F375242

General Info

Members Datasets Scaffolds Average Seq Length
268 155 536 217

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10245972|Ga0065704_102459721
Length 247
Sequence MPADAHAATAAHAHQFEDAAQQREAVTLGMWAFLVTEILFFGGLFTAYTLYRWSFPAAFALSSHHLDVVLGGVNTVVLICSSLTMAMAVHAAQIGRRRGLVAFLLLTLLLGGAFLGIKAVEYHHKYTEHLIPGHSFRMAPEALPAGVDPASDAIIAGGVPSVNPGVAADLQRHAQIFFSLYFGMTGMHALHMIVGLGLLTWLLLAARRGRFTREYNSPVEIVGLYWHFVDIVWIFLFPLLYLIGRHA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.87
Rhizosphere 98.13
Stem 0
Stem Tuber 0
Unclassified 6.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10245972 3300005289 Bacteria 1002
2 MBSR1b_contig_8538750 2162886012 Bacteria 1983
3 Ga0065712_10117440 3300005290 Bacteria 1720
4 Ga0065715_10097976 3300005293 Bacteria 3618
5 Ga0070670_100436533 3300005331 Bacteria 1159
6 Ga0070666_10171144 3300005335 Bacteria 1521
7 Ga0070666_10309110 3300005335 Bacteria 1126
8 Ga0070680_100158547 3300005336 Bacteria 1901
9 Ga0070689_100032676 3300005340 Bacteria 3959
10 Ga0070675_100000723 3300005354 Bacteria 22952
11 Ga0070675_100292574 3300005354 Bacteria 1433
12 Ga0070675_100370997 3300005354 Bacteria 1272
13 Ga0070688_100118342 3300005365 Bacteria 1771
14 Ga0070714_100842088 3300005435 Bacteria 889
15 Ga0070713_100203485 3300005436 Bacteria 1789
16 Ga0070701_10118083 3300005438 Bacteria 1491
17 Ga0070705_100180988 3300005440 Bacteria 1428
18 Ga0070708_100017801 3300005445 Bacteria 5936
19 Ga0070708_100022766 3300005445 Bacteria 5319
20 Ga0070708_100167207 3300005445 Bacteria 2052
21 Ga0070708_100494452 3300005445 Bacteria 1154
22 Ga0070706_100043707 3300005467 Bacteria 4139
23 Ga0070706_100056590 3300005467 Bacteria 3618
24 Ga0070706_100111847 3300005467 Bacteria 2542
25 Ga0070706_100698847 3300005467 Unclassified 940
26 Ga0070707_100026525 3300005468 Bacteria 5502
27 Ga0070707_100407339 3300005468 Bacteria 1320
28 Ga0070707_100515616 3300005468 Bacteria 1158
29 Ga0070698_100001801 3300005471 Bacteria 23859
30 Ga0070698_100359239 3300005471 Bacteria 1388
31 Ga0070698_100821415 3300005471 Bacteria 874
32 Ga0070699_100000002 3300005518 Bacteria 423451
33 Ga0070699_100256420 3300005518 Bacteria 1564
34 Ga0070679_100169226 3300005530 Bacteria 2158
35 Ga0070679_100245318 3300005530 Bacteria 1748
36 Ga0070697_100110787 3300005536 Bacteria 2287
37 Ga0070697_100952778 3300005536 Unclassified 762
38 Ga0070686_100188708 3300005544 Bacteria 1470
39 Ga0070695_100016340 3300005545 Bacteria 4492
40 Ga0070696_100100101 3300005546 Bacteria 2075
41 Ga0070704_100234963 3300005549 Bacteria 1497
42 Ga0068855_100160955 3300005563 Bacteria 2548
43 Ga0068855_100797726 3300005563 Bacteria 1004
44 Ga0070664_100572463 3300005564 Bacteria 1046
45 Ga0068856_100023859 3300005614 Bacteria 5950
46 Ga0068859_100017223 3300005617 Bacteria 7256
47 Ga0068859_100028025 3300005617 Bacteria 5648
48 Ga0068859_100115467 3300005617 Bacteria 2749
49 Ga0068859_100572823 3300005617 Bacteria 1223
50 Ga0068863_101164202 3300005841 Bacteria 776
51 Ga0068862_100076541 3300005844 Bacteria 2896
52 Ga0068862_100095244 3300005844 Bacteria 2597
53 Ga0081538_10014573 3300005981 Bacteria 6147
54 Ga0070717_10318219 3300006028 Unclassified 1386
55 Ga0070716_100236746 3300006173 Bacteria 1236
56 Ga0097621_100000674 3300006237 Bacteria 23911
57 Ga0068871_100009621 3300006358 Bacteria 7019
