F375370
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 192 | 268 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_101389272|Ga0068863_1013892721 |
| Length | 152 |
| Sequence | MVEINGVAHTFITAGDFEASRAFYRQLLPFLGLKEVADSPDTYYCVGGRTGFGIRRPDPKHAGMAYEQFRVGSLHHQCWRVRDLAAVDAVHDFLVSIGAKIVHAPQIDAFAPGYYSVLFEDPDGIRLEVNHVPGRGLFDTKEQKVFGTLDER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 3 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 25 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 30 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 31 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 51 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 89 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 91 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 96 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 99 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 100 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 101 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 102 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 103 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 104 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 105 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 114 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 115 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 116 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 117 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 155 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 159 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 187 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 191 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 192 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.6 |
| Nodule | 0 |
| Rhizoplane | 5.22 |
| Rhizosphere | 87.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10022408 | 3300003215 | Bacteria | 2329 |
| 2 | Ga0055530_10001964 | 3300003791 | Bacteria | 14001 |
| 3 | Ga0055531_10001208 | 3300003794 | Bacteria | 19802 |
| 4 | Ga0065165_1000741 | 3300005262 | Bacteria | 45124 |
| 5 | Ga0070658_10687567 | 3300005327 | Bacteria | 888 |
| 6 | Ga0070680_100033064 | 3300005336 | Bacteria | 4166 |
| 7 | Ga0070689_100000218 | 3300005340 | Bacteria | 34123 |
| 8 | Ga0070671_101344823 | 3300005355 | Unclassified | 630 |
| 9 | Ga0070709_10319754 | 3300005434 | Bacteria | 1139 |
| 10 | Ga0070714_100113532 | 3300005435 | Bacteria | 2402 |
| 11 | Ga0070714_100208504 | 3300005435 | Bacteria | 1790 |
| 12 | Ga0070713_100027107 | 3300005436 | Bacteria | 4507 |
| 13 | Ga0070713_100068117 | 3300005436 | Bacteria | 2999 |
| 14 | Ga0070713_100166802 | 3300005436 | Bacteria | 1970 |
| 15 | Ga0070713_101836752 | 3300005436 | Unclassified | 588 |
| 16 | Ga0070710_10068393 | 3300005437 | Bacteria | 2040 |
| 17 | Ga0070711_100053142 | 3300005439 | Bacteria | 2790 |
| 18 | Ga0070711_100123618 | 3300005439 | Bacteria | 1918 |
| 19 | Ga0070711_100155757 | 3300005439 | Bacteria | 1727 |
| 20 | Ga0070681_10025688 | 3300005458 | Bacteria | 5923 |
| 21 | Ga0070681_10877724 | 3300005458 | Bacteria | 815 |
| 22 | Ga0070706_100490786 | 3300005467 | Bacteria | 1143 |
| 23 | Ga0070707_100013322 | 3300005468 | Bacteria | 7691 |
| 24 | Ga0068853_100245789 | 3300005539 | Bacteria | 1641 |
| 25 | Ga0070665_100303702 | 3300005548 | Bacteria | 1599 |
| 26 | Ga0070665_101332129 | 3300005548 | Unclassified | 728 |
| 27 | Ga0068855_100061698 | 3300005563 | Bacteria | 4379 |
| 28 | Ga0068854_100102925 | 3300005578 | Bacteria | 2143 |
| 29 | Ga0068856_100000055 | 3300005614 | Bacteria | 104152 |
| 30 | Ga0068856_100257919 | 3300005614 | Bacteria | 1759 |
| 31 | Ga0068852_100019381 | 3300005616 | Bacteria | 5382 |
| 32 | Ga0068852_100453261 | 3300005616 | Bacteria | 1270 |
| 33 | Ga0068863_101389272 | 3300005841 | Bacteria | 710 |
| 34 | Ga0068860_100942750 | 3300005843 | Unclassified | 880 |
| 35 | Ga0081455_10362703 | 3300005937 | Bacteria | 1018 |
| 36 | Ga0070717_10099788 | 3300006028 | Bacteria | 2464 |
| 37 | Ga0070716_100017137 | 3300006173 | Bacteria | 3751 |
| 38 | Ga0070716_100180505 | 3300006173 | Bacteria | 1385 |
| 39 | Ga0070716_100885345 | 3300006173 | Bacteria | 698 |
| 40 | Ga0070712_100000314 | 3300006175 | Bacteria | 27319 |
| 41 | Ga0070712_100129930 | 3300006175 | Bacteria | 1908 |
| 42 | Ga0075362_10117079 | 3300006177 | Bacteria | 1258 |
| 43 | Ga0075433_10187497 | 3300006852 | Bacteria | 1840 |
| 44 | Ga0075434_100228502 | 3300006871 | Bacteria | 1880 |
| 45 | Ga0068865_100001871 | 3300006881 | Bacteria | 12372 |
| 46 | Ga0105240_10216323 | 3300009093 | Bacteria | 2235 |
| 47 | Ga0105240_11966378 | 3300009093 | Bacteria | 608 |
| 48 | Ga0105241_10180339 | 3300009174 | Bacteria | 1751 |
| 49 | Ga0105241_10857372 | 3300009174 | Bacteria | 841 |
| 50 | Ga0105248_10010745 | 3300009177 | Bacteria | 10105 |
