ga0207670_10003672 Ga0207670_100036724 147
19 3300026118 Ga0207675_100965412 Ga0207675_1009654122 147
20 3300031251 Ga0265327_10000998 Ga0265327_100009988 147
21 3300033180 Ga0307510_10079410 Ga0307510_100794102 147
22 3300005434 Ga0070709_10319754 Ga0070709_103197542 148
23 3300005435 Ga0070714_100113532 Ga0070714_1001135322 148
24 3300005436 Ga0070713_100027107 Ga0070713_1000271072 148
25 3300013308 Ga0157375_12097699 Ga0157375_120976992 148
26 3300035695 Ga0373927_0272126 Ga0373927_0272126_520_966 148
27 3300005355 Ga0070671_101344823 Ga0070671_1013448231 149
28 3300005435 Ga0070714_100208504 Ga0070714_1002085041 149
29 3300005436 Ga0070713_100068117 Ga0070713_1000681174 149
30 3300005436 Ga0070713_100166802 Ga0070713_1001668022 149
31 3300005436 Ga0070713_101836752 Ga0070713_1018367521 149
32 3300005437 Ga0070710_10068393 Ga0070710_100683932 149
33 3300005439 Ga0070711_100053142 Ga0070711_1000531422 149
34 3300005439 Ga0070711_100123618 Ga0070711_1001236181 149
35 3300005439 Ga0070711_100155757 Ga0070711_1001557573 149
36 3300005467 Ga0070706_100490786 Ga0070706_1004907861 149
37 3300005468 Ga0070707_100013322 Ga0070707_10001332214 149
38 3300005548 Ga0070665_101332129 Ga0070665_1013321292 149
39 3300005614 Ga0068856_100257919 Ga0068856_1002579193 149
40 3300005616 Ga0068852_100453261 Ga0068852_1004532613 149
41 3300006173 Ga0070716_100017137 Ga0070716_1000171375 149
42 3300006173 Ga0070716_100180505 Ga0070716_1001805053 149
43 3300006173 Ga0070716_100885345 Ga0070716_1008853451 149
44 3300006175 Ga0070712_100000314 Ga0070712_10000031410 149
45 3300006175 Ga0070712_100129930 Ga0070712_1001299302 149
46 3300009174 Ga0105241_10857372 Ga0105241_108573721 149
47 3300009545 Ga0105237_10220879 Ga0105237_102208792 149
48 3300009551 Ga0105238_10127374 Ga0105238_101273743 149
49 3300011119 Ga0105246_10707501 Ga0105246_107075011 149
50 3300013105 Ga0157369_10569656 Ga0157369_105696563 149
51 3300013306 Ga0163162_10093131 Ga0163162_100931316 149
52 3300014968 Ga0157379_10034604 Ga0157379_100346044 149
53 3300014969 Ga0157376_11787904 Ga0157376_117879041 149
54 3300025898 Ga0207692_10059748 Ga0207692_100597482 149
55 3300025906 Ga0207699_10004986 Ga0207699_100049862 149
56 3300025910 Ga0207684_10356635 Ga0207684_103566352 149
57 3300025911 Ga0207654_10066875 Ga0207654_100668753 149
58 3300025914 Ga0207671_10357110 Ga0207671_103571102 149
59 3300025915 Ga0207693_10000276 Ga0207693_1000027634 149
60 3300025915 Ga0207693_10010222 Ga0207693_100102222 149
61 3300025915 Ga0207693_10335222 Ga0207693_103352221 149
62 3300025915 Ga0207693_10836098 Ga0207693_108360981 149
63 3300025916 Ga0207663_10041345 Ga0207663_100413454 149
64 3300025916 Ga0207663_10082446 Ga0207663_100824462 149
65 3300025924 Ga0207694_10174707 Ga0207694_101747072 149
66 3300025928 Ga0207700_10122141 Ga0207700_101221411 149
67 3300025929 Ga0207664_10332202 Ga0207664_103322022 149
68 3300025931 Ga0207644_10957894 Ga0207644_109578941 149
69 3300025939 Ga0207665_10008780 Ga0207665_100087806 149
70 3300025939 Ga0207665_10070165 Ga0207665_100701651 149
71 3300025972 Ga0207668_10245942 Ga0207668_102459421 149
72 3300026116 Ga0207674_11435370 Ga0207674_114353701 149
73 3300028800 Ga0265338_10064043 Ga0265338_100640431 149
74 3300028800 Ga0265338_10120519 Ga0265338_101205192 149
75 3300031241 Ga0265325_10000094 Ga0265325_1000009452 149