58 Ga0068871_100155976 3300006358 Bacteria 1949
59 Ga0075428_100003395 3300006844 Bacteria 17411
60 Ga0075428_100009076 3300006844 Bacteria 11037
61 Ga0075428_100028837 3300006844 Bacteria 6142
62 Ga0075428_100066110 3300006844 Bacteria 3959
63 Ga0075428_100219385 3300006844 Bacteria 2054
64 Ga0075428_100261080 3300006844 Bacteria 1865
65 Ga0075428_100333026 3300006844 Bacteria 1630
66 Ga0075428_100366765 3300006844 Bacteria 1545
67 Ga0075428_100504844 3300006844 Unclassified 1294
68 Ga0075430_100032399 3300006846 Bacteria 4437
69 Ga0075431_100006499 3300006847 Bacteria 11602
70 Ga0075431_100151022 3300006847 Bacteria 2392
71 Ga0075433_10010350 3300006852 Bacteria 7481
72 Ga0075433_10018426 3300006852 Bacteria 5803
73 Ga0075433_10093120 3300006852 Bacteria 2666
74 Ga0075433_10251658 3300006852 Unclassified 1567
75 Ga0075433_10291142 3300006852 Bacteria 1446
76 Ga0075433_10491299 3300006852 Bacteria 1081
77 Ga0075434_100016721 3300006871 Bacteria 7057
78 Ga0075434_100087761 3300006871 Unclassified 3112
79 Ga0075434_100275454 3300006871 Bacteria 1702
80 Ga0075434_100507486 3300006871 Bacteria 1227
81 Ga0075429_100189135 3300006880 Bacteria 1804
82 Ga0075429_100426454 3300006880 Bacteria 1161
83 Ga0097620_100017222 3300006931 Bacteria 7256
84 Ga0097620_100028029 3300006931 Bacteria 5648
85 Ga0097620_100115453 3300006931 Bacteria 2749
86 Ga0097620_100572754 3300006931 Bacteria 1223
87 Ga0075435_100029431 3300007076 Bacteria 4310
88 Ga0075435_100441501 3300007076 Unclassified 1122
89 Ga0111539_10002671 3300009094 Bacteria 23614
90 Ga0111539_10230530 3300009094 Bacteria 2156
91 Ga0111539_10281388 3300009094 Bacteria 1935
92 Ga0114129_10003987 3300009147 Bacteria 20856
93 Ga0114129_10009369 3300009147 Bacteria 13961
94 Ga0114129_10012270 3300009147 Bacteria 12193
95 Ga0114129_10014583 3300009147 Bacteria 11197
96 Ga0114129_10065732 3300009147 Bacteria 5061
97 Ga0114129_10185859 3300009147 Bacteria 2824
98 Ga0114129_10229601 3300009147 Bacteria 2500
99 Ga0114129_10395473 3300009147 Bacteria 1822
100 Ga0114129_10447312 3300009147 Bacteria 1695
101 Ga0114129_10747624 3300009147 Bacteria 1252
102 Ga0114129_10791312 3300009147 Bacteria 1211
103 Ga0105241_10658910 3300009174 Bacteria 951
104 Ga0105242_10614803 3300009176 Bacteria 1052
105 Ga0105242_11114820 3300009176 Bacteria 804
106 Ga0105248_10196156 3300009177 Bacteria 2275
107 Ga0105248_10292150 3300009177 Bacteria 1835
108 Ga0105248_10763016 3300009177 Bacteria 1091
109 Ga0157370_10126751 3300013104 Bacteria 2383
110 Ga0157370_10222774 3300013104 Bacteria 1747
111 Ga0157378_10172997 3300013297 Bacteria 2027
112 Ga0157375_10251045 3300013308 Bacteria 1930
113 Ga0163163_10759238 3300014325 Unclassified 1033
114 Ga0157380_10100037 3300014326 Bacteria 2413
115 Ga0157380_10694505 3300014326 Bacteria 1022
116 Ga0157377_10200448 3300014745 Bacteria 1267
117 Ga0157379_10662547 3300014968 Unclassified 978
118 Ga0157376_10184849 3300014969 Bacteria 1907
119 Ga0157376_10331395 3300014969 Bacteria 1450
120 Ga0207697_10025411 3300025315 Bacteria 2420
121 Ga0207684_10000953 3300025910 Bacteria 32600
122 Ga0207684_10040743 3300025910 Bacteria 3938
123 Ga0207684_10068835 3300025910 Bacteria 3008
124 Ga0207684_10557557 3300025910 Bacteria 980
125 Ga0207693_10034369 3300025915 Bacteria 3999
126 Ga0207660_10175413 3300025917 Bacteria 1662