| 51 | Ga0105237_10220879 | 3300009545 | Bacteria | 1895 |
| 52 | Ga0105238_10127374 | 3300009551 | Bacteria | 2525 |
| 53 | Ga0105238_10470957 | 3300009551 | Bacteria | 1255 |
| 54 | Ga0105238_11166243 | 3300009551 | Bacteria | 794 |
| 55 | Ga0105239_10414915 | 3300010375 | Bacteria | 1525 |
| 56 | Ga0105246_10707501 | 3300011119 | Bacteria | 884 |
| 57 | Ga0157370_10084911 | 3300013104 | Bacteria | 2974 |
| 58 | Ga0157369_10360902 | 3300013105 | Bacteria | 1508 |
| 59 | Ga0157369_10569656 | 3300013105 | Bacteria | 1170 |
| 60 | Ga0157378_12427610 | 3300013297 | Bacteria | 576 |
| 61 | Ga0163162_10093131 | 3300013306 | Bacteria | 3098 |
| 62 | Ga0157372_10090252 | 3300013307 | Bacteria | 3483 |
| 63 | Ga0157372_10978244 | 3300013307 | Bacteria | 980 |
| 64 | Ga0157375_12097699 | 3300013308 | Bacteria | 673 |
| 65 | Ga0163163_12584619 | 3300014325 | Bacteria | 565 |
| 66 | Ga0157380_11612675 | 3300014326 | Bacteria | 704 |
| 67 | Ga0157379_10034604 | 3300014968 | Bacteria | 4504 |
| 68 | Ga0157376_11787904 | 3300014969 | Unclassified | 651 |
| 69 | Ga0209026_1011020 | 3300025250 | Bacteria | 1654 |
| 70 | Ga0209148_1024379 | 3300025254 | Bacteria | 956 |
| 71 | Ga0209148_1026875 | 3300025254 | Bacteria | 890 |
| 72 | Ga0209758_1001910 | 3300025297 | Bacteria | 22687 |
| 73 | Ga0209050_1000121 | 3300025298 | Bacteria | 196019 |
| 74 | Ga0209257_1000125 | 3300025304 | Bacteria | 218126 |
| 75 | Ga0209257_1000888 | 3300025304 | Bacteria | 41959 |
| 76 | Ga0207692_10059748 | 3300025898 | Bacteria | 1970 |
| 77 | Ga0207699_10004986 | 3300025906 | Bacteria | 6348 |
| 78 | Ga0207684_10356635 | 3300025910 | Bacteria | 1258 |
| 79 | Ga0207654_10066875 | 3300025911 | Bacteria | 2121 |
| 80 | Ga0207654_10205982 | 3300025911 | Bacteria | 1298 |
| 81 | Ga0207707_10286650 | 3300025912 | Bacteria | 1425 |
| 82 | Ga0207695_10356300 | 3300025913 | Bacteria | 1350 |
| 83 | Ga0207671_10357110 | 3300025914 | Bacteria | 1159 |
| 84 | Ga0207693_10000276 | 3300025915 | Bacteria | 47566 |
| 85 | Ga0207693_10010222 | 3300025915 | Bacteria | 7619 |
| 86 | Ga0207693_10335222 | 3300025915 | Bacteria | 1184 |
| 87 | Ga0207693_10836098 | 3300025915 | Bacteria | 708 |
| 88 | Ga0207663_10041345 | 3300025916 | Bacteria | 2809 |
| 89 | Ga0207663_10082446 | 3300025916 | Bacteria | 2110 |
| 90 | Ga0207663_10717028 | 3300025916 | Bacteria | 793 |
| 91 | Ga0207660_10534598 | 3300025917 | Bacteria | 953 |
| 92 | Ga0207660_10855311 | 3300025917 | Bacteria | 742 |
| 93 | Ga0207694_10028484 | 3300025924 | Bacteria | 4259 |
| 94 | Ga0207694_10174707 | 3300025924 | Bacteria | 1740 |
| 95 | Ga0207700_10122141 | 3300025928 | Bacteria | 2114 |
| 96 | Ga0207700_10641710 | 3300025928 | Unclassified | 946 |
| 97 | Ga0207664_10332202 | 3300025929 | Bacteria | 1343 |
| 98 | Ga0207644_10957894 | 3300025931 | Unclassified | 718 |
| 99 | Ga0207670_10003672 | 3300025936 | Bacteria | 8142 |
| 100 | Ga0207669_10333881 | 3300025937 | Bacteria | 1165 |
| 101 | Ga0207704_10002011 | 3300025938 | Bacteria | 9122 |
| 102 | Ga0207665_10008780 | 3300025939 | Bacteria | 6645 |
| 103 | Ga0207665_10070165 | 3300025939 | Bacteria | 2390 |
| 104 | Ga0207711_10000424 | 3300025941 | Bacteria | 44295 |
| 105 | Ga0207667_10085113 | 3300025949 | Bacteria | 3273 |
| 106 | Ga0207668_10245942 | 3300025972 | Bacteria | 1450 |
| 107 | Ga0207640_10163445 | 3300025981 | Bacteria | 1650 |
| 108 | Ga0207677_10652842 | 3300026023 | Bacteria | 929 |
| 109 | Ga0207678_10095404 | 3300026067 | Bacteria | 2542 |
| 110 | Ga0207702_10000287 | 3300026078 | Bacteria | 58488 |
| 111 | Ga0207676_10951220 | 3300026095 | Bacteria | 845 |
| 112 | Ga0207674_11435370 | 3300026116 | Bacteria | 659 |
| 113 | Ga0207675_100965412 | 3300026118 | Bacteria | 870 |
| 114 | Ga0207698_10037122 | 3300026142 | Bacteria | 3585 |
| 115 | Ga0268266_10098538 | 3300028379 | Bacteria | 2572 |
| 116 | Ga0268265_11443626 | 3300028380 | Bacteria | 691 |
| 117 | Ga0265334_10022661 | 3300028573 | Unclassified | 2557 |
| 118 | Ga0265338_10064043 | 3300028800 | Bacteria | 3201 |
| 119 | Ga0265338_10120519 | 3300028800 | Bacteria | 2092 |
| 120 | Ga0307511_10290626 | 3300030521 | Bacteria | 747 |
| 121 | Ga0265328_10299107 | 3300031239 | Bacteria | 621 |
| 122 | Ga0265325_10000094 | 3300031241 | Bacteria | 62066 |
| 123 | Ga0265325_10084243 | 3300031241 | Bacteria | 1576 |
| 124 | Ga0265329_10286261 | 3300031242 | Bacteria | 555 |
| 125 | Ga0265339_10007213 | 3300031249 | Bacteria | 7203 |
| 126 | Ga0265339_10019365 | 3300031249 | Bacteria | 3997 |
| 127 | Ga0265339_10021626 | 3300031249 | Bacteria | 3738 |
| 128 | Ga0265331_10010737 | 3300031250 | Bacteria | 5046 |
| 129 | Ga0265327_10000998 | 3300031251 | Bacteria | 40192 |
| 130 | Ga0265316_10010117 | 3300031344 | Bacteria | 8616 |
| 131 | Ga0265316_10059787 | 3300031344 | Bacteria | 2963 |
| 132 | Ga0265316_10617386 | 3300031344 | Bacteria | 768 |