76 3300031241 Ga0265325_10084243 Ga0265325_100842432 149
77 3300031242 Ga0265329_10286261 Ga0265329_102862611 149
78 3300031249 Ga0265339_10007213 Ga0265339_100072135 149
79 3300031249 Ga0265339_10019365 Ga0265339_100193655 149
80 3300031250 Ga0265331_10010737 Ga0265331_100107375 149
81 3300031344 Ga0265316_10010117 Ga0265316_100101176 149
82 3300031344 Ga0265316_10059787 Ga0265316_100597873 149
83 3300031344 Ga0265316_10617386 Ga0265316_106173862 149
84 3300031595 Ga0265313_10005358 Ga0265313_100053585 149
85 3300031595 Ga0265313_10086475 Ga0265313_100864752 149
86 3300031711 Ga0265314_10207569 Ga0265314_102075692 149
87 3300035116 Ga0373945_0183742 Ga0373945_0183742_365_826 149
88 3300035725 Ga0373947_0093036 Ga0373947_0093036_171_632 149
89 3300036401 Ga0373937_0341322 Ga0373937_0341322_898_1359 149
90 3300037068 Ga0373925_0485820 Ga0373925_0485820_352_813 149
91 3300039450 Ga0436363_0062555 Ga0436363_0062555_1406_1867 149
92 3300045976 Ga0466967_0524442 Ga0466967_0524442_224_685 149
93 3300046455 Ga0495603_0281718 Ga0495603_0281718_174_635 149
94 3300046460 Ga0495638_0289517 Ga0495638_0289517_176_637 149
95 3300046461 Ga0495641_0345183 Ga0495641_0345183_55_516 149
96 3300046472 Ga0495580_0826995 Ga0495580_0826995_62_544 149
97 3300046474 Ga0495605_0315750 Ga0495605_0315750_51_512 149
98 3300046475 Ga0495639_0166650 Ga0495639_0166650_231_692 149
99 3300046492 Ga0495585_0089933 Ga0495585_0089933_1074_1535 149
100 3300046492 Ga0495585_0488330 Ga0495585_0488330_97_558 149
101 3300046499 Ga0495594_0101413 Ga0495594_0101413_328_789 149
102 3300046499 Ga0495594_0166853 Ga0495594_0166853_742_1203 149
103 3300046519 Ga0495632_0042321 Ga0495632_0042321_1023_1484 149
104 3300046525 Ga0495663_0039837 Ga0495663_0039837_37_498 149
105 3300046526 Ga0495666_0041149 Ga0495666_0041149_1730_2191 149
106 3300046530 Ga0495654_0102260 Ga0495654_0102260_832_1293 149
107 3300046537 Ga0495598_0146684 Ga0495598_0146684_219_680 149
108 3300046557 Ga0495622_0253445 Ga0495622_0253445_150_611 149
109 3300046558 Ga0495633_0091328 Ga0495633_0091328_271_732 149
110 3300046615 Ga0495656_0087730 Ga0495656_0087730_850_1311 149
111 3300046616 Ga0495668_0375126 Ga0495668_0375126_155_616 149
112 3300046648 Ga0495611_0054946 Ga0495611_0054946_733_1194 149
113 3300046660 Ga0495625_0210553 Ga0495625_0210553_588_1049 149
114 3300046664 Ga0495659_0200415 Ga0495659_0200415_153_614 149
115 3300046665 Ga0495661_0203311 Ga0495661_0203311_84_545 149
116 3300046674 Ga0495588_0154122 Ga0495588_0154122_141_602 149
117 3300046674 Ga0495588_0161150 Ga0495588_0161150_219_680 149
118 3300046794 Ga0495589_0157340 Ga0495589_0157340_476_937 149
119 3300047318 Ga0495636_0110327 Ga0495636_0110327_129_590 149
120 3300047319 Ga0495674_0423864 Ga0495674_0423864_390_851 149
121 3300047319 Ga0495674_0937166 Ga0495674_0937166_35_496 149
122 3300047321 Ga0495676_0295681 Ga0495676_0295681_611_1072 149
123 3300047445 Ga0495677_0190487 Ga0495677_0190487_27_488 149
124 3300047447 Ga0495685_162447 Ga0495685_162447_123_584 149
125 3300047470 Ga0495681_0280522 Ga0495681_0280522_159_620 149
126 3300048904 Ga0496101_0979533 Ga0496101_0979533_140_601 149
127 3300048904 Ga0496101_1147241 Ga0496101_1147241_40_501 149
128 3300048908 Ga0496105_0128545 Ga0496105_0128545_168_629 149
129 3300048908 Ga0496105_0519286 Ga0496105_0519286_148_615 149
130 3300048909 Ga0496106_0321602 Ga0496106_0321602_367_828 149