127 Ga0207681_10337483 3300025923 Bacteria 1203
128 Ga0207659_10000574 3300025926 Bacteria 22106
129 Ga0207659_10036344 3300025926 Bacteria 3411
130 Ga0207670_10105114 3300025936 Bacteria 2023
131 Ga0207665_10376720 3300025939 Bacteria 1076
132 Ga0207711_10058949 3300025941 Bacteria 3305
133 Ga0207711_10313670 3300025941 Unclassified 1448
134 Ga0207711_10551530 3300025941 Bacteria 1075
135 Ga0207667_10907044 3300025949 Bacteria 873
136 Ga0207702_10059381 3300026078 Bacteria 3258
137 Ga0207648_10458190 3300026089 Unclassified 1162
138 Ga0207676_10187994 3300026095 Bacteria 1815
139 Ga0207676_10446139 3300026095 Bacteria 1219
140 Ga0207676_10740759 3300026095 Bacteria 955
141 Ga0207674_10629863 3300026116 Bacteria 1036
142 Ga0207675_100482328 3300026118 Bacteria 1232
143 Ga0207683_10558372 3300026121 Bacteria 1059
144 Ga0210002_1002939 3300027617 Bacteria 2494
145 Ga0209983_1003221 3300027665 Bacteria 3501
146 Ga0209974_10002919 3300027876 Bacteria 6201
147 Ga0207428_10081628 3300027907 Bacteria 2524
148 Ga0268266_10845001 3300028379 Bacteria 885
149 Ga0268265_10050215 3300028380 Bacteria 3142
150 Ga0268265_10091108 3300028380 Bacteria 2437
151 Ga0268264_10218111 3300028381 Bacteria 1755
152 Ga0268264_11338062 3300028381 Bacteria 726
153 Ga0265318_10033570 3300028577 Bacteria 1980
154 Ga0265338_10022728 3300028800 Bacteria 6477
155 Ga0265324_10054126 3300029957 Bacteria 1377
156 Ga0265328_10067029 3300031239 Bacteria 1319
157 Ga0265320_10003307 3300031240 Bacteria 10871
158 Ga0265329_10086672 3300031242 Bacteria 993
159 Ga0265331_10026580 3300031250 Bacteria 2907
160 Ga0265316_10145794 3300031344 Bacteria 1775
161 Ga0265316_10378436 3300031344 Bacteria 1022
162 Ga0265342_10050426 3300031712 Bacteria 2486
163 Ga0373936_0020843 3300035113 Bacteria 2549
164 Ga0373931_0047734 3300035691 Unclassified 2267
165 Ga0439444_0017463 3300042437 Bacteria 1232
166 Ga0451577_0031304 3300042876 Bacteria 4802
167 Ga0451577_0257848 3300042876 Bacteria 1579
168 Ga0451577_0899490 3300042876 Bacteria 797
169 Ga0453683_0000412 3300044673 Bacteria 49894
170 Ga0453683_0034574 3300044673 Bacteria 3186
171 Ga0453683_0168930 3300044673 Bacteria 1385
172 Ga0453684_0027275 3300044712 Bacteria 8198
173 Ga0453684_1201989 3300044712 Bacteria 796
174 Ga0466959_0219831 3300045049 Bacteria 1318
175 Ga0451576_0042689 3300045051 Bacteria 4787
176 Ga0451576_0394850 3300045051 Bacteria 1450
177 Ga0466967_0166990 3300045976 Bacteria 2069
178 Ga0495592_0769042 3300046454 Bacteria 574
179 Ga0495651_0001416 3300046462 Bacteria 18607
180 Ga0495653_0277718 3300046463 Bacteria 1101
181 Ga0495580_0497829 3300046472 Bacteria 814
182 Ga0495582_0031545 3300046473 Bacteria 2912
183 Ga0495639_0495514 3300046475 Bacteria 623
184 Ga0495618_0311647 3300046514 Bacteria 976
185 Ga0495630_0000085 3300046517 Bacteria 73665
186 Ga0495663_0020174 3300046525 Bacteria 1912
187 Ga0495666_0012303 3300046526 Bacteria 4267
188 Ga0495665_0317194 3300046531 Bacteria 796
189 Ga0495640_0080710 3300046533 Bacteria 2163
190 Ga0495586_0000012 3300046535 Bacteria 138093
191 Ga0495586_0138931 3300046535 Bacteria 1363
192 Ga0495633_0096824 3300046558 Bacteria 1371
193 Ga0495667_0231328 3300046559 Bacteria 1178
194 Ga0495658_0232052 3300046683 Bacteria 1157
195 Ga0495613_0211674 3300046689 Bacteria 1363
196 Ga0495613_0447377 3300046689 Bacteria 876
