F375171

General Info

Members Datasets Scaffolds Average Seq Length
267 196 201 282

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2873151551|2873157852
Length 339
Sequence CGGDERRDDDGDKGGDGIEGGEYGEGAGEIRGTGGGGGTDRGEGTDGGGWTGGDEVVADDEAIPVARAVDHGFAKLMPDVDRPRAWLLTVDGAPQSYVDLDEPTYLEFEYARRLAHVLDTAAGPGRPLDAVHLGGGALTLPRYVAATRPGSRQDVVEADRGLLELVAEQVPWAGGDGISVHAADARQWLEAAPDDSADVLVADVFGGSRVPAHLTTVAYARTAGRVLRPGGVYAANLADGAPFAFLRSQLATFAAVFGELALIAEPSVLRGRRFGNAVLVASHRPLDIAALARRAASDAFPARVEHGDALRRLIGGAEAVRDEDAVPSPEPPDGAFVIG

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
5 2643221548 Streptomyces sp. Root55 Isolate Unclassified
6 2643221578 Streptomyces sp. Root63 Isolate Unclassified
7 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221670 Streptomyces sp. Root431 Isolate Unclassified
10 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
11 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
12 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
13 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
14 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
15 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
16 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
17 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606448 Streptomyces sp. 193411 Isolate Unclassified
21 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
22 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
23 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
24 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
25 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
26 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
27 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
28 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
29 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
30 2862574272 Streptomyces sp. AcE210 Isolate Nodule
31 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
32 2867369537 Streptomyces sp. Z26 Isolate Unclassified
33 2867428634 Streptomyces sp. RP5T Isolate Unclassified
34 2867475112 Streptomyces sp. TM32 Isolate Unclassified
35 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
36 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
37 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
38 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
39 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
40 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
41 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
42 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
43 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
44 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
45 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
46 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
47 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
48 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
49 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
50 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
51 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
52 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
53 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
54 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
55 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
56 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
57 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
58 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
64 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
90 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
91 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
92 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
93 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
94 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
180 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
181 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
182 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