131 3300048909 Ga0496106_0708990 Ga0496106_0708990_18_479 149
132 3300048910 Ga0496107_0764891 Ga0496107_0764891_220_681 149
133 3300048911 Ga0496108_0943739 Ga0496108_0943739_123_584 149
134 3300048914 Ga0496111_0079390 Ga0496111_0079390_1470_1931 149
135 3300048915 Ga0496112_0388636 Ga0496112_0388636_426_887 149
136 3300048915 Ga0496112_0553856 Ga0496112_0553856_214_675 149
137 3300048918 Ga0496115_1263937 Ga0496115_1263937_45_506 149
138 3300050512 nmdc:mga0n895_215769_c1 nmdc:mga0n895_215769_c1_216_677 149
139 3300003215 JGI25153J46596_10022408 JGI25153J46596_100224082 150
140 3300003791 Ga0055530_10001964 Ga0055530_100019648 150
141 3300003794 Ga0055531_10001208 Ga0055531_1000120819 150
142 3300005262 Ga0065165_1000741 Ga0065165_100074142 150
143 3300005327 Ga0070658_10687567 Ga0070658_106875671 150
144 3300005336 Ga0070680_100033064 Ga0070680_1000330643 150
145 3300005458 Ga0070681_10025688 Ga0070681_100256885 150
146 3300005539 Ga0068853_100245789 Ga0068853_1002457891 150
147 3300005548 Ga0070665_100303702 Ga0070665_1003037023 150
148 3300005563 Ga0068855_100061698 Ga0068855_1000616983 150
149 3300005578 Ga0068854_100102925 Ga0068854_1001029252 150
150 3300005614 Ga0068856_100000055 Ga0068856_100000055106 150
151 3300005616 Ga0068852_100019381 Ga0068852_1000193813 150
152 3300005841 Ga0068863_101389272 Ga0068863_1013892721 150
153 3300006028 Ga0070717_10099788 Ga0070717_100997882 150
154 3300006177 Ga0075362_10117079 Ga0075362_101170792 150
155 3300006881 Ga0068865_100001871 Ga0068865_1000018719 150
156 3300009093 Ga0105240_10216323 Ga0105240_102163232 150
157 3300009093 Ga0105240_11966378 Ga0105240_119663781 150
158 3300009174 Ga0105241_10180339 Ga0105241_101803392 150
159 3300009177 Ga0105248_10010745 Ga0105248_100107457 150
160 3300009551 Ga0105238_10470957 Ga0105238_104709572 150
161 3300009551 Ga0105238_11166243 Ga0105238_111662432 150
162 3300010375 Ga0105239_10414915 Ga0105239_104149152 150
163 3300013104 Ga0157370_10084911 Ga0157370_100849113 150
164 3300013105 Ga0157369_10360902 Ga0157369_103609022 150
165 3300013307 Ga0157372_10090252 Ga0157372_100902523 150
166 3300013307 Ga0157372_10978244 Ga0157372_109782442 150
167 3300014325 Ga0163163_12584619 Ga0163163_125846191 150
168 3300014326 Ga0157380_11612675 Ga0157380_116126751 150
169 3300025250 Ga0209026_1011020 Ga0209026_10110202 150
170 3300025254 Ga0209148_1024379 Ga0209148_10243792 150
171 3300025297 Ga0209758_1001910 Ga0209758_10019104 150
172 3300025298 Ga0209050_1000121 Ga0209050_1000121121 150
173 3300025304 Ga0209257_1000125 Ga0209257_1000125145 150
174 3300025304 Ga0209257_1000888 Ga0209257_100088841 150
175 3300025911 Ga0207654_10205982 Ga0207654_102059823 150
176 3300025912 Ga0207707_10286650 Ga0207707_102866503 150
177 3300025913 Ga0207695_10356300 Ga0207695_103563002 150
178 3300025916 Ga0207663_10717028 Ga0207663_107170282 150
179 3300025917 Ga0207660_10534598 Ga0207660_105345982 150
180 3300025917 Ga0207660_10855311 Ga0207660_108553112 150
181 3300025924 Ga0207694_10028484 Ga0207694_100284845 150
182 3300025928 Ga0207700_10641710 Ga0207700_106417102 150
183 3300025937 Ga0207669_10333881 Ga0207669_103338812 150
184 3300025938 Ga0207704_10002011 Ga0207704_100020118 150
185 3300025941 Ga0207711_10000424 Ga0207711_100004246 150
186 3300025949 Ga0207667_10085113 Ga0207667_100851133 150