197 Ga0495604_0112122 3300047317 Bacteria 1987
198 Ga0495674_0000442 3300047319 Bacteria 37312
199 Ga0495674_0441449 3300047319 Bacteria 1046
200 Ga0495676_0003605 3300047321 Bacteria 14053
201 Ga0495680_0086105 3300047322 Bacteria 2365
202 Ga0495675_0005601 3300047444 Bacteria 7667
203 Ga0495684_0001187 3300047471 Bacteria 21008
204 Ga0495602_0001420 3300048088 Bacteria 23739
205 Ga0495602_0165141 3300048088 Bacteria 1724
206 Ga0496104_0032806 3300048907 Bacteria 4834
207 Ga0496105_0122091 3300048908 Bacteria 2148
208 Ga0496108_0205289 3300048911 Bacteria 1710
209 Ga0496114_0376313 3300048917 Bacteria 1257
210 Ga0496115_0274793 3300048918 Bacteria 1384
211 Ga0501034_0043651 3300049571 Bacteria 4536
212 Ga0501036_0651077 3300049572 Bacteria 872
213 Ga0501037_0700466 3300049573 Bacteria 674
214 Ga0501039_0489183 3300049575 Unclassified 966
215 Ga0501041_0458508 3300049577 Bacteria 809
216 Ga0501043_0398272 3300049579 Bacteria 1041
217 Ga0501048_0314576 3300049582 Bacteria 1115
218 Ga0501048_0858890 3300049582 Unclassified 652
219 Ga0501068_0602504 3300049584 Archaea 716
220 Ga0501070_0263306 3300049586 Bacteria 1409
221 Ga0501071_0162732 3300049587 Bacteria 1668
222 Ga0501072_0092470 3300049588 Bacteria 2402
223 Ga0501075_0268175 3300049591 Bacteria 1301
224 Ga0501077_0037475 3300049593 Bacteria 3088
225 Ga0501077_0398381 3300049593 Unclassified 880
226 Ga0501079_0143106 3300049741 Bacteria 1863
227 Ga0501081_0089019 3300049743 Bacteria 2169
228 Ga0501081_0114306 3300049743 Bacteria 1918
229 Ga0501081_0335262 3300049743 Bacteria 1113
230 Ga0501044_0003342 3300049823 Bacteria 18091
231 Ga0501045_0065660 3300049824 Bacteria 2664
232 nmdc:mga05p37_149068_c1 3300050507 Bacteria 2863
233 nmdc:mga05p37_1556519_c1 3300050507 Bacteria 654
234 nmdc:mga05p37_18223_c1 3300050507 Bacteria 8483
235 nmdc:mga05p37_1946_c1 3300050507 Bacteria 24075
236 nmdc:mga05p37_221725_c1 3300050507 Bacteria 2282
237 nmdc:mga05p37_343253_c1 3300050507 Unclassified 1760
238 nmdc:mga05p37_444933_c1 3300050507 Bacteria 1501
239 nmdc:mga05p37_534430_c1 3300050507 Bacteria 1338
240 nmdc:mga05p37_70673_c1 3300050507 Bacteria 4294
241 nmdc:mga05p37_9205_c1 3300050507 Bacteria 11671
242 nmdc:mga09592_106022_c1 3300050508 Bacteria 2410
243 nmdc:mga09592_221580_c1 3300050508 Bacteria 1639
244 nmdc:mga09592_75067_c1 3300050508 Bacteria 2874
245 nmdc:mga0qj67_158713_c1 3300050509 Bacteria 1836
246 nmdc:mga0qj67_16331_c1 3300050509 Bacteria 5628
247 nmdc:mga0qj67_660812_c1 3300050509 Bacteria 833
248 nmdc:mga06r32_1083614_c1 3300050510 Bacteria 751
249 nmdc:mga06r32_679398_c1 3300050510 Bacteria 996
250 nmdc:mga06r32_75906_c1 3300050510 Bacteria 3263
251 nmdc:mga08y16_144366_c1 3300050511 Bacteria 2474
252 nmdc:mga08y16_681_c1 3300050511 Bacteria 32115
253 nmdc:mga0n895_215115_c1 3300050512 Bacteria 1952
254 nmdc:mga0n895_46422_c1 3300050512 Bacteria 4244
255 nmdc:mga0rr50_322536_c1 3300050513 Unclassified 1295
256 nmdc:mga0rr50_406665_c1 3300050513 Unclassified 1150
257 nmdc:mga0a205_100289_c1 3300050515 Bacteria 2794
258 nmdc:mga0a205_119720_c1 3300050515 Bacteria 2532
259 nmdc:mga0a205_15740_c1 3300050515 Bacteria 7070
260 nmdc:mga0a205_210037_c1 3300050515 Bacteria 1835
261 nmdc:mga0a205_288112_c1 3300050515 Bacteria 1517
262 nmdc:mga0a205_31430_c1 3300050515 Bacteria 5086