183 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
184 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
185 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
188 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
189 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
190 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
191 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
192 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
193 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
194 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
195 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
196 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.16
Metatranscriptomes 0.37
Isolates 25.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.62
Nodule 0.75
Rhizoplane 1.12
Rhizosphere 71.54
Stem 0
Stem Tuber 0
Unclassified 20.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001379 3300003316 Bacteria 16163
2 rootH1_10001379 3300003323 Bacteria 9513
3 rootH1_10097774 3300003316 Bacteria 2142
4 rootH2_10237745 3300003320 Bacteria 1032
5 rootL2_10020307 3300003322 Bacteria 13085
6 rootH1_10015998 3300003316 Bacteria 11196
7 rootH1_10015998 3300003323 Bacteria 8895
8 rootH1_10097353 3300003323 Bacteria 2479
9 JGI25160J50197_1025659 3300003354 Bacteria 1644
10 Ga0006562J51391_1042933 3300003578 Bacteria 2200
11 Ga0070714_100030269 3300005435 Bacteria 4504
12 Ga0068855_100341160 3300005563 Bacteria 1652
13 Ga0068856_100207906 3300005614 Bacteria 1972
14 Ga0183367_1003 3300015688 Bacteria 814276
15 Ga0209758_1003771 3300025297 Bacteria 13384
16 Ga0207426_1001260 3300025302 Bacteria 22101
17 Ga0207426_1001349 3300025302 Bacteria 20838
18 Ga0207426_1010001 3300025302 Bacteria 3712
19 Ga0207426_1019559 3300025302 Bacteria 2365
20 Ga0207647_10018479 3300025904 Bacteria 4711
21 Ga0207694_10287743 3300025924 Bacteria 1351
22 Ga0268266_10103422 3300028379 Bacteria 2513
23 Ga0307517_10009400 3300028786 Bacteria 13847
24 Ga0307515_10001941 3300028794 Bacteria 45822
25 Ga0307511_10000323 3300030521 Bacteria 50893
26 Ga0307512_10016019 3300030522 Bacteria 6928
27 Ga0307513_10096967 3300031456 Bacteria 2984
28 Ga0307509_10095015 3300031507 Bacteria 3038
29 Ga0307508_10007635 3300031616 Bacteria 10055
30 Ga0307508_10051474 3300031616 Bacteria 3660
31 Ga0307508_10110348 3300031616 Bacteria 2350
32 Ga0307514_10004057 3300031649 Bacteria 13612
33 Ga0307514_10041818 3300031649 Bacteria 3607
34 Ga0307514_10064493 3300031649 Bacteria 2778
35 Ga0307516_10001113 3300031730 Bacteria 37449
36 Ga0307518_10137831 3300031838 Bacteria 1705
37 Ga0307518_10268357 3300031838 Bacteria 1068
38 Ga0307507_10001166 3300033179 Bacteria 58459
39 Ga0307510_10043461 3300033180 Bacteria 4883
40 Ga0307510_10104667 3300033180 Bacteria 2602
41 Ga0395900_0127843 3300037418 Bacteria 2605
42 Ga0395898_0000903 3300037466 Bacteria 47785
43 Ga0395898_0041263 3300037466 Bacteria 4559
44 Ga0395901_0031340 3300038443 Bacteria 5483
45 Ga0439436_0004141 3300041404 Bacteria 4447
46 Ga0439439_0021051 3300041406 Bacteria 1623
47 Ga0451837_0595283 3300041494 Bacteria 4553
48 Ga0439433_0001915 3300041999 Bacteria 4356
49 Ga0439457_004014 3300042014 Bacteria 3907
50 Ga0439462_0035215 3300042015 Bacteria 1330
51 Ga0466969_0039002 3300044656 Bacteria 2388
52 Ga0466969_0046365 3300044656 Bacteria 2155
53 Ga0466969_0088241 3300044656 Bacteria 1472
54 Ga0466972_0006795 3300044658 Bacteria 5742
55 Ga0466972_0007789 3300044658 Bacteria 5376
56 Ga0466972_0092187 3300044658 Bacteria 1436
57 Ga0466972_0134329 3300044658 Bacteria 1165
58 Ga0466965_0004322 3300044683 Bacteria 6311
59 Ga0466965_0106560 3300044683 Bacteria 1438
60 Ga0466966_0001703 3300044684 Bacteria 14204
61 Ga0466966_0084196 3300044684 Bacteria 1978
62 Ga0466961_0002080 3300044693 Bacteria 12469
63 Ga0466961_0075961 3300044693 Bacteria 2129
64 Ga0466963_0002483 3300044694 Bacteria 10313
65 Ga0466964_0005276 3300044706 Bacteria 4792