| 133 | Ga0265313_10005358 | 3300031595 | Bacteria | 9468 |
| 134 | Ga0265313_10086475 | 3300031595 | Unclassified | 1415 |
| 135 | Ga0265314_10207569 | 3300031711 | Bacteria | 1153 |
| 136 | Ga0265314_10361956 | 3300031711 | Bacteria | 795 |
| 137 | Ga0307407_10430489 | 3300031903 | Bacteria | 953 |
| 138 | Ga0307510_10079410 | 3300033180 | Bacteria | 3200 |
| 139 | Ga0373945_0183742 | 3300035116 | Bacteria | 862 |
| 140 | Ga0373931_1295750 | 3300035691 | Bacteria | 501 |
| 141 | Ga0373935_0701502 | 3300035692 | Bacteria | 744 |
| 142 | Ga0373927_0272126 | 3300035695 | Bacteria | 1114 |
| 143 | Ga0373927_0428177 | 3300035695 | Bacteria | 874 |
| 144 | Ga0373947_0048319 | 3300035725 | Bacteria | 2553 |
| 145 | Ga0373947_0093036 | 3300035725 | Bacteria | 1883 |
| 146 | Ga0373937_0341322 | 3300036401 | Bacteria | 1418 |
| 147 | Ga0373925_0485820 | 3300037068 | Bacteria | 1013 |
| 148 | Ga0395899_0001662 | 3300037312 | Bacteria | 18535 |
| 149 | Ga0395899_0093505 | 3300037312 | Bacteria | 2176 |
| 150 | Ga0395899_0274192 | 3300037312 | Bacteria | 1150 |
| 151 | Ga0395900_0000052 | 3300037418 | Bacteria | 223910 |
| 152 | Ga0395900_0254398 | 3300037418 | Bacteria | 1756 |
| 153 | Ga0395900_0572576 | 3300037418 | Bacteria | 1072 |
| 154 | Ga0395898_0014051 | 3300037466 | Bacteria | 8227 |
| 155 | Ga0395898_0062211 | 3300037466 | Bacteria | 3625 |
| 156 | Ga0395898_0397910 | 3300037466 | Bacteria | 1313 |
| 157 | Ga0395905_0036952 | 3300037471 | Bacteria | 4588 |
| 158 | Ga0395905_0114281 | 3300037471 | Bacteria | 2537 |
| 159 | Ga0395905_0232726 | 3300037471 | Bacteria | 1723 |
| 160 | Ga0395905_0399676 | 3300037471 | Bacteria | 1269 |
| 161 | Ga0436364_0568932 | 3300037853 | Bacteria | 617 |
| 162 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 163 | Ga0395901_0135317 | 3300038443 | Bacteria | 2590 |
| 164 | Ga0395901_1139459 | 3300038443 | Bacteria | 748 |
| 165 | Ga0395901_1309659 | 3300038443 | Bacteria | 686 |
| 166 | Ga0436363_0062555 | 3300039450 | Bacteria | 4551 |
| 167 | Ga0466961_0230762 | 3300044693 | Unclassified | 1139 |
| 168 | Ga0466970_0193531 | 3300044765 | Bacteria | 1131 |
| 169 | Ga0466957_0721310 | 3300044842 | Bacteria | 705 |
| 170 | Ga0466957_0972030 | 3300044842 | Bacteria | 609 |
| 171 | Ga0466960_0025382 | 3300044901 | Bacteria | 2682 |
| 172 | Ga0466958_0181952 | 3300045836 | Bacteria | 1334 |
| 173 | Ga0466958_0792675 | 3300045836 | Bacteria | 618 |
| 174 | Ga0466967_0524442 | 3300045976 | Bacteria | 1164 |
| 175 | Ga0495603_0281718 | 3300046455 | Bacteria | 955 |
| 176 | Ga0495638_0289517 | 3300046460 | Bacteria | 887 |
| 177 | Ga0495641_0345183 | 3300046461 | Unclassified | 673 |
| 178 | Ga0495580_0826995 | 3300046472 | Unclassified | 599 |
| 179 | Ga0495605_0315750 | 3300046474 | Unclassified | 659 |
| 180 | Ga0495639_0166650 | 3300046475 | Bacteria | 1068 |
| 181 | Ga0495585_0089933 | 3300046492 | Bacteria | 1654 |
| 182 | Ga0495585_0488330 | 3300046492 | Unclassified | 586 |
| 183 | Ga0495594_0101413 | 3300046499 | Bacteria | 1619 |
| 184 | Ga0495594_0166853 | 3300046499 | Bacteria | 1252 |
| 185 | Ga0495630_1371418 | 3300046517 | Bacteria | 532 |
| 186 | Ga0495632_0042321 | 3300046519 | Bacteria | 2283 |
| 187 | Ga0495663_0039837 | 3300046525 | Bacteria | 1425 |
| 188 | Ga0495666_0041149 | 3300046526 | Bacteria | 2239 |
| 189 | Ga0495654_0102260 | 3300046530 | Bacteria | 1317 |
| 190 | Ga0495598_0146684 | 3300046537 | Bacteria | 820 |
| 191 | Ga0495645_0313013 | 3300046543 | Bacteria | 1022 |
| 192 | Ga0495622_0253445 | 3300046557 | Bacteria | 774 |
| 193 | Ga0495633_0091328 | 3300046558 | Bacteria | 1415 |
| 194 | Ga0495656_0087730 | 3300046615 | Bacteria | 1417 |
| 195 | Ga0495668_0079536 | 3300046616 | Bacteria | 1799 |
| 196 | Ga0495668_0140740 | 3300046616 | Bacteria | 1320 |
| 197 | Ga0495668_0375126 | 3300046616 | Bacteria | 781 |
| 198 | Ga0495611_0054946 | 3300046648 | Bacteria | 1801 |
| 199 | Ga0495625_0210553 | 3300046660 | Bacteria | 1278 |
| 200 | Ga0495625_0363386 | 3300046660 | Bacteria | 912 |
| 201 | Ga0495659_0200415 | 3300046664 | Bacteria | 818 |
| 202 | Ga0495661_0203311 | 3300046665 | Bacteria | 1036 |
| 203 | Ga0495588_0154122 | 3300046674 | Bacteria | 1214 |
| 204 | Ga0495588_0161150 | 3300046674 | Bacteria | 1186 |
| 205 | Ga0495670_0550611 | 3300046691 | Bacteria | 628 |
| 206 | Ga0495589_0157340 | 3300046794 | Bacteria | 1083 |
| 207 | Ga0495636_0110327 | 3300047318 | Bacteria | 1210 |
| 208 | Ga0495674_0423864 | 3300047319 | Bacteria | 1072 |
| 209 | Ga0495674_0937166 | 3300047319 | Unclassified | 667 |
| 210 | Ga0495676_0295681 | 3300047321 | Bacteria | 1093 |
| 211 | Ga0495677_0190487 | 3300047445 | Unclassified | 796 |
| 212 | Ga0495685_162447 | 3300047447 | Unclassified | 723 |
| 213 | Ga0495681_0280522 | 3300047470 | Unclassified | 650 |
| 214 | Ga0495686_0023047 | 3300047472 | Bacteria | 4113 |