263 nmdc:mga0a205_3737_c1 3300050515 Bacteria 13634
264 nmdc:mga0a205_47501_c2 3300050515 Bacteria 2954
265 nmdc:mga0a205_902260_c1 3300050515 Bacteria 731
266 Ga0501084_0153649 3300054114 Bacteria 1940
267 Ga0590071_006556 3300059421 Bacteria 2768
268 Ga0501082_0076036 3300060353 Bacteria 2894
269 Ga0065704_10245972
270 MBSR1b_contig_8538750
271 Ga0065712_10117440
272 Ga0065715_10097976
273 Ga0070670_100436533
274 Ga0070666_10171144
275 Ga0070666_10309110
276 Ga0070680_100158547
277 Ga0070689_100032676
278 Ga0070675_100000723
279 Ga0070675_100292574
280 Ga0070675_100370997
281 Ga0070688_100118342
282 Ga0070714_100842088
283 Ga0070713_100203485
284 Ga0070701_10118083
285 Ga0070705_100180988
286 Ga0070708_100017801
287 Ga0070708_100022766
288 Ga0070708_100167207
289 Ga0070708_100494452
290 Ga0070706_100043707
291 Ga0070706_100056590
292 Ga0070706_100111847
293 Ga0070706_100698847
294 Ga0070707_100026525
295 Ga0070707_100407339
296 Ga0070707_100515616
297 Ga0070698_100001801
298 Ga0070698_100359239
299 Ga0070698_100821415
300 Ga0070699_100000002
301 Ga0070699_100256420
302 Ga0070679_100169226
303 Ga0070679_100245318
304 Ga0070697_100110787
305 Ga0070697_100952778
306 Ga0070686_100188708
307 Ga0070695_100016340
308 Ga0070696_100100101
309 Ga0070704_100234963
310 Ga0068855_100160955
311 Ga0068855_100797726
312 Ga0070664_100572463
313 Ga0068856_100023859
314 Ga0068859_100017223
315 Ga0068859_100028025
316 Ga0068859_100115467
317 Ga0068859_100572823
318 Ga0068863_101164202
319 Ga0068862_100076541
320 Ga0068862_100095244
321 Ga0081538_10014573
322 Ga0070717_10318219
323 Ga0070716_100236746
324 Ga0097621_100000674
325 Ga0068871_100009621
326 Ga0068871_100155976
327 Ga0075428_100003395
328 Ga0075428_100009076
329 Ga0075428_100028837
330 Ga0075428_100066110
331 Ga0075428_100219385
332 Ga0075428_100261080
333 Ga0075428_100333026
334 Ga0075428_100366765
335 Ga0075428_100504844
336 Ga0075430_100032399
337 Ga0075431_100006499
338 Ga0075431_100151022
339 Ga0075433_10010350
340 Ga0075433_10018426
341 Ga0075433_10093120
342 Ga0075433_10251658
343 Ga0075433_10291142
344 Ga0075433_10491299
345 Ga0075434_100016721
346 Ga0075434_100087761
347 Ga0075434_100275454
348 Ga0075434_100507486
349 Ga0075429_100189135
350 Ga0075429_100426454
351 Ga0097620_100017222
352 Ga0097620_100028029
353 Ga0097620_100115453
354 Ga0097620_100572754
355 Ga0075435_100029431
356 Ga0075435_100441501
357 Ga0111539_10002671
358 Ga0111539_10230530
359 Ga0111539_10281388
360 Ga0114129_10003987
361 Ga0114129_10009369
362 Ga0114129_10012270
363 Ga0114129_10014583
364 Ga0114129_10065732
365 Ga0114129_10185859
366 Ga0114129_10229601
367 Ga0114129_10395473
368 Ga0114129_10447312
369 Ga0114129_10747624
370 Ga0114129_10791312
371 Ga0105241_10658910
372 Ga0105242_10614803
373 Ga0105242_11114820
374 Ga0105248_10196156
375 Ga0105248_10292150
376 Ga0105248_10763016
377 Ga0157370_10126751
378 Ga0157370_10222774
379 Ga0157378_10172997
380 Ga0157375_10251045
381 Ga0163163_10759238
382 Ga0157380_10100037
383 Ga0157380_10694505
384 Ga0157377_10200448
385 Ga0157379_10662547
386 Ga0157376_10184849
387 Ga0157376_10331395
388 Ga0207697_10025411
389 Ga0207684_10000953
390 Ga0207684_10040743
391 Ga0207684_10068835
392 Ga0207684_10557557
393 Ga0207693_10034369
394 Ga0207660_10175413
395 Ga0207681_10337483
396 Ga0207659_10000574
397 Ga0207659_10036344