187 3300025981 Ga0207640_10163445 Ga0207640_101634452 150
188 3300026023 Ga0207677_10652842 Ga0207677_106528422 150
189 3300026067 Ga0207678_10095404 Ga0207678_100954041 150
190 3300026078 Ga0207702_10000287 Ga0207702_1000028736 150
191 3300026095 Ga0207676_10951220 Ga0207676_109512202 150
192 3300026142 Ga0207698_10037122 Ga0207698_100371222 150
193 3300028379 Ga0268266_10098538 Ga0268266_100985382 150
194 3300028380 Ga0268265_11443626 Ga0268265_114436261 150
195 3300030521 Ga0307511_10290626 Ga0307511_102906262 150
196 3300035692 Ga0373935_0701502 Ga0373935_0701502_72_524 150
197 3300035695 Ga0373927_0428177 Ga0373927_0428177_131_595 150
198 3300035725 Ga0373947_0048319 Ga0373947_0048319_1176_1628 150
199 3300037312 Ga0395899_0001662 Ga0395899_0001662_1416_1868 150
200 3300037312 Ga0395899_0093505 Ga0395899_0093505_413_865 150
201 3300037312 Ga0395899_0274192 Ga0395899_0274192_497_949 150
202 3300037418 Ga0395900_0000052 Ga0395900_0000052_185878_186330 150
203 3300037418 Ga0395900_0254398 Ga0395900_0254398_207_659 150
204 3300037418 Ga0395900_0572576 Ga0395900_0572576_98_550 150
205 3300037466 Ga0395898_0014051 Ga0395898_0014051_1743_2195 150
206 3300037466 Ga0395898_0062211 Ga0395898_0062211_1541_1993 150
207 3300037466 Ga0395898_0397910 Ga0395898_0397910_249_701 150
208 3300037471 Ga0395905_0036952 Ga0395905_0036952_2131_2583 150
209 3300037471 Ga0395905_0114281 Ga0395905_0114281_753_1292 150
210 3300037471 Ga0395905_0232726 Ga0395905_0232726_710_1162 150
211 3300037471 Ga0395905_0399676 Ga0395905_0399676_489_941 150
212 3300038443 Ga0395901_0000001 Ga0395901_0000001_601672_602124 150
213 3300038443 Ga0395901_0135317 Ga0395901_0135317_382_834 150
214 3300038443 Ga0395901_1139459 Ga0395901_1139459_19_471 150
215 3300038443 Ga0395901_1309659 Ga0395901_1309659_39_509 150
216 3300044693 Ga0466961_0230762 Ga0466961_0230762_64_516 150
217 3300044765 Ga0466970_0193531 Ga0466970_0193531_521_973 150
218 3300044842 Ga0466957_0721310 Ga0466957_0721310_172_624 150
219 3300044842 Ga0466957_0972030 Ga0466957_0972030_96_548 150
220 3300044901 Ga0466960_0025382 Ga0466960_0025382_521_973 150
221 3300045836 Ga0466958_0181952 Ga0466958_0181952_140_592 150
222 3300045836 Ga0466958_0792675 Ga0466958_0792675_135_587 150
223 3300046517 Ga0495630_1371418 Ga0495630_1371418_49_504 150
224 3300046543 Ga0495645_0313013 Ga0495645_0313013_387_842 150
225 3300046616 Ga0495668_0079536 Ga0495668_0079536_82_543 150
226 3300046616 Ga0495668_0140740 Ga0495668_0140740_549_1001 150
227 3300046660 Ga0495625_0363386 Ga0495625_0363386_110_562 150
228 3300046691 Ga0495670_0550611 Ga0495670_0550611_81_536 150
229 3300047472 Ga0495686_0023047 Ga0495686_0023047_1122_1574 150
230 3300048915 Ga0496112_0346883 Ga0496112_0346883_272_724 150
231 3300048915 Ga0496112_0520660 Ga0496112_0520660_564_1016 150
232 3300049568 Ga0501031_0001400 Ga0501031_0001400_7359_7823 150
233 3300049569 Ga0501032_0000088 Ga0501032_0000088_1718_2182 150
234 3300049570 Ga0501033_0000724 Ga0501033_0000724_15269_15733 150
235 3300049571 Ga0501034_0000332 Ga0501034_0000332_51897_52361 150
236 3300049572 Ga0501036_0000233 Ga0501036_0000233_15269_15733 150
237 3300049573 Ga0501037_0000421 Ga0501037_0000421_19042_19506 150
238 3300049574 Ga0501038_0000049 Ga0501038_0000049_12569_13033 150
239 3300049575 Ga0501039_0007740 Ga0501039_0007740_7523_7987 150