66 Ga0466971_0001247 3300044719 Bacteria 10601
67 Ga0466971_0019939 3300044719 Bacteria 2980
68 Ga0466970_0000035 3300044765 Bacteria 50098
69 Ga0466970_0000831 3300044765 Bacteria 14854
70 Ga0466970_0040915 3300044765 Bacteria 2462
71 Ga0466957_0004353 3300044842 Bacteria 7870
72 Ga0466960_0038755 3300044901 Bacteria 2243
73 Ga0466959_0002302 3300045049 Bacteria 12181
74 Ga0466959_0004532 3300045049 Bacteria 9319
75 Ga0466958_0021350 3300045836 Bacteria 3782
76 Ga0466958_0067631 3300045836 Bacteria 2183
77 Ga0466967_0023482 3300045976 Bacteria 5054
78 Ga0466967_0044343 3300045976 Bacteria 3857
79 Ga0466967_0659296 3300045976 Bacteria 1035
80 Ga0495592_0075434 3300046454 Bacteria 2448
81 Ga0495603_0000462 3300046455 Bacteria 22298
82 Ga0495603_0000764 3300046455 Bacteria 18367
83 Ga0495603_0019861 3300046455 Bacteria 4068
84 Ga0495629_0000508 3300046459 Bacteria 32662
85 Ga0495629_0001478 3300046459 Bacteria 18515
86 Ga0495629_0017558 3300046459 Bacteria 5129
87 Ga0495629_0109315 3300046459 Bacteria 1928
88 Ga0495651_0062422 3300046462 Bacteria 2850
89 Ga0495653_0099898 3300046463 Bacteria 2104
90 Ga0495639_0002575 3300046475 Bacteria 7907
91 Ga0495662_0000685 3300046476 Bacteria 16020
92 Ga0495664_0003139 3300046477 Bacteria 8972
93 Ga0495594_0007039 3300046499 Bacteria 5782
94 Ga0495594_0071286 3300046499 Bacteria 1932
95 Ga0495608_0000967 3300046511 Bacteria 20282
96 Ga0495628_0044329 3300046516 Bacteria 3539
97 Ga0495630_0046813 3300046517 Bacteria 3233
98 Ga0495630_0165108 3300046517 Bacteria 1686
99 Ga0495643_0007093 3300046522 Bacteria 7271
100 Ga0495666_0022373 3300046526 Bacteria 3130
101 Ga0495652_0025103 3300046529 Bacteria 5274
102 Ga0495652_0076144 3300046529 Bacteria 2784
103 Ga0495665_0006035 3300046531 Bacteria 6530
104 Ga0495640_0001890 3300046533 Bacteria 16677
105 Ga0495586_0107233 3300046535 Bacteria 1553
106 Ga0495587_0053806 3300046536 Bacteria 2372
107 Ga0495645_0010194 3300046543 Bacteria 6584
108 Ga0495645_0084921 3300046543 Bacteria 2266
109 Ga0495645_0190958 3300046543 Bacteria 1396
110 Ga0495622_0085155 3300046557 Bacteria 1454
111 Ga0495656_0194179 3300046615 Bacteria 1004
112 Ga0495634_0106526 3300046642 Bacteria 1806
113 Ga0495611_0014002 3300046648 Bacteria 3422
114 Ga0495611_0043497 3300046648 Bacteria 2008
115 Ga0495588_0010959 3300046674 Bacteria 4241
116 Ga0495657_0003469 3300046675 Bacteria 12859
117 Ga0495657_0051694 3300046675 Bacteria 2758
118 Ga0495599_0034117 3300046678 Bacteria 3197
119 Ga0495623_0027253 3300046679 Bacteria 3674
120 Ga0495646_0004635 3300046680 Bacteria 8650
121 Ga0495647_0038747 3300046681 Bacteria 1803
122 Ga0495613_0009740 3300046689 Bacteria 7142
123 Ga0495613_0018721 3300046689 Bacteria 5163
124 Ga0495670_0263893 3300046691 Bacteria 919
125 Ga0495649_0178886 3300046694 Bacteria 1107
126 Ga0495589_0077981 3300046794 Bacteria 1614
127 Ga0495600_0063952 3300046809 Bacteria 2404
128 Ga0495581_0057557 3300047315 Bacteria 2243
129 Ga0495581_0112178 3300047315 Bacteria 1585
130 Ga0495604_0004566 3300047317 Bacteria 10971
131 Ga0495636_0038114 3300047318 Bacteria 1987
132 Ga0495674_0026524 3300047319 Bacteria 5301
133 Ga0495676_0008304 3300047321 Bacteria 9519
134 Ga0495680_0008331 3300047322 Bacteria 9431
135 Ga0495687_043668 3300047443 Bacteria 1952
136 Ga0495687_065172 3300047443 Bacteria 1484
137 Ga0495675_0012263 3300047444 Bacteria 5395
138 Ga0495675_0043765 3300047444 Bacteria 2852
139 Ga0495685_001010 3300047447 Bacteria 8564
140 Ga0495685_004563 3300047447 Bacteria 4486
141 Ga0495685_025798 3300047447 Bacteria 2023
142 Ga0495681_0001438 3300047470 Bacteria 17876
143 Ga0495686_0085112 3300047472 Bacteria 1926
144 Ga0495602_0054476 3300048088 Bacteria 3530
145 Ga0495614_0000944 3300048089 Bacteria 12335
146 Ga0496102_0282295 3300048905 Bacteria 1565
147 Ga0496106_0016299 3300048909 Bacteria 5499
148 Ga0501031_0046717 3300049568 Bacteria 2823
149 Ga0501031_0198042 3300049568 Bacteria 1311
150 Ga0501032_0008873 3300049569 Bacteria 7311