398 Ga0207670_10105114
399 Ga0207665_10376720
400 Ga0207711_10058949
401 Ga0207711_10313670
402 Ga0207711_10551530
403 Ga0207667_10907044
404 Ga0207702_10059381
405 Ga0207648_10458190
406 Ga0207676_10187994
407 Ga0207676_10446139
408 Ga0207676_10740759
409 Ga0207674_10629863
410 Ga0207675_100482328
411 Ga0207683_10558372
412 Ga0210002_1002939
413 Ga0209983_1003221
414 Ga0209974_10002919
415 Ga0207428_10081628
416 Ga0268266_10845001
417 Ga0268265_10050215
418 Ga0268265_10091108
419 Ga0268264_10218111
420 Ga0268264_11338062
421 Ga0265318_10033570
422 Ga0265338_10022728
423 Ga0265324_10054126
424 Ga0265328_10067029
425 Ga0265320_10003307
426 Ga0265329_10086672
427 Ga0265331_10026580
428 Ga0265316_10145794
429 Ga0265316_10378436
430 Ga0265342_10050426
431 Ga0373936_0020843
432 Ga0373931_0047734
433 Ga0439444_0017463
434 Ga0451577_0031304
435 Ga0451577_0257848
436 Ga0451577_0899490
437 Ga0453683_0000412
438 Ga0453683_0034574
439 Ga0453683_0168930
440 Ga0453684_0027275
441 Ga0453684_1201989
442 Ga0466959_0219831
443 Ga0451576_0042689
444 Ga0451576_0394850
445 Ga0466967_0166990
446 Ga0495592_0769042
447 Ga0495651_0001416
448 Ga0495653_0277718
449 Ga0495580_0497829
450 Ga0495582_0031545
451 Ga0495639_0495514
452 Ga0495618_0311647
453 Ga0495630_0000085
454 Ga0495663_0020174
455 Ga0495666_0012303
456 Ga0495665_0317194
457 Ga0495640_0080710
458 Ga0495586_0000012
459 Ga0495586_0138931
460 Ga0495633_0096824
461 Ga0495667_0231328
462 Ga0495658_0232052
463 Ga0495613_0211674
464 Ga0495613_0447377
465 Ga0495604_0112122
466 Ga0495674_0000442
467 Ga0495674_0441449
468 Ga0495676_0003605
469 Ga0495680_0086105
470 Ga0495675_0005601
471 Ga0495684_0001187
472 Ga0495602_0001420
473 Ga0495602_0165141
474 Ga0496104_0032806
475 Ga0496105_0122091
476 Ga0496108_0205289
477 Ga0496114_0376313
478 Ga0496115_0274793
479 Ga0501034_0043651
480 Ga0501036_0651077
481 Ga0501037_0700466
482 Ga0501039_0489183
483 Ga0501041_0458508
484 Ga0501043_0398272
485 Ga0501048_0314576
486 Ga0501048_0858890
487 Ga0501068_0602504
488 Ga0501070_0263306
489 Ga0501071_0162732
490 Ga0501072_0092470
491 Ga0501075_0268175
492 Ga0501077_0037475
493 Ga0501077_0398381
494 Ga0501079_0143106
495 Ga0501081_0089019
496 Ga0501081_0114306
497 Ga0501081_0335262
498 Ga0501044_0003342
499 Ga0501045_0065660
500 nmdc:mga05p37_149068_c1
501 nmdc:mga05p37_1556519_c1
502 nmdc:mga05p37_18223_c1
503 nmdc:mga05p37_1946_c1
504 nmdc:mga05p37_221725_c1
505 nmdc:mga05p37_343253_c1
506 nmdc:mga05p37_444933_c1
507 nmdc:mga05p37_534430_c1
508 nmdc:mga05p37_70673_c1
509 nmdc:mga05p37_9205_c1
510 nmdc:mga09592_106022_c1
511 nmdc:mga09592_221580_c1
512 nmdc:mga09592_75067_c1
513 nmdc:mga0qj67_158713_c1
514 nmdc:mga0qj67_16331_c1
515 nmdc:mga0qj67_660812_c1
516 nmdc:mga06r32_1083614_c1
517 nmdc:mga06r32_679398_c1
518 nmdc:mga06r32_75906_c1
519 nmdc:mga08y16_144366_c1
520 nmdc:mga08y16_681_c1
521 nmdc:mga0n895_215115_c1
522 nmdc:mga0n895_46422_c1
523 nmdc:mga0rr50_322536_c1
524 nmdc:mga0rr50_406665_c1
525 nmdc:mga0a205_100289_c1
526 nmdc:mga0a205_119720_c1
527 nmdc:mga0a205_15740_c1
528 nmdc:mga0a205_210037_c1
529 nmdc:mga0a205_288112_c1
530 nmdc:mga0a205_31430_c1
531 nmdc:mga0a205_3737_c1
532 nmdc:mga0a205_47501_c2
533 nmdc:mga0a205_902260_c1
534 Ga0501084_0153649
535 Ga0590071_006556
536 Ga0501082_0076036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