| 215 | Ga0496101_0979533 | 3300048904 | Bacteria | 665 |
| 216 | Ga0496101_1147241 | 3300048904 | Unclassified | 610 |
| 217 | Ga0496105_0128545 | 3300048908 | Bacteria | 2089 |
| 218 | Ga0496105_0519286 | 3300048908 | Unclassified | 933 |
| 219 | Ga0496106_0321602 | 3300048909 | Bacteria | 1242 |
| 220 | Ga0496106_0708990 | 3300048909 | Bacteria | 802 |
| 221 | Ga0496107_0764891 | 3300048910 | Unclassified | 708 |
| 222 | Ga0496108_0943739 | 3300048911 | Bacteria | 739 |
| 223 | Ga0496111_0079390 | 3300048914 | Bacteria | 2394 |
| 224 | Ga0496112_0346883 | 3300048915 | Bacteria | 1427 |
| 225 | Ga0496112_0388636 | 3300048915 | Bacteria | 1336 |
| 226 | Ga0496112_0520660 | 3300048915 | Bacteria | 1124 |
| 227 | Ga0496112_0553856 | 3300048915 | Bacteria | 1084 |
| 228 | Ga0496115_1263937 | 3300048918 | Unclassified | 552 |
| 229 | Ga0501031_0001400 | 3300049568 | Bacteria | 14900 |
| 230 | Ga0501032_0000088 | 3300049569 | Bacteria | 79913 |
| 231 | Ga0501033_0000724 | 3300049570 | Bacteria | 30292 |
| 232 | Ga0501034_0000332 | 3300049571 | Bacteria | 82900 |
| 233 | Ga0501036_0000233 | 3300049572 | Bacteria | 37220 |
| 234 | Ga0501037_0000421 | 3300049573 | Bacteria | 35090 |
| 235 | Ga0501038_0000049 | 3300049574 | Bacteria | 100279 |
| 236 | Ga0501039_0007740 | 3300049575 | Bacteria | 8198 |
| 237 | Ga0501043_0000740 | 3300049579 | Bacteria | 28916 |
| 238 | Ga0501043_0798565 | 3300049579 | Bacteria | 683 |
| 239 | Ga0501046_0000087 | 3300049580 | Bacteria | 99252 |
| 240 | Ga0501047_0001375 | 3300049581 | Bacteria | 23892 |
| 241 | Ga0501047_0056305 | 3300049581 | Bacteria | 3802 |
| 242 | Ga0501047_0138445 | 3300049581 | Bacteria | 2313 |
| 243 | Ga0501048_0000665 | 3300049582 | Bacteria | 24850 |
| 244 | Ga0501067_0000497 | 3300049583 | Bacteria | 21556 |
| 245 | Ga0501068_0001170 | 3300049584 | Bacteria | 13935 |
| 246 | Ga0501069_0046794 | 3300049585 | Bacteria | 2400 |
| 247 | Ga0501069_0551983 | 3300049585 | Bacteria | 689 |
| 248 | Ga0501070_0004024 | 3300049586 | Bacteria | 12625 |
| 249 | Ga0501070_0097509 | 3300049586 | Bacteria | 2432 |
| 250 | Ga0501072_0000535 | 3300049588 | Bacteria | 27273 |
| 251 | Ga0501073_0000112 | 3300049589 | Bacteria | 52280 |
| 252 | Ga0501074_0000225 | 3300049590 | Bacteria | 31306 |
| 253 | Ga0501079_0002907 | 3300049741 | Bacteria | 12517 |
| 254 | Ga0501080_0052221 | 3300049742 | Bacteria | 3804 |
| 255 | Ga0501083_0005430 | 3300049744 | Bacteria | 9027 |
| 256 | Ga0501035_0001854 | 3300049822 | Bacteria | 21280 |
| 257 | Ga0501044_0000182 | 3300049823 | Bacteria | 78052 |
| 258 | Ga0501044_0658134 | 3300049823 | Bacteria | 936 |
| 259 | Ga0501044_0719273 | 3300049823 | Bacteria | 883 |
| 260 | Ga0501045_0194774 | 3300049824 | Bacteria | 1510 |
| 261 | nmdc:mga0yw44_682628_c1 | 3300050492 | Bacteria | 698 |
| 262 | nmdc:mga07m45_318569_c1 | 3300050496 | Bacteria | 904 |
| 263 | nmdc:mga0n895_215769_c1 | 3300050512 | Bacteria | 1948 |
| 264 | nmdc:mga0n895_906176_c1 | 3300050512 | Bacteria | 867 |
| 265 | nmdc:mga0a205_248580_c1 | 3300050515 | Bacteria | 1658 |
| 266 | Ga0500595_007942 | 3300053119 | Bacteria | 4361 |
| 267 | Ga0500645_003949 | 3300053730 | Bacteria | 5839 |
| 268 | Ga0501084_0009033 | 3300054114 | Bacteria | 8251 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006852 | Ga0075433_10187497 | Ga0075433_101874972 | 139 |
| 2 | 3300006871 | Ga0075434_100228502 | Ga0075434_1002285022 | 139 |
| 3 | 3300050512 | nmdc:mga0n895_906176_c1 | nmdc:mga0n895_906176_c1_83_502 | 139 |
| 4 | 3300050515 | nmdc:mga0a205_248580_c1 | nmdc:mga0a205_248580_c1_627_1046 | 139 |
| 5 | 3300005843 | Ga0068860_100942750 | Ga0068860_1009427502 | 143 |
| 6 | 3300035691 | Ga0373931_1295750 | Ga0373931_1295750_49_480 | 143 |
| 7 | 3300005458 | Ga0070681_10877724 | Ga0070681_108777241 | 145 |
| 8 | 3300013297 | Ga0157378_12427610 | Ga0157378_124276101 | 145 |
| 9 | 3300028573 | Ga0265334_10022661 | Ga0265334_100226612 | 145 |
| 10 | 3300031239 | Ga0265328_10299107 | Ga0265328_102991071 | 145 |
| 11 | 3300031249 | Ga0265339_10021626 | Ga0265339_100216262 | 145 |
| 12 | 3300031711 | Ga0265314_10361956 | Ga0265314_103619561 | 145 |
| 13 | 3300037853 | Ga0436364_0568932 | Ga0436364_0568932_107_562 | 145 |
| 14 | 3300005937 | Ga0081455_10362703 | Ga0081455_103627032 | 146 |
| 15 | 3300031903 | Ga0307407_10430489 | Ga0307407_104304892 | 146 |
| 16 | 3300005340 | Ga0070689_100000218 | Ga0070689_10000021811 | 147 |
| 17 | 3300025254 | Ga0209148_1026875 | Ga0209148_10268751 | 147 |
| 18 | 3300025936 | Ga0207670_10003672 | Ga0207670_100036724 | 147 |
| 19 | 3300026118 | Ga0207675_100965412 | Ga0207675_1009654122 | 147 |
| 20 | 3300031251 | Ga0265327_10000998 | Ga0265327_100009988 | 147 |
| 21 | 3300033180 | Ga0307510_10079410 | Ga0307510_100794102 | 147 |
| 22 | 3300005434 | Ga0070709_10319754 | Ga0070709_103197542 | 148 |
| 23 | 3300005435 | Ga0070714_100113532 | Ga0070714_1001135322 | 148 |