151 Ga0501033_0010603 3300049570 Bacteria 7067
152 Ga0501033_0092770 3300049570 Bacteria 2208
153 Ga0501033_0189850 3300049570 Bacteria 1470
154 Ga0501034_0005099 3300049571 Bacteria 14418
155 Ga0501034_0021910 3300049571 Bacteria 6511
156 Ga0501036_0009325 3300049572 Bacteria 8071
157 Ga0501036_0059491 3300049572 Bacteria 3237
158 Ga0501036_0438933 3300049572 Bacteria 1088
159 Ga0501037_0103035 3300049573 Bacteria 2058
160 Ga0501038_0000732 3300049574 Bacteria 29297
161 Ga0501038_0017069 3300049574 Bacteria 6566
162 Ga0501038_0027500 3300049574 Bacteria 5060
163 Ga0501038_0426676 3300049574 Bacteria 1022
164 Ga0501039_0001579 3300049575 Bacteria 16768
165 Ga0501039_0492793 3300049575 Bacteria 962
166 Ga0501042_0160032 3300049578 Bacteria 1624
167 Ga0501043_0003436 3300049579 Bacteria 13009
168 Ga0501043_0057670 3300049579 Bacteria 3049
169 Ga0501043_0077244 3300049579 Bacteria 2616
170 Ga0501046_0123617 3300049580 Bacteria 1967
171 Ga0501047_0028555 3300049581 Bacteria 5380
172 Ga0501047_0125646 3300049581 Bacteria 2445
173 Ga0501070_0000195 3300049586 Bacteria 56683
174 Ga0501070_0418163 3300049586 Bacteria 1083
175 Ga0501074_0006734 3300049590 Bacteria 8290
176 Ga0501080_0009940 3300049742 Bacteria 8693
177 Ga0501035_0003960 3300049822 Bacteria 14121
178 Ga0501035_0017644 3300049822 Bacteria 6583
179 Ga0501035_0133996 3300049822 Bacteria 2158
180 Ga0501035_0202137 3300049822 Bacteria 1703
181 Ga0501035_0295262 3300049822 Bacteria 1367
182 Ga0501035_0469877 3300049822 Bacteria 1039
183 Ga0501044_0003202 3300049823 Bacteria 18453
184 Ga0501044_0004407 3300049823 Bacteria 15750
185 Ga0501044_0011758 3300049823 Bacteria 9483
186 Ga0501044_0134534 3300049823 Bacteria 2464
187 Ga0501044_0135050 3300049823 Bacteria 2458
188 Ga0501044_0284337 3300049823 Bacteria 1586
189 Ga0501045_0248168 3300049824 Bacteria 1325
190 nmdc:mga06z11_2866_c1 3300050494 Bacteria 6621
191 nmdc:mga04h51_2608_c1 3300050495 Bacteria 4290
192 Ga0500560_029302 3300053107 Bacteria 1650
193 Ga0500614_067067 3300053123 Bacteria 977
194 Ga0500628_051584 3300053129 Bacteria 978
195 Ga0500658_0003652 3300053134 Bacteria 5802
196 Ga0500573_0007557 3300053140 Bacteria 5935
197 Ga0500600_0056614 3300053149 Bacteria 2203
198 Ga0500633_0062976 3300053160 Bacteria 1309
199 Ga0466962_0005454 3300061719 Bacteria 6112
200 Ga0466962_0020914 3300061719 Bacteria 3144
201 Ga0466962_0061841 3300061719 Bacteria 1787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2867428634 2867429267 237
2 3300025302 Ga0207426_1019559 Ga0207426_10195592 255
3 3300053107 Ga0500560_029302 Ga0500560_029302_846_1640 259
4 3300031649 Ga0307514_10041818 Ga0307514_100418182 262
5 iso_pu_bacteria 2791355406 2793985122 263
6 3300003354 JGI25160J50197_1025659 JGI25160J50197_10256592 266
7 3300025302 Ga0207426_1001260 Ga0207426_10012609 266
8 3300003316 rootH1_10097774 rootH1_100977742 270
9 3300003323 rootH1_10015998 rootH1_1001599810 270
10 3300046455 Ga0495603_0000764 Ga0495603_0000764_4060_4884 270
11 3300046459 Ga0495629_0109315 Ga0495629_0109315_56_880 270
12 3300046499 Ga0495594_0071286 Ga0495594_0071286_494_1318 270
13 3300046517 Ga0495630_0165108 Ga0495630_0165108_170_994 270
14 3300046615 Ga0495656_0194179 Ga0495656_0194179_96_920 270
15 3300046681 Ga0495647_0038747 Ga0495647_0038747_43_873 270
16 3300046691 Ga0495670_0263893 Ga0495670_0263893_58_882 270
17 3300046794 Ga0495589_0077981 Ga0495589_0077981_71_895 270
18 3300047315 Ga0495581_0112178 Ga0495581_0112178_178_1002 270
19 3300047318 Ga0495636_0038114 Ga0495636_0038114_980_1804 270
20 3300047447 Ga0495685_004563 Ga0495685_004563_132_956 270
21 3300005563 Ga0068855_100341160 Ga0068855_1003411602 271
22 3300005614 Ga0068856_100207906 Ga0068856_1002079061 271
23 3300025904 Ga0207647_10018479 Ga0207647_100184794 271
24 3300025924 Ga0207694_10287743 Ga0207694_102877432 271
25 3300030521 Ga0307511_10000323 Ga0307511_1000032325 271
26 3300031649 Ga0307514_10064493 Ga0307514_100644933 271