166

245

0.94

PF00510

COX3

Cytochrome c oxidase subunit III

7

129

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.8949 21 211
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.8894 22 211
7e1v-assembly1.cif.gz_G cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.8891 24 211
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8845 19 217
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8754 19 217
ID Description Score Start End Superfamily
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8892 18 212 1.20.120.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8757 22 210 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.874 24 211 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8711 18 212 1.20.120.80
1fftH00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8503 24 216 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A7C2R622-F1-model_v4 Cytochrome c oxidase subunit 3 family protein 0.9942 27 215 GO:0004129
GO:0005886
GO:0019646
AF-A0A7C2R622-F1-model_v4 Cytochrome c oxidase subunit 3 family protein 0.9838 27 215 GO:0004129
GO:0005886
GO:0019646
AF-A0A2V7VQZ1-F1-model_v4 Cytochrome oxidase subunit III 0.9774 27 215 GO:0004129
GO:0005886
GO:0019646
AF-A0A3L7PZE3-F1-model_v4 Cytochrome c oxidase subunit 3 family protein 0.9773 27 217 GO:0004129
GO:0005886
GO:0019646
AF-A0A359CB41-F1-model_v4 Cytochrome C oxidase subunit III 0.9751 14 211 GO:0004129
GO:0005886
GO:0019646

Map