| 24 | 3300005436 | Ga0070713_100027107 | Ga0070713_1000271072 | 148 |
| 25 | 3300013308 | Ga0157375_12097699 | Ga0157375_120976992 | 148 |
| 26 | 3300035695 | Ga0373927_0272126 | Ga0373927_0272126_520_966 | 148 |
| 27 | 3300005355 | Ga0070671_101344823 | Ga0070671_1013448231 | 149 |
| 28 | 3300005435 | Ga0070714_100208504 | Ga0070714_1002085041 | 149 |
| 29 | 3300005436 | Ga0070713_100068117 | Ga0070713_1000681174 | 149 |
| 30 | 3300005436 | Ga0070713_100166802 | Ga0070713_1001668022 | 149 |
| 31 | 3300005436 | Ga0070713_101836752 | Ga0070713_1018367521 | 149 |
| 32 | 3300005437 | Ga0070710_10068393 | Ga0070710_100683932 | 149 |
| 33 | 3300005439 | Ga0070711_100053142 | Ga0070711_1000531422 | 149 |
| 34 | 3300005439 | Ga0070711_100123618 | Ga0070711_1001236181 | 149 |
| 35 | 3300005439 | Ga0070711_100155757 | Ga0070711_1001557573 | 149 |
| 36 | 3300005467 | Ga0070706_100490786 | Ga0070706_1004907861 | 149 |
| 37 | 3300005468 | Ga0070707_100013322 | Ga0070707_10001332214 | 149 |
| 38 | 3300005548 | Ga0070665_101332129 | Ga0070665_1013321292 | 149 |
| 39 | 3300005614 | Ga0068856_100257919 | Ga0068856_1002579193 | 149 |
| 40 | 3300005616 | Ga0068852_100453261 | Ga0068852_1004532613 | 149 |
| 41 | 3300006173 | Ga0070716_100017137 | Ga0070716_1000171375 | 149 |
| 42 | 3300006173 | Ga0070716_100180505 | Ga0070716_1001805053 | 149 |
| 43 | 3300006173 | Ga0070716_100885345 | Ga0070716_1008853451 | 149 |
| 44 | 3300006175 | Ga0070712_100000314 | Ga0070712_10000031410 | 149 |
| 45 | 3300006175 | Ga0070712_100129930 | Ga0070712_1001299302 | 149 |
| 46 | 3300009174 | Ga0105241_10857372 | Ga0105241_108573721 | 149 |
| 47 | 3300009545 | Ga0105237_10220879 | Ga0105237_102208792 | 149 |
| 48 | 3300009551 | Ga0105238_10127374 | Ga0105238_101273743 | 149 |
| 49 | 3300011119 | Ga0105246_10707501 | Ga0105246_107075011 | 149 |
| 50 | 3300013105 | Ga0157369_10569656 | Ga0157369_105696563 | 149 |
| 51 | 3300013306 | Ga0163162_10093131 | Ga0163162_100931316 | 149 |
| 52 | 3300014968 | Ga0157379_10034604 | Ga0157379_100346044 | 149 |
| 53 | 3300014969 | Ga0157376_11787904 | Ga0157376_117879041 | 149 |
| 54 | 3300025898 | Ga0207692_10059748 | Ga0207692_100597482 | 149 |
| 55 | 3300025906 | Ga0207699_10004986 | Ga0207699_100049862 | 149 |
| 56 | 3300025910 | Ga0207684_10356635 | Ga0207684_103566352 | 149 |
| 57 | 3300025911 | Ga0207654_10066875 | Ga0207654_100668753 | 149 |
| 58 | 3300025914 | Ga0207671_10357110 | Ga0207671_103571102 | 149 |
| 59 | 3300025915 | Ga0207693_10000276 | Ga0207693_1000027634 | 149 |
| 60 | 3300025915 | Ga0207693_10010222 | Ga0207693_100102222 | 149 |
| 61 | 3300025915 | Ga0207693_10335222 | Ga0207693_103352221 | 149 |
| 62 | 3300025915 | Ga0207693_10836098 | Ga0207693_108360981 | 149 |
| 63 | 3300025916 | Ga0207663_10041345 | Ga0207663_100413454 | 149 |
| 64 | 3300025916 | Ga0207663_10082446 | Ga0207663_100824462 | 149 |
| 65 | 3300025924 | Ga0207694_10174707 | Ga0207694_101747072 | 149 |
| 66 | 3300025928 | Ga0207700_10122141 | Ga0207700_101221411 | 149 |
| 67 | 3300025929 | Ga0207664_10332202 | Ga0207664_103322022 | 149 |
| 68 | 3300025931 | Ga0207644_10957894 | Ga0207644_109578941 | 149 |
| 69 | 3300025939 | Ga0207665_10008780 | Ga0207665_100087806 | 149 |
| 70 | 3300025939 | Ga0207665_10070165 | Ga0207665_100701651 | 149 |
| 71 | 3300025972 | Ga0207668_10245942 | Ga0207668_102459421 | 149 |
| 72 | 3300026116 | Ga0207674_11435370 | Ga0207674_114353701 | 149 |
| 73 | 3300028800 | Ga0265338_10064043 | Ga0265338_100640431 | 149 |
| 74 | 3300028800 | Ga0265338_10120519 | Ga0265338_101205192 | 149 |
| 75 | 3300031241 | Ga0265325_10000094 | Ga0265325_1000009452 | 149 |
| 76 | 3300031241 | Ga0265325_10084243 | Ga0265325_100842432 | 149 |
| 77 | 3300031242 | Ga0265329_10286261 | Ga0265329_102862611 | 149 |
| 78 | 3300031249 | Ga0265339_10007213 | Ga0265339_100072135 | 149 |
| 79 | 3300031249 | Ga0265339_10019365 | Ga0265339_100193655 | 149 |
| 80 | 3300031250 | Ga0265331_10010737 | Ga0265331_100107375 | 149 |
| 81 | 3300031344 | Ga0265316_10010117 | Ga0265316_100101176 | 149 |
| 82 | 3300031344 | Ga0265316_10059787 | Ga0265316_100597873 | 149 |
| 83 | 3300031344 | Ga0265316_10617386 | Ga0265316_106173862 | 149 |
| 84 | 3300031595 | Ga0265313_10005358 | Ga0265313_100053585 | 149 |
| 85 | 3300031595 | Ga0265313_10086475 | Ga0265313_100864752 | 149 |
| 86 | 3300031711 | Ga0265314_10207569 | Ga0265314_102075692 | 149 |
| 87 | 3300035116 | Ga0373945_0183742 | Ga0373945_0183742_365_826 | 149 |
| 88 | 3300035725 | Ga0373947_0093036 | Ga0373947_0093036_171_632 | 149 |
| 89 | 3300036401 | Ga0373937_0341322 | Ga0373937_0341322_898_1359 | 149 |
| 90 | 3300037068 | Ga0373925_0485820 | Ga0373925_0485820_352_813 | 149 |
| 91 | 3300039450 | Ga0436363_0062555 | Ga0436363_0062555_1406_1867 | 149 |
| 92 | 3300045976 | Ga0466967_0524442 | Ga0466967_0524442_224_685 | 149 |