27 3300031838 Ga0307518_10137831 Ga0307518_101378312 271
28 3300031838 Ga0307518_10268357 Ga0307518_102683571 271
29 3300033180 Ga0307510_10043461 Ga0307510_100434613 271
30 3300044658 Ga0466972_0092187 Ga0466972_0092187_56_883 271
31 3300044658 Ga0466972_0134329 Ga0466972_0134329_186_1013 271
32 3300044901 Ga0466960_0038755 Ga0466960_0038755_1151_1978 271
33 3300046459 Ga0495629_0001478 Ga0495629_0001478_9256_10083 271
34 3300046499 Ga0495594_0007039 Ga0495594_0007039_4427_5254 271
35 3300046557 Ga0495622_0085155 Ga0495622_0085155_257_1084 271
36 3300046648 Ga0495611_0014002 Ga0495611_0014002_802_1629 271
37 3300046674 Ga0495588_0010959 Ga0495588_0010959_1599_2426 271
38 3300048905 Ga0496102_0282295 Ga0496102_0282295_340_1167 271
39 3300049568 Ga0501031_0198042 Ga0501031_0198042_324_1151 271
40 3300049572 Ga0501036_0438933 Ga0501036_0438933_128_955 271
41 3300049574 Ga0501038_0000732 Ga0501038_0000732_18166_18993 271
42 3300049575 Ga0501039_0492793 Ga0501039_0492793_87_914 271
43 3300049579 Ga0501043_0077244 Ga0501043_0077244_1596_2423 271
44 3300049581 Ga0501047_0125646 Ga0501047_0125646_1359_2186 271
45 3300049586 Ga0501070_0418163 Ga0501070_0418163_177_1004 271
46 3300049742 Ga0501080_0009940 Ga0501080_0009940_6589_7416 271
47 3300049822 Ga0501035_0469877 Ga0501035_0469877_94_921 271
48 3300049823 Ga0501044_0003202 Ga0501044_0003202_2219_3046 271
49 3300049823 Ga0501044_0284337 Ga0501044_0284337_137_964 271
50 3300050494 nmdc:mga06z11_2866_c1 nmdc:mga06z11_2866_c1_157_984 271
51 3300050495 nmdc:mga04h51_2608_c1 nmdc:mga04h51_2608_c1_3448_4275 271
52 iso_pu_bacteria 3006425503 3006430750 272
53 3300028794 Ga0307515_10001941 Ga0307515_1000194115 273
54 3300031616 Ga0307508_10051474 Ga0307508_100514743 273
55 iso_pu_bacteria 2547132111 2547409177 273
56 iso_pu_bacteria 2554235005 2554259757 273
57 iso_pu_bacteria 2582581313 2585310281 273
58 iso_pu_bacteria 2616644941 2616905839 273
59 iso_pu_bacteria 2643221548 2643764515 273
60 iso_pu_bacteria 2643221578 2643905154 273
61 iso_pu_bacteria 2643221587 2643942631 273
62 iso_pu_bacteria 2643221647 2644264212 273
63 iso_pu_bacteria 2643221670 2644385991 273
64 iso_pu_bacteria 2643221673 2644403212 273
65 iso_pu_bacteria 2643221677 2644430090 273
66 iso_pu_bacteria 2643221682 2644458426 273
67 iso_pu_bacteria 2784132148 2784586576 273
68 iso_pu_bacteria 2784746768 2785366959 273
69 iso_pu_bacteria 2808606375 2808918184 273
70 iso_pu_bacteria 2808606448 2809230090 273
71 iso_pu_bacteria 2808606982 2811846802 273
72 iso_pu_bacteria 2811994917 2812482587 273
73 iso_pu_bacteria 2852635781 2852641318 273
74 iso_pu_bacteria 2862281513 2862289855 273
75 iso_pu_bacteria 2862382967 2862392716 273
76 iso_pu_bacteria 2862507626 2862509792 273
77 iso_pu_bacteria 2862574272 2862580188 273
78 iso_pu_bacteria 2867346516 2867346685 273
79 iso_pu_bacteria 2875391855 2875392517 273
80 iso_pu_bacteria 2877676314 2877683581 273
81 iso_pu_bacteria 2912715099 2912722749 273
82 iso_pu_bacteria 2912723979 2912726367 273
83 iso_pu_bacteria 2912757875 2912758577 273
84 iso_pu_bacteria 2918501144 2918502327 273
85 iso_pu_bacteria 2946045630 2946052215 273
86 iso_pu_bacteria 2954380949 2954388836 273
87 iso_pu_bacteria 2954691527 2954699625 273
88 iso_pu_bacteria 2954701450 2954702593 273
89 iso_pu_bacteria 2966598605 2966604600 273
90 iso_pu_bacteria 2997600082 2997603341 273
91 iso_pu_bacteria 3006393351 3006394613 273
92 iso_pu_bacteria 3006493962 3006498286 273
93 iso_pu_bacteria 8023623736 8023631352 273
94 iso_pu_bacteria 8025530807 8025535932 273
95 iso_pu_bacteria 8047893842 8047894527 273
96 iso_pu_bacteria 8048127548 8048134978 273
97 iso_pu_bacteria 8048356638 8048364525 273
98 iso_pu_bacteria 8048369669 8048371544 273
99 iso_pu_bacteria 8048379754 8048380478 273
100 iso_pu_bacteria 8056447290 8056451739 273
101 iso_pu_bacteria 8056667051 8056670306 273
102 3300031507 Ga0307509_10095015 Ga0307509_100950153 274
103 iso_pu_bacteria 2643221678 2644438241 274