240 3300049579 Ga0501043_0000740 Ga0501043_0000740_7065_7529 150
241 3300049579 Ga0501043_0798565 Ga0501043_0798565_182_646 150
242 3300049580 Ga0501046_0000087 Ga0501046_0000087_89506_89970 150
243 3300049581 Ga0501047_0001375 Ga0501047_0001375_15907_16371 150
244 3300049581 Ga0501047_0056305 Ga0501047_0056305_925_1377 150
245 3300049581 Ga0501047_0138445 Ga0501047_0138445_455_919 150
246 3300049582 Ga0501048_0000665 Ga0501048_0000665_16988_17452 150
247 3300049583 Ga0501067_0000497 Ga0501067_0000497_8006_8470 150
248 3300049584 Ga0501068_0001170 Ga0501068_0001170_7689_8153 150
249 3300049585 Ga0501069_0046794 Ga0501069_0046794_610_1074 150
250 3300049585 Ga0501069_0551983 Ga0501069_0551983_69_533 150
251 3300049586 Ga0501070_0004024 Ga0501070_0004024_2603_3067 150
252 3300049586 Ga0501070_0097509 Ga0501070_0097509_1936_2400 150
253 3300049588 Ga0501072_0000535 Ga0501072_0000535_17768_18232 150
254 3300049589 Ga0501073_0000112 Ga0501073_0000112_35929_36393 150
255 3300049590 Ga0501074_0000225 Ga0501074_0000225_9087_9551 150
256 3300049741 Ga0501079_0002907 Ga0501079_0002907_5900_6364 150
257 3300049742 Ga0501080_0052221 Ga0501080_0052221_1964_2428 150
258 3300049744 Ga0501083_0005430 Ga0501083_0005430_4699_5163 150
259 3300049822 Ga0501035_0001854 Ga0501035_0001854_16204_16668 150
260 3300049823 Ga0501044_0000182 Ga0501044_0000182_2462_2926 150
261 3300049823 Ga0501044_0658134 Ga0501044_0658134_474_926 150
262 3300049823 Ga0501044_0719273 Ga0501044_0719273_179_631 150
263 3300049824 Ga0501045_0194774 Ga0501045_0194774_788_1252 150
264 3300050492 nmdc:mga0yw44_682628_c1 nmdc:mga0yw44_682628_c1_180_638 150
265 3300050496 nmdc:mga07m45_318569_c1 nmdc:mga07m45_318569_c1_257_709 150
266 3300053119 Ga0500595_007942 Ga0500595_007942_94_546 150
267 3300053730 Ga0500645_003949 Ga0500645_003949_2516_2968 150
268 3300054114 Ga0501084_0009033 Ga0501084_0009033_4608_5072 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

129

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ct8-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase (np_243026.1) from bacillus halodurans at 2.10 a resolution 0.8683 4 129
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8316 8 129
3ct8-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase (np_243026.1) from bacillus halodurans at 2.10 a resolution 0.8199 4 129
5vb0-assembly6.cif.gz_H crystal structure of fosfomycin resistance protein fosa3 0.817 2 129
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8121 2 129
ID Description Score Start End Superfamily
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8827 74 128 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.871 74 129 3.30.720.110
3ct8A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8657 4 129 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8316 8 129 3.10.180.10
3ct8A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8232 4 129 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1F9CH45-F1-model_v4 VOC domain-containing protein 0.9838 1 136
AF-A0A523KMG3-F1-model_v4 VOC family protein 0.9816 1 139
AF-A0A4Q5XVN5-F1-model_v4 VOC family protein 0.9802 1 128
AF-A0A2S6RIG0-F1-model_v4 VOC domain-containing protein 0.9778 3 139
AF-A0A2D6T0L7-F1-model_v4 Bleomycin resistance protein 0.9727 1 85

Feature Viewer

pLDDT pTM Quality
94.57 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map