| 93 | 3300046455 | Ga0495603_0281718 | Ga0495603_0281718_174_635 | 149 |
| 94 | 3300046460 | Ga0495638_0289517 | Ga0495638_0289517_176_637 | 149 |
| 95 | 3300046461 | Ga0495641_0345183 | Ga0495641_0345183_55_516 | 149 |
| 96 | 3300046472 | Ga0495580_0826995 | Ga0495580_0826995_62_544 | 149 |
| 97 | 3300046474 | Ga0495605_0315750 | Ga0495605_0315750_51_512 | 149 |
| 98 | 3300046475 | Ga0495639_0166650 | Ga0495639_0166650_231_692 | 149 |
| 99 | 3300046492 | Ga0495585_0089933 | Ga0495585_0089933_1074_1535 | 149 |
| 100 | 3300046492 | Ga0495585_0488330 | Ga0495585_0488330_97_558 | 149 |
| 101 | 3300046499 | Ga0495594_0101413 | Ga0495594_0101413_328_789 | 149 |
| 102 | 3300046499 | Ga0495594_0166853 | Ga0495594_0166853_742_1203 | 149 |
| 103 | 3300046519 | Ga0495632_0042321 | Ga0495632_0042321_1023_1484 | 149 |
| 104 | 3300046525 | Ga0495663_0039837 | Ga0495663_0039837_37_498 | 149 |
| 105 | 3300046526 | Ga0495666_0041149 | Ga0495666_0041149_1730_2191 | 149 |
| 106 | 3300046530 | Ga0495654_0102260 | Ga0495654_0102260_832_1293 | 149 |
| 107 | 3300046537 | Ga0495598_0146684 | Ga0495598_0146684_219_680 | 149 |
| 108 | 3300046557 | Ga0495622_0253445 | Ga0495622_0253445_150_611 | 149 |
| 109 | 3300046558 | Ga0495633_0091328 | Ga0495633_0091328_271_732 | 149 |
| 110 | 3300046615 | Ga0495656_0087730 | Ga0495656_0087730_850_1311 | 149 |
| 111 | 3300046616 | Ga0495668_0375126 | Ga0495668_0375126_155_616 | 149 |
| 112 | 3300046648 | Ga0495611_0054946 | Ga0495611_0054946_733_1194 | 149 |
| 113 | 3300046660 | Ga0495625_0210553 | Ga0495625_0210553_588_1049 | 149 |
| 114 | 3300046664 | Ga0495659_0200415 | Ga0495659_0200415_153_614 | 149 |
| 115 | 3300046665 | Ga0495661_0203311 | Ga0495661_0203311_84_545 | 149 |
| 116 | 3300046674 | Ga0495588_0154122 | Ga0495588_0154122_141_602 | 149 |
| 117 | 3300046674 | Ga0495588_0161150 | Ga0495588_0161150_219_680 | 149 |
| 118 | 3300046794 | Ga0495589_0157340 | Ga0495589_0157340_476_937 | 149 |
| 119 | 3300047318 | Ga0495636_0110327 | Ga0495636_0110327_129_590 | 149 |
| 120 | 3300047319 | Ga0495674_0423864 | Ga0495674_0423864_390_851 | 149 |
| 121 | 3300047319 | Ga0495674_0937166 | Ga0495674_0937166_35_496 | 149 |
| 122 | 3300047321 | Ga0495676_0295681 | Ga0495676_0295681_611_1072 | 149 |
| 123 | 3300047445 | Ga0495677_0190487 | Ga0495677_0190487_27_488 | 149 |
| 124 | 3300047447 | Ga0495685_162447 | Ga0495685_162447_123_584 | 149 |
| 125 | 3300047470 | Ga0495681_0280522 | Ga0495681_0280522_159_620 | 149 |
| 126 | 3300048904 | Ga0496101_0979533 | Ga0496101_0979533_140_601 | 149 |
| 127 | 3300048904 | Ga0496101_1147241 | Ga0496101_1147241_40_501 | 149 |
| 128 | 3300048908 | Ga0496105_0128545 | Ga0496105_0128545_168_629 | 149 |
| 129 | 3300048908 | Ga0496105_0519286 | Ga0496105_0519286_148_615 | 149 |
| 130 | 3300048909 | Ga0496106_0321602 | Ga0496106_0321602_367_828 | 149 |
| 131 | 3300048909 | Ga0496106_0708990 | Ga0496106_0708990_18_479 | 149 |
| 132 | 3300048910 | Ga0496107_0764891 | Ga0496107_0764891_220_681 | 149 |
| 133 | 3300048911 | Ga0496108_0943739 | Ga0496108_0943739_123_584 | 149 |
| 134 | 3300048914 | Ga0496111_0079390 | Ga0496111_0079390_1470_1931 | 149 |
| 135 | 3300048915 | Ga0496112_0388636 | Ga0496112_0388636_426_887 | 149 |
| 136 | 3300048915 | Ga0496112_0553856 | Ga0496112_0553856_214_675 | 149 |
| 137 | 3300048918 | Ga0496115_1263937 | Ga0496115_1263937_45_506 | 149 |
| 138 | 3300050512 | nmdc:mga0n895_215769_c1 | nmdc:mga0n895_215769_c1_216_677 | 149 |
| 139 | 3300003215 | JGI25153J46596_10022408 | JGI25153J46596_100224082 | 150 |
| 140 | 3300003791 | Ga0055530_10001964 | Ga0055530_100019648 | 150 |
| 141 | 3300003794 | Ga0055531_10001208 | Ga0055531_1000120819 | 150 |
| 142 | 3300005262 | Ga0065165_1000741 | Ga0065165_100074142 | 150 |
| 143 | 3300005327 | Ga0070658_10687567 | Ga0070658_106875671 | 150 |
| 144 | 3300005336 | Ga0070680_100033064 | Ga0070680_1000330643 | 150 |
| 145 | 3300005458 | Ga0070681_10025688 | Ga0070681_100256885 | 150 |
| 146 | 3300005539 | Ga0068853_100245789 | Ga0068853_1002457891 | 150 |
| 147 | 3300005548 | Ga0070665_100303702 | Ga0070665_1003037023 | 150 |
| 148 | 3300005563 | Ga0068855_100061698 | Ga0068855_1000616983 | 150 |
| 149 | 3300005578 | Ga0068854_100102925 | Ga0068854_1001029252 | 150 |
| 150 | 3300005614 | Ga0068856_100000055 | Ga0068856_100000055106 | 150 |
| 151 | 3300005616 | Ga0068852_100019381 | Ga0068852_1000193813 | 150 |
| 152 | 3300005841 | Ga0068863_101389272 | Ga0068863_1013892721 | 150 |
| 153 | 3300006028 | Ga0070717_10099788 | Ga0070717_100997882 | 150 |
| 154 | 3300006177 | Ga0075362_10117079 | Ga0075362_101170792 | 150 |
| 155 | 3300006881 | Ga0068865_100001871 | Ga0068865_1000018719 | 150 |
| 156 | 3300009093 | Ga0105240_10216323 | Ga0105240_102163232 | 150 |
| 157 | 3300009093 | Ga0105240_11966378 | Ga0105240_119663781 | 150 |
| 158 | 3300009174 | Ga0105241_10180339 | Ga0105241_101803392 | 150 |