104 iso_pu_bacteria 2808606359 2808847456 274
105 iso_pu_bacteria 2954002825 2954008910 274
106 3300049568 Ga0501031_0046717 Ga0501031_0046717_253_1125 275
107 3300049822 Ga0501035_0202137 Ga0501035_0202137_249_1097 275
108 3300049823 Ga0501044_0134534 Ga0501044_0134534_583_1431 275
109 iso_pu_bacteria 2818991472 2819746737 275
110 iso_pu_bacteria 2862290372 2862291828 275
111 3300046543 Ga0495645_0084921 Ga0495645_0084921_275_1135 276
112 3300047444 Ga0495675_0012263 Ga0495675_0012263_3169_4029 276
113 iso_pu_bacteria 2784746763 2785345935 276
114 iso_pu_bacteria 2867475112 2867479216 276
115 3300005435 Ga0070714_100030269 Ga0070714_1000302693 277
116 3300015688 Ga0183367_1003 Ga0183367_100380 277
117 3300025297 Ga0209758_1003771 Ga0209758_10037719 277
118 3300028379 Ga0268266_10103422 Ga0268266_101034222 277
119 3300030522 Ga0307512_10016019 Ga0307512_100160196 277
120 3300031456 Ga0307513_10096967 Ga0307513_100969672 277
121 3300031616 Ga0307508_10007635 Ga0307508_1000763513 277
122 3300031649 Ga0307514_10004057 Ga0307514_1000405711 277
123 3300031730 Ga0307516_10001113 Ga0307516_1000111334 277
124 3300033179 Ga0307507_10001166 Ga0307507_1000116642 277
125 3300033180 Ga0307510_10104667 Ga0307510_101046672 277
126 3300037418 Ga0395900_0127843 Ga0395900_0127843_251_1096 277
127 3300037466 Ga0395898_0000903 Ga0395898_0000903_42144_42989 277
128 3300037466 Ga0395898_0041263 Ga0395898_0041263_559_1404 277
129 3300038443 Ga0395901_0031340 Ga0395901_0031340_4023_4868 277
130 3300041404 Ga0439436_0004141 Ga0439436_0004141_846_1700 277
131 3300041406 Ga0439439_0021051 Ga0439439_0021051_325_1179 277
132 3300041494 Ga0451837_0595283 Ga0451837_0595283_501_1355 277
133 3300041999 Ga0439433_0001915 Ga0439433_0001915_1993_2838 277
134 3300042014 Ga0439457_004014 Ga0439457_004014_1692_2537 277
135 3300042015 Ga0439462_0035215 Ga0439462_0035215_140_985 277
136 3300044656 Ga0466969_0039002 Ga0466969_0039002_607_1452 277
137 3300044656 Ga0466969_0046365 Ga0466969_0046365_46_912 277
138 3300044656 Ga0466969_0088241 Ga0466969_0088241_76_930 277
139 3300044658 Ga0466972_0006795 Ga0466972_0006795_531_1376 277
140 3300044658 Ga0466972_0007789 Ga0466972_0007789_437_1291 277
141 3300044683 Ga0466965_0004322 Ga0466965_0004322_2504_3358 277
142 3300044683 Ga0466965_0106560 Ga0466965_0106560_558_1403 277
143 3300044684 Ga0466966_0001703 Ga0466966_0001703_2669_3523 277
144 3300044684 Ga0466966_0084196 Ga0466966_0084196_13_879 277
145 3300044693 Ga0466961_0002080 Ga0466961_0002080_1062_1916 277
146 3300044693 Ga0466961_0075961 Ga0466961_0075961_811_1677 277
147 3300044694 Ga0466963_0002483 Ga0466963_0002483_3411_4265 277
148 3300044706 Ga0466964_0005276 Ga0466964_0005276_1035_1889 277
149 3300044719 Ga0466971_0001247 Ga0466971_0001247_6118_6972 277
150 3300044719 Ga0466971_0019939 Ga0466971_0019939_1351_2217 277
151 3300044765 Ga0466970_0000035 Ga0466970_0000035_21542_22396 277
152 3300044765 Ga0466970_0000831 Ga0466970_0000831_9329_10174 277
153 3300044765 Ga0466970_0040915 Ga0466970_0040915_848_1714 277
154 3300044842 Ga0466957_0004353 Ga0466957_0004353_2479_3333 277
155 3300045049 Ga0466959_0002302 Ga0466959_0002302_5236_6090 277
156 3300045049 Ga0466959_0004532 Ga0466959_0004532_1544_2410 277
157 3300045836 Ga0466958_0021350 Ga0466958_0021350_2483_3337 277
158 3300045836 Ga0466958_0067631 Ga0466958_0067631_1016_1882 277
159 3300045976 Ga0466967_0023482 Ga0466967_0023482_1035_1889 277
160 3300045976 Ga0466967_0044343 Ga0466967_0044343_1920_2765 277
161 3300045976 Ga0466967_0659296 Ga0466967_0659296_69_914 277
162 3300046455 Ga0495603_0000462 Ga0495603_0000462_17247_18092 277
163 3300046455 Ga0495603_0019861 Ga0495603_0019861_2063_2908 277
164 3300046459 Ga0495629_0000508 Ga0495629_0000508_947_1792 277
165 3300046459 Ga0495629_0017558 Ga0495629_0017558_4245_5090 277
166 3300046475 Ga0495639_0002575 Ga0495639_0002575_6877_7722 277
167 3300046529 Ga0495652_0076144 Ga0495652_0076144_1494_2339 277
168 3300046543 Ga0495645_0190958 Ga0495645_0190958_140_985 277
169 3300046648 Ga0495611_0043497 Ga0495611_0043497_194_1048 277
170 3300046675 Ga0495657_0003469 Ga0495657_0003469_1307_2200 277
171 3300046675 Ga0495657_0051694 Ga0495657_0051694_183_1028 277
172 3300046689 Ga0495613_0009740 Ga0495613_0009740_1010_1903 277
173 3300046694 Ga0495649_0178886 Ga0495649_0178886_141_986 277
174 3300047321 Ga0495676_0008304 Ga0495676_0008304_440_1285 277
175 3300047322 Ga0495680_0008331 Ga0495680_0008331_4224_5069 277
176 3300047443 Ga0495687_043668 Ga0495687_043668_952_1797 277
177 3300047444 Ga0495675_0043765 Ga0495675_0043765_1838_2683 277
178 3300047447 Ga0495685_025798 Ga0495685_025798_432_1277 277
179 3300048089 Ga0495614_0000944 Ga0495614_0000944_1794_2639 277
180 3300048909 Ga0496106_0016299 Ga0496106_0016299_4460_5305 277
181 3300049569 Ga0501032_0008873 Ga0501032_0008873_2903_3748 277
182 3300049570 Ga0501033_0010603 Ga0501033_0010603_5780_6625 277
183 3300049570 Ga0501033_0092770 Ga0501033_0092770_764_1609 277
184 3300049570 Ga0501033_0189850 Ga0501033_0189850_248_1093 277
185 3300049571 Ga0501034_0005099 Ga0501034_0005099_9240_10085 277
186 3300049571 Ga0501034_0021910 Ga0501034_0021910_2474_3319 277
187 3300049572 Ga0501036_0009325 Ga0501036_0009325_927_1772 277
188 3300049572 Ga0501036_0059491 Ga0501036_0059491_2275_3120 277
189 3300049573 Ga0501037_0103035 Ga0501037_0103035_177_1022 277
190 3300049574 Ga0501038_0017069 Ga0501038_0017069_245_1090 277
191 3300049574 Ga0501038_0027500 Ga0501038_0027500_3193_4038 277
192 3300049574 Ga0501038_0426676 Ga0501038_0426676_52_897 277
193 3300049575 Ga0501039_0001579 Ga0501039_0001579_5745_6590 277
194 3300049578 Ga0501042_0160032 Ga0501042_0160032_681_1526 277
195 3300049579 Ga0501043_0003436 Ga0501043_0003436_5351_6196 277
196 3300049579 Ga0501043_0057670 Ga0501043_0057670_1122_1967 277
197 3300049580 Ga0501046_0123617 Ga0501046_0123617_86_931 277
198 3300049581 Ga0501047_0028555 Ga0501047_0028555_907_1752 277
199 3300049586 Ga0501070_0000195 Ga0501070_0000195_15778_16623 277
200 3300049590 Ga0501074_0006734 Ga0501074_0006734_7263_8108 277
201 3300049822 Ga0501035_0003960 Ga0501035_0003960_9571_10416 277
202 3300049822 Ga0501035_0017644 Ga0501035_0017644_5588_6433 277
203 3300049822 Ga0501035_0133996 Ga0501035_0133996_1015_1860 277
204 3300049822 Ga0501035_0295262 Ga0501035_0295262_408_1256 277
205 3300049823 Ga0501044_0004407 Ga0501044_0004407_14418_15263 277
206 3300049823 Ga0501044_0011758 Ga0501044_0011758_5126_5971 277
207 3300049823 Ga0501044_0135050 Ga0501044_0135050_268_1113 277
208 3300049824 Ga0501045_0248168 Ga0501045_0248168_447_1292 277
209 3300061719 Ga0466962_0005454 Ga0466962_0005454_2479_3333 277
210 3300061719 Ga0466962_0020914 Ga0466962_0020914_1578_2444 277
211 3300061719 Ga0466962_0061841 Ga0466962_0061841_57_902 277
212 iso_pu_bacteria 2862178590 2862181372 277
213 iso_pu_bacteria 2873151551 2873157852 277
214 iso_pu_bacteria 2946064051 2946065388 277
215 iso_pu_bacteria 2954721474 2954728536 277
216 iso_pu_bacteria 2954731030 2954733275 277
217 iso_pu_bacteria 2954740390 2954747431 277
218 iso_pu_bacteria 2954749733 2954752157 277
219 iso_pu_bacteria 2954759201 2954766547 277
220 iso_pu_bacteria 8008574985 8008580930 277
221 3300003316 rootH1_10001379 rootH1_100013792 278
222 3300003320 rootH2_10237745 rootH2_102377451 278
223 3300003322 rootL2_10020307 rootL2_100203075 278
224 3300003323 rootH1_10097353 rootH1_100973532 278
225 3300003578 Ga0006562J51391_1042933 Ga0006562J51391_10429332 278
226 3300025302 Ga0207426_1001349 Ga0207426_100134916 278
227 3300025302 Ga0207426_1010001 Ga0207426_10100012 278
228 3300028786 Ga0307517_10009400 Ga0307517_100094005 278
229 3300031616 Ga0307508_10110348 Ga0307508_101103482 278
230 3300046454 Ga0495592_0075434 Ga0495592_0075434_564_1445 278
231 3300046462 Ga0495651_0062422 Ga0495651_0062422_693_1574 278
232 3300046463 Ga0495653_0099898 Ga0495653_0099898_374_1255 278
233 3300046476 Ga0495662_0000685 Ga0495662_0000685_12066_12947 278
234 3300046477 Ga0495664_0003139 Ga0495664_0003139_4998_5879 278
235 3300046511 Ga0495608_0000967 Ga0495608_0000967_14381_15262 278
236 3300046516 Ga0495628_0044329 Ga0495628_0044329_2347_3228 278
237 3300046517 Ga0495630_0046813 Ga0495630_0046813_1660_2541 278
238 3300046522 Ga0495643_0007093 Ga0495643_0007093_4634_5488 278
239 3300046526 Ga0495666_0022373 Ga0495666_0022373_622_1503 278
240 3300046529 Ga0495652_0025103 Ga0495652_0025103_2559_3440 278
241 3300046531 Ga0495665_0006035 Ga0495665_0006035_4633_5514 278
242 3300046533 Ga0495640_0001890 Ga0495640_0001890_4153_5034 278
243 3300046535 Ga0495586_0107233 Ga0495586_0107233_632_1513 278
244 3300046536 Ga0495587_0053806 Ga0495587_0053806_564_1445 278
245 3300046543 Ga0495645_0010194 Ga0495645_0010194_1066_1947 278
246 3300046642 Ga0495634_0106526 Ga0495634_0106526_679_1560 278
247 3300046678 Ga0495599_0034117 Ga0495599_0034117_312_1193 278
248 3300046679 Ga0495623_0027253 Ga0495623_0027253_1944_2825 278
249 3300046680 Ga0495646_0004635 Ga0495646_0004635_6899_7780 278
250 3300046689 Ga0495613_0018721 Ga0495613_0018721_3433_4314 278
251 3300046809 Ga0495600_0063952 Ga0495600_0063952_1277_2158 278
252 3300047315 Ga0495581_0057557 Ga0495581_0057557_674_1555 278
253 3300047317 Ga0495604_0004566 Ga0495604_0004566_1277_2158 278
254 3300047319 Ga0495674_0026524 Ga0495674_0026524_4046_4927 278
255 3300047443 Ga0495687_065172 Ga0495687_065172_454_1308 278
256 3300047447 Ga0495685_001010 Ga0495685_001010_50_904 278
257 3300047470 Ga0495681_0001438 Ga0495681_0001438_13629_14483 278
258 3300047472 Ga0495686_0085112 Ga0495686_0085112_634_1488 278
259 3300048088 Ga0495602_0054476 Ga0495602_0054476_1277_2158 278
260 3300053123 Ga0500614_067067 Ga0500614_067067_49_903 278
261 3300053129 Ga0500628_051584 Ga0500628_051584_75_929 278
262 3300053134 Ga0500658_0003652 Ga0500658_0003652_4899_5753 278
263 3300053140 Ga0500573_0007557 Ga0500573_0007557_2580_3482 278
264 3300053149 Ga0500600_0056614 Ga0500600_0056614_1311_2165 278
265 3300053160 Ga0500633_0062976 Ga0500633_0062976_282_1136 278
266 iso_pu_bacteria 2867369537 2867369655 278
267 iso_pu_bacteria 2990088156 2990090769 278

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gjy-assembly1.cif.gz_A crystal structure of a probable spermidine synthase from corynebacterium glutamicum atcc 13032 0.9087 5 271
3gjy-assembly1.cif.gz_A crystal structure of a probable spermidine synthase from corynebacterium glutamicum atcc 13032 0.8712 5 271
3bkw-assembly1.cif.gz_B crystal structure of s-adenosylmethionine dependent methyltransferase (np_104914.1) from mesorhizobium loti at 1.60 a resolution 0.7936 52 175
4mwz-assembly1.cif.gz_A crystal structure of n-methyl transferase from plasmodium vivax complexed with s-adenosyl methionine, phosphate and amodiaquine 0.779 53 179
3ujd-assembly1.cif.gz_A phosphoethanolamine methyltransferase mutant (y19f) from plasmodium falciparum in complex with phosphocholine 0.7758 54 180
ID Description Score Start End Superfamily
3gjyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8896 5 268 3.40.50.150
3gjyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8646 5 268 3.40.50.150
af_A0A144A060_258_376_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8422 68 140 3.40.50.150
af_Q4DPM4_255_475_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8156 47 222 3.40.50.150
af_Q22944_136_350_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8128 46 233 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2S6PYQ5-F1-model_v4 Spermidine synthase-like protein 0.9886 3 278 GO:0006596
AF-A0A1G9TQ40-F1-model_v4 Spermidine synthase-like protein 0.9885 2 278 GO:0006596
AF-A0A329C4V8-F1-model_v4 deleted 0.9872 3 278
AF-A0A7U9L3H4-F1-model_v4 Spermidine synthase-like protein 0.9872 1 278 GO:0006596
AF-A0A250VKZ0-F1-model_v4 Spermidine synthase-like protein 0.9867 1 278 GO:0006596

Feature Viewer

pLDDT pTM Quality
90.67 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map