| 159 | 3300009177 | Ga0105248_10010745 | Ga0105248_100107457 | 150 |
| 160 | 3300009551 | Ga0105238_10470957 | Ga0105238_104709572 | 150 |
| 161 | 3300009551 | Ga0105238_11166243 | Ga0105238_111662432 | 150 |
| 162 | 3300010375 | Ga0105239_10414915 | Ga0105239_104149152 | 150 |
| 163 | 3300013104 | Ga0157370_10084911 | Ga0157370_100849113 | 150 |
| 164 | 3300013105 | Ga0157369_10360902 | Ga0157369_103609022 | 150 |
| 165 | 3300013307 | Ga0157372_10090252 | Ga0157372_100902523 | 150 |
| 166 | 3300013307 | Ga0157372_10978244 | Ga0157372_109782442 | 150 |
| 167 | 3300014325 | Ga0163163_12584619 | Ga0163163_125846191 | 150 |
| 168 | 3300014326 | Ga0157380_11612675 | Ga0157380_116126751 | 150 |
| 169 | 3300025250 | Ga0209026_1011020 | Ga0209026_10110202 | 150 |
| 170 | 3300025254 | Ga0209148_1024379 | Ga0209148_10243792 | 150 |
| 171 | 3300025297 | Ga0209758_1001910 | Ga0209758_10019104 | 150 |
| 172 | 3300025298 | Ga0209050_1000121 | Ga0209050_1000121121 | 150 |
| 173 | 3300025304 | Ga0209257_1000125 | Ga0209257_1000125145 | 150 |
| 174 | 3300025304 | Ga0209257_1000888 | Ga0209257_100088841 | 150 |
| 175 | 3300025911 | Ga0207654_10205982 | Ga0207654_102059823 | 150 |
| 176 | 3300025912 | Ga0207707_10286650 | Ga0207707_102866503 | 150 |
| 177 | 3300025913 | Ga0207695_10356300 | Ga0207695_103563002 | 150 |
| 178 | 3300025916 | Ga0207663_10717028 | Ga0207663_107170282 | 150 |
| 179 | 3300025917 | Ga0207660_10534598 | Ga0207660_105345982 | 150 |
| 180 | 3300025917 | Ga0207660_10855311 | Ga0207660_108553112 | 150 |
| 181 | 3300025924 | Ga0207694_10028484 | Ga0207694_100284845 | 150 |
| 182 | 3300025928 | Ga0207700_10641710 | Ga0207700_106417102 | 150 |
| 183 | 3300025937 | Ga0207669_10333881 | Ga0207669_103338812 | 150 |
| 184 | 3300025938 | Ga0207704_10002011 | Ga0207704_100020118 | 150 |
| 185 | 3300025941 | Ga0207711_10000424 | Ga0207711_100004246 | 150 |
| 186 | 3300025949 | Ga0207667_10085113 | Ga0207667_100851133 | 150 |
| 187 | 3300025981 | Ga0207640_10163445 | Ga0207640_101634452 | 150 |
| 188 | 3300026023 | Ga0207677_10652842 | Ga0207677_106528422 | 150 |
| 189 | 3300026067 | Ga0207678_10095404 | Ga0207678_100954041 | 150 |
| 190 | 3300026078 | Ga0207702_10000287 | Ga0207702_1000028736 | 150 |
| 191 | 3300026095 | Ga0207676_10951220 | Ga0207676_109512202 | 150 |
| 192 | 3300026142 | Ga0207698_10037122 | Ga0207698_100371222 | 150 |
| 193 | 3300028379 | Ga0268266_10098538 | Ga0268266_100985382 | 150 |
| 194 | 3300028380 | Ga0268265_11443626 | Ga0268265_114436261 | 150 |
| 195 | 3300030521 | Ga0307511_10290626 | Ga0307511_102906262 | 150 |
| 196 | 3300035692 | Ga0373935_0701502 | Ga0373935_0701502_72_524 | 150 |
| 197 | 3300035695 | Ga0373927_0428177 | Ga0373927_0428177_131_595 | 150 |
| 198 | 3300035725 | Ga0373947_0048319 | Ga0373947_0048319_1176_1628 | 150 |
| 199 | 3300037312 | Ga0395899_0001662 | Ga0395899_0001662_1416_1868 | 150 |
| 200 | 3300037312 | Ga0395899_0093505 | Ga0395899_0093505_413_865 | 150 |
| 201 | 3300037312 | Ga0395899_0274192 | Ga0395899_0274192_497_949 | 150 |
| 202 | 3300037418 | Ga0395900_0000052 | Ga0395900_0000052_185878_186330 | 150 |
| 203 | 3300037418 | Ga0395900_0254398 | Ga0395900_0254398_207_659 | 150 |
| 204 | 3300037418 | Ga0395900_0572576 | Ga0395900_0572576_98_550 | 150 |
| 205 | 3300037466 | Ga0395898_0014051 | Ga0395898_0014051_1743_2195 | 150 |
| 206 | 3300037466 | Ga0395898_0062211 | Ga0395898_0062211_1541_1993 | 150 |
| 207 | 3300037466 | Ga0395898_0397910 | Ga0395898_0397910_249_701 | 150 |
| 208 | 3300037471 | Ga0395905_0036952 | Ga0395905_0036952_2131_2583 | 150 |
| 209 | 3300037471 | Ga0395905_0114281 | Ga0395905_0114281_753_1292 | 150 |
| 210 | 3300037471 | Ga0395905_0232726 | Ga0395905_0232726_710_1162 | 150 |
| 211 | 3300037471 | Ga0395905_0399676 | Ga0395905_0399676_489_941 | 150 |
| 212 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_601672_602124 | 150 |
| 213 | 3300038443 | Ga0395901_0135317 | Ga0395901_0135317_382_834 | 150 |
| 214 | 3300038443 | Ga0395901_1139459 | Ga0395901_1139459_19_471 | 150 |
| 215 | 3300038443 | Ga0395901_1309659 | Ga0395901_1309659_39_509 | 150 |
| 216 | 3300044693 | Ga0466961_0230762 | Ga0466961_0230762_64_516 | 150 |
| 217 | 3300044765 | Ga0466970_0193531 | Ga0466970_0193531_521_973 | 150 |
| 218 | 3300044842 | Ga0466957_0721310 | Ga0466957_0721310_172_624 | 150 |
| 219 | 3300044842 | Ga0466957_0972030 | Ga0466957_0972030_96_548 | 150 |
| 220 | 3300044901 | Ga0466960_0025382 | Ga0466960_0025382_521_973 | 150 |
| 221 | 3300045836 | Ga0466958_0181952 | Ga0466958_0181952_140_592 | 150 |
| 222 | 3300045836 | Ga0466958_0792675 | Ga0466958_0792675_135_587 | 150 |
| 223 | 3300046517 | Ga0495630_1371418 | Ga0495630_1371418_49_504 | 150 |
| 224 | 3300046543 | Ga0495645_0313013 | Ga0495645_0313013_387_842 | 150 |
| 225 | 3300046616 | Ga0495668_0079536 | Ga0495668_0079536_82_543 | 150 |
| 226 | 3300046616 | Ga0495668_0140740 | Ga0495668_0140740_549_1001 | 150 |
| 227 | 3300046660 | Ga0495625_0363386 | Ga0495625_0363386_110_562 | 150 |
| 228 | 3300046691 | Ga0495670_0550611 | Ga0495670_0550611_81_536 | 150 |
| 229 | 3300047472 | Ga0495686_0023047 | Ga0495686_0023047_1122_1574 | 150 |
| 230 | 3300048915 | Ga0496112_0346883 | Ga0496112_0346883_272_724 | 150 |
| 231 | 3300048915 | Ga0496112_0520660 | Ga0496112_0520660_564_1016 | 150 |
| 232 | 3300049568 | Ga0501031_0001400 | Ga0501031_0001400_7359_7823 | 150 |
| 233 | 3300049569 | Ga0501032_0000088 | Ga0501032_0000088_1718_2182 | 150 |
| 234 | 3300049570 | Ga0501033_0000724 | Ga0501033_0000724_15269_15733 | 150 |
| 235 | 3300049571 | Ga0501034_0000332 | Ga0501034_0000332_51897_52361 | 150 |
| 236 | 3300049572 | Ga0501036_0000233 | Ga0501036_0000233_15269_15733 | 150 |
| 237 | 3300049573 | Ga0501037_0000421 | Ga0501037_0000421_19042_19506 | 150 |
| 238 | 3300049574 | Ga0501038_0000049 | Ga0501038_0000049_12569_13033 | 150 |
| 239 | 3300049575 | Ga0501039_0007740 | Ga0501039_0007740_7523_7987 | 150 |
| 240 | 3300049579 | Ga0501043_0000740 | Ga0501043_0000740_7065_7529 | 150 |
| 241 | 3300049579 | Ga0501043_0798565 | Ga0501043_0798565_182_646 | 150 |
| 242 | 3300049580 | Ga0501046_0000087 | Ga0501046_0000087_89506_89970 | 150 |
| 243 | 3300049581 | Ga0501047_0001375 | Ga0501047_0001375_15907_16371 | 150 |
| 244 | 3300049581 | Ga0501047_0056305 | Ga0501047_0056305_925_1377 | 150 |
| 245 | 3300049581 | Ga0501047_0138445 | Ga0501047_0138445_455_919 | 150 |
| 246 | 3300049582 | Ga0501048_0000665 | Ga0501048_0000665_16988_17452 | 150 |
| 247 | 3300049583 | Ga0501067_0000497 | Ga0501067_0000497_8006_8470 | 150 |
| 248 | 3300049584 | Ga0501068_0001170 | Ga0501068_0001170_7689_8153 | 150 |
| 249 | 3300049585 | Ga0501069_0046794 | Ga0501069_0046794_610_1074 | 150 |
| 250 | 3300049585 | Ga0501069_0551983 | Ga0501069_0551983_69_533 | 150 |
| 251 | 3300049586 | Ga0501070_0004024 | Ga0501070_0004024_2603_3067 | 150 |
| 252 | 3300049586 | Ga0501070_0097509 | Ga0501070_0097509_1936_2400 | 150 |
| 253 | 3300049588 | Ga0501072_0000535 | Ga0501072_0000535_17768_18232 | 150 |
| 254 | 3300049589 | Ga0501073_0000112 | Ga0501073_0000112_35929_36393 | 150 |
| 255 | 3300049590 | Ga0501074_0000225 | Ga0501074_0000225_9087_9551 | 150 |
| 256 | 3300049741 | Ga0501079_0002907 | Ga0501079_0002907_5900_6364 | 150 |
| 257 | 3300049742 | Ga0501080_0052221 | Ga0501080_0052221_1964_2428 | 150 |
| 258 | 3300049744 | Ga0501083_0005430 | Ga0501083_0005430_4699_5163 | 150 |
| 259 | 3300049822 | Ga0501035_0001854 | Ga0501035_0001854_16204_16668 | 150 |
| 260 | 3300049823 | Ga0501044_0000182 | Ga0501044_0000182_2462_2926 | 150 |
| 261 | 3300049823 | Ga0501044_0658134 | Ga0501044_0658134_474_926 | 150 |
| 262 | 3300049823 | Ga0501044_0719273 | Ga0501044_0719273_179_631 | 150 |
| 263 | 3300049824 | Ga0501045_0194774 | Ga0501045_0194774_788_1252 | 150 |
| 264 | 3300050492 | nmdc:mga0yw44_682628_c1 | nmdc:mga0yw44_682628_c1_180_638 | 150 |
| 265 | 3300050496 | nmdc:mga07m45_318569_c1 | nmdc:mga07m45_318569_c1_257_709 | 150 |
| 266 | 3300053119 | Ga0500595_007942 | Ga0500595_007942_94_546 | 150 |
| 267 | 3300053730 | Ga0500645_003949 | Ga0500645_003949_2516_2968 | 150 |
| 268 | 3300054114 | Ga0501084_0009033 | Ga0501084_0009033_4608_5072 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ct8-assembly1.cif.gz_A-2 | crystal structure of a putative glyoxalase (np_243026.1) from bacillus halodurans at 2.10 a resolution | 0.8683 | 4 | 129 |
| 4z04-assembly1.cif.gz_A-2 | crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione | 0.8316 | 8 | 129 |
| 3ct8-assembly1.cif.gz_A-2 | crystal structure of a putative glyoxalase (np_243026.1) from bacillus halodurans at 2.10 a resolution | 0.8199 | 4 | 129 |
| 5vb0-assembly6.cif.gz_H | crystal structure of fosfomycin resistance protein fosa3 | 0.817 | 2 | 129 |
| 2rk0-assembly1.cif.gz_A | crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec | 0.8121 | 2 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8827 | 74 | 128 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.871 | 74 | 129 | 3.30.720.110 |
| 3ct8A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8657 | 4 | 129 | 3.10.180.10 |
| 4z04A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8316 | 8 | 129 | 3.10.180.10 |
| 3ct8A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8232 | 4 | 129 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F9CH45-F1-model_v4 | VOC domain-containing protein | 0.9838 | 1 | 136 |
|
| AF-A0A523KMG3-F1-model_v4 | VOC family protein | 0.9816 | 1 | 139 |
|
| AF-A0A4Q5XVN5-F1-model_v4 | VOC family protein | 0.9802 | 1 | 128 |
|
| AF-A0A2S6RIG0-F1-model_v4 | VOC domain-containing protein | 0.9778 | 3 | 139 |
|
| AF-A0A2D6T0L7-F1-model_v4 | Bleomycin resistance protein | 0.9727 | 1 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar