F375109

General Info

Members Datasets Scaffolds Average Seq Length
267 181 534 309

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0038852|Ga0501035_0038852_710_1861
Length 348
Sequence MSAPTTATGATTTEVRRPKAPSAAEQAHKKLTSPWASLAAIVIAVLWTIPTIGLLISSFRPEEDVKGSGWWTFFSDPNVTLDNYDAVLGGDVNLATYFVNTIVITLPSVIIPITLATLAAYAFAWMQFPGRDILFIAVFAMQIVPIQVTMIPLLSLYVDPPLGLPQLAGGDAPGGGFYTIWLSHSIFALPLAIYLLHNFMKEVPAELVEAARVDGAGHVRIFTRIMLPLMTPAIAAFAIFQFLWVWNDLLVALVFGGGSLEVSPLTVRLAELSGTRGDDWHLLSAGAFVSLIVPLIVFLAGQRFFVRGIGGWPVRPQAGGSRHARAGRTSDRTPSACASGPRAHVPRR

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
51 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
69 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
70 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
71 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
137 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
138 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
157 2643221613 Oerskovia sp. Root22 Isolate Unclassified
158 2643221615 Nocardioides sp. Root224 Isolate Unclassified
159 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
160 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
161 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
162 2643221721 Oerskovia sp. Root918 Isolate Unclassified
163 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
164 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
165 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
166 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
167 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
168 2739367898 Nocardioides sp. CF479 Isolate Unclassified
169 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
170 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
171 2808606394 Promicromonospora sp. C35 Isolate Unclassified
172 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
173 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
174 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
175 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
176 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
177 2920879853 Kocuria salina CV6 Isolate Unclassified
178 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
179 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
180 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
181 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.4
Metatranscriptomes 7.87
Isolates 9.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.74
Nodule 0.37
Rhizoplane 10.86
Rhizosphere 68.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0038852 3300049822 Bacteria 4309
2 JGI25406J46586_10032307 3300003203 Bacteria 1946
3 Ga0007423J48922_100147 3300003285 Bacteria 6898
4 Ga0070658_10003158 3300005327 Bacteria 13595
5 Ga0070658_10092558 3300005327 Bacteria 2492
6 Ga0068868_100041947 3300005338 Bacteria 3568
7 Ga0070661_100033363 3300005344 Bacteria 3728
8 Ga0070668_100308117 3300005347 Bacteria 1330
9 Ga0070659_100001888 3300005366 Bacteria 14993
10 Ga0070667_100033842 3300005367 Bacteria 4275
11 Ga0070667_100119846 3300005367 Bacteria 2288
12 Ga0070662_100087386 3300005457 Bacteria 2334
13 Ga0068853_100192744 3300005539 Bacteria 1852
14 Ga0068855_100000369 3300005563 Bacteria 55783
15 Ga0070664_100096634 3300005564 Bacteria 2564
16 Ga0068854_100138407 3300005578 Bacteria 1866
17 Ga0068864_100191270 3300005618 Bacteria 1876
18 Ga0068863_100662639 3300005841 Bacteria 1036
19 Ga0068858_100000080 3300005842 Bacteria 100656
20 Ga0068860_100000408 3300005843 Bacteria 55871
21 Ga0081539_10001898 3300005985 Bacteria 32399
22 Ga0081539_10045559 3300005985 Bacteria 2521
23 Ga0081539_10058151 3300005985 Bacteria 2135
24 Ga0075365_10009441 3300006038 Bacteria 5609
25 Ga0075365_10030404 3300006038 Bacteria 3459
26 Ga0075365_10032310 3300006038 Bacteria 3363
27 Ga0075365_10049648 3300006038 Bacteria 2765
28 Ga0075365_10094531 3300006038 Bacteria 2040
29 Ga0075363_100055383 3300006048 Bacteria 2124
30 Ga0075363_100174928 3300006048 Bacteria 1220
31 Ga0075363_100219398 3300006048 Bacteria 1090
32 Ga0075364_10079082 3300006051 Bacteria 2172
33 Ga0075370_10132686 3300006353 Bacteria 1454
34 Ga0105240_10027547 3300009093 Bacteria 7438
35 Ga0105245_10033600 3300009098 Bacteria 4547
36 Ga0105243_10119385 3300009148 Bacteria 2220
37 Ga0105243_10283919 3300009148 Bacteria 1492
38 Ga0105242_10152152 3300009176 Bacteria 2018
39 Ga0105239_10013378 3300010375 Bacteria 9116
40 Ga0163162_10280662 3300013306 Bacteria 1798
41 Ga0157372_10055109 3300013307 Bacteria 4438
42 Ga0157375_10082190 3300013308 Bacteria 3262
43 Ga0157375_10151148 3300013308 Bacteria 2457
44 Ga0157375_10512133 3300013308 Bacteria 1364
45 Ga0163163_10066598 3300014325 Bacteria 3578
46 Ga0157379_10015140 3300014968 Bacteria 6765
47 Ga0163161_10272091 3300017792 Bacteria 1326
48 Ga0207654_10256133 3300025911 Bacteria 1175
49 Ga0207695_10025692 3300025913 Bacteria 6588
50 Ga0207657_10090623 3300025919 Bacteria 2551
51 Ga0207687_10033471 3300025927 Bacteria 3486
52 Ga0207687_10142436 3300025927 Bacteria 1820
53 Ga0207706_10020937 3300025933 Bacteria 5873
54 Ga0207686_10127770 3300025934 Bacteria 1739
55 Ga0207689_10204334 3300025942 Bacteria 1631
56 Ga0207679_10045404 3300025945 Bacteria 3177
57 Ga0207667_10000462 3300025949 Bacteria 54635
58 Ga0207667_10001083 3300025949 Bacteria 34556
59 Ga0207677_10071356 3300026023 Bacteria 2451
60 Ga0207703_10000033 3300026035 Bacteria 187752
61 Ga0207639_10022895 3300026041 Bacteria 4506
62 Ga0207678_10043126 3300026067 Bacteria 3905
63 Ga0268264_10000462 3300028381 Bacteria 55077
64 Ga0307515_10258200 3300028794 Bacteria 1483
65 Ga0316176_1152930 3300030732 Bacteria 1746
66 Ga0314311_1132142 3300030733 Bacteria 1240
67 Ga0307408_100028333 3300031548 Bacteria 3870
68 Ga0316578_10109833 3300031728 Bacteria 1656
69 Ga0307405_10083886 3300031731 Bacteria 2090
70 Ga0307405_10116799 3300031731 Bacteria 1818
71 Ga0307413_10052710 3300031824 Bacteria 2459
72 Ga0307413_10218453 3300031824 Bacteria 1390
73 Ga0307410_10036347 3300031852 Bacteria 3207
74 Ga0307410_10115981 3300031852 Bacteria 1945
75 Ga0307410_10394967 3300031852 Bacteria 1116
76 Ga0307406_10292992 3300031901 Bacteria 1246
77 Ga0307407_10244228 3300031903 Bacteria 1226
78 Ga0307412_10218438 3300031911 Bacteria 1459
79 Ga0307409_100028578 3300031995 Bacteria 3975
80 Ga0307409_100073904 3300031995 Bacteria 2721
81 Ga0307409_100157890 3300031995 Bacteria 1979
82 Ga0307409_100193205 3300031995 Bacteria 1814
83 Ga0307409_100394025 3300031995 Bacteria 1320
84 Ga0307416_100006374 3300032002 Bacteria 7380
85 Ga0307416_100010297 3300032002 Bacteria 6169
86 Ga0307416_100218470 3300032002 Bacteria 1825
87 Ga0307414_10083915 3300032004 Bacteria 2341
88 Ga0307411_10087120 3300032005 Bacteria 2168
89 Ga0307411_10363394 3300032005 Bacteria 1184
90 Ga0307415_100055317 3300032126 Bacteria 2714
91 Ga0307415_100229827 3300032126 Bacteria 1493
92 Ga0307415_100347599 3300032126 Bacteria 1247
93 Ga0307415_100379817 3300032126 Bacteria 1199
94 Ga0316584_0001720 3300036712 Bacteria 13419
95 Ga0395905_0067274 3300037471 Bacteria 3356
96 Ga0395901_0009127 3300038443 Bacteria 10043
97 Ga0395901_0212202 3300038443 Bacteria 2026
98 Ga0451791_1290433 3300041451 Bacteria 1212
99 Ga0451793_0689201 3300041452 Bacteria 4439
100 Ga0451795_0030003 3300041456 Bacteria 1027
101 Ga0451795_0848713 3300041456 Bacteria 1251
102 Ga0451837_1672359 3300041494 Bacteria 1347
103 Ga0451853_1692918 3300041512 Bacteria 1210
104 Ga0439464_0023642 3300042439 Bacteria 1697
105 Ga0466972_0051757 3300044658 Bacteria 1981
106 Ga0466965_0005646 3300044683 Bacteria 5645
107 Ga0466965_0009216 3300044683 Bacteria 4586
108 Ga0466961_0030691 3300044693 Bacteria 3453
109 Ga0466961_0111863 3300044693 Bacteria 1718
110 Ga0466971_0048667 3300044719 Bacteria 1906
111 Ga0466968_0114798 3300044735 Bacteria 1214
112 Ga0466970_0008803 3300044765 Bacteria 5084
113 Ga0466970_0009101 3300044765 Bacteria 5011
114 Ga0466970_0009655 3300044765 Bacteria 4881
115 Ga0466957_0013282 3300044842 Bacteria 4777
116 Ga0466957_0302076 3300044842 Bacteria 1076
117 Ga0466960_0000747 3300044901 Bacteria 11416
118 Ga0466959_0200183 3300045049 Bacteria 1391
119 Ga0466958_0010303 3300045836 Bacteria 5233
120 Ga0466967_0016508 3300045976 Bacteria 5826
121 Ga0466967_0190039 3300045976 Bacteria 1940
122 Ga0495627_038285 3300046453 Bacteria 1483
123 Ga0495667_0207065 3300046559 Bacteria 1254
124 Ga0495656_0056106 3300046615 Bacteria 1701
125 Ga0495668_0205601 3300046616 Bacteria 1078
126 Ga0495686_0219487 3300047472 Bacteria 1082
127 Ga0496100_0279202 3300048903 Bacteria 1245
128 Ga0496101_0307320 3300048904 Bacteria 1243
129 Ga0496102_0008247 3300048905 Bacteria 8922
130 Ga0496102_0633164 3300048905 Bacteria 993
131 Ga0496104_0170555 3300048907 Bacteria 2087
132 Ga0496104_0178771 3300048907 Bacteria 2032
133 Ga0496104_0593437 3300048907 Bacteria 1018
134 Ga0496105_0001848 3300048908 Bacteria 15183
135 Ga0496105_0302431 3300048908 Bacteria 1286
136 Ga0496105_0308279 3300048908 Bacteria 1271
137 Ga0496108_0023119 3300048911 Bacteria 5112
138 Ga0496109_0003071 3300048912 Bacteria 13920
139 Ga0496109_0019092 3300048912 Bacteria 6037
140 Ga0496110_0011193 3300048913 Bacteria 7333
141 Ga0496110_0515527 3300048913 Bacteria 1088
142 Ga0496111_0001988 3300048914 Bacteria 12153
143 Ga0496111_0002229 3300048914 Bacteria 11629
144 Ga0496111_0041580 3300048914 Bacteria 3299
145 Ga0496113_0010046 3300048916 Bacteria 6242
146 Ga0496114_0008784 3300048917 Bacteria 8006
147 Ga0496114_0012377 3300048917 Bacteria 6827
148 Ga0496114_0028433 3300048917 Bacteria 4588
149 Ga0496114_0039606 3300048917 Bacteria 3900
150 Ga0496114_0297740 3300048917 Bacteria 1424
151 Ga0496115_0073610 3300048918 Bacteria 2773
152 Ga0496118_0035666 3300048921 Bacteria 4034
153 Ga0496122_0000593 3300048925 Bacteria 74464
154 Ga0496124_0170618 3300048927 Bacteria 1685
155 Ga0496125_0000074 3300048928 Bacteria 235549
156 Ga0496126_0022596 3300048929 Bacteria 6113
157 Ga0501031_0070216 3300049568 Bacteria 2281
158 Ga0501032_0018200 3300049569 Bacteria 4924
159 Ga0501033_0018876 3300049570 Bacteria 5212
160 Ga0501034_0000182 3300049571 Bacteria 117605
161 Ga0501034_0074064 3300049571 Bacteria 3414
162 Ga0501036_0012153 3300049572 Bacteria 7133
163 Ga0501036_0042481 3300049572 Bacteria 3849
164 Ga0501036_0186902 3300049572 Bacteria 1744
165 Ga0501036_0285721 3300049572 Bacteria 1380
166 Ga0501037_0016382 3300049573 Bacteria 5454
167 Ga0501038_0001463 3300049574 Bacteria 21730
168 Ga0501038_0241921 3300049574 Bacteria 1432
169 Ga0501039_0019617 3300049575 Bacteria 5185
170 Ga0501040_0053680 3300049576 Bacteria 2761
171 Ga0501042_0006531 3300049578 Bacteria 7577
172 Ga0501042_0055955 3300049578 Bacteria 2815
173 Ga0501043_0028638 3300049579 Bacteria 4372
174 Ga0501043_0243344 3300049579 Bacteria 1387
175 Ga0501046_0002795 3300049580 Bacteria 16250
176 Ga0501046_0004732 3300049580 Bacteria 12281
177 Ga0501046_0046322 3300049580 Bacteria 3451
178 Ga0501047_0025235 3300049581 Bacteria 5711
179 Ga0501047_0037813 3300049581 Bacteria 4667
180 Ga0501067_0015851 3300049583 Bacteria 4169
181 Ga0501067_0068772 3300049583 Bacteria 1961
182 Ga0501067_0197097 3300049583 Bacteria 1122
183 Ga0501070_0061998 3300049586 Bacteria 3097
184 Ga0501070_0156183 3300049586 Bacteria 1881
185 Ga0501070_0485508 3300049586 Bacteria 993
186 Ga0501071_0246793 3300049587 Bacteria 1347
187 Ga0501072_0071355 3300049588 Bacteria 2744
188 Ga0501072_0328445 3300049588 Bacteria 1215
189 Ga0501073_0092169 3300049589 Bacteria 2106
190 Ga0501073_0168094 3300049589 Bacteria 1518
191 Ga0501074_0093869 3300049590 Bacteria 2149
192 Ga0501074_0242354 3300049590 Bacteria 1282
193 Ga0501075_0100202 3300049591 Bacteria 2200
194 Ga0501075_0168139 3300049591 Bacteria 1673
195 Ga0501076_0067244 3300049592 Bacteria 2861
196 Ga0501079_0209026 3300049741 Bacteria 1524
197 Ga0501080_0084570 3300049742 Bacteria 2948
198 Ga0501080_0129944 3300049742 Bacteria 2331
199 Ga0501044_0006089 3300049823 Bacteria 13310
200 Ga0501044_0074612 3300049823 Bacteria 3445
201 Ga0501045_0039167 3300049824 Bacteria 3449
202 nmdc:mga00v17_105013_c1 3300050491 Bacteria 1787
203 nmdc:mga00v17_21493_c1 3300050491 Bacteria 3710
204 nmdc:mga00v17_52186_c1 3300050491 Bacteria 2487
205 nmdc:mga0yw44_146635_c1 3300050492 Bacteria 1537
206 nmdc:mga0yw44_324305_c1 3300050492 Bacteria 1034
207 nmdc:mga0yw44_56122_c1 3300050492 Bacteria 2398
208 nmdc:mga0yw44_67129_c1 3300050492 Bacteria 2216
209 nmdc:mga0yw44_72019_c1 3300050492 Bacteria 2147
210 nmdc:mga0yw44_80594_c1 3300050492 Bacteria 2040
211 nmdc:mga07m45_118297_c1 3300050496 Bacteria 1530
212 nmdc:mga07m45_54271_c1 3300050496 Bacteria 2265
213 Ga0495619_0214677 3300053085 Bacteria 1332
214 Ga0500556_0000599 3300053104 Bacteria 23426
215 Ga0500593_003592 3300053117 Bacteria 5891
216 Ga0500604_0035974 3300053151 Bacteria 1475
217 Ga0500616_0000752 3300053153 Bacteria 37274
218 Ga0500616_0000978 3300053153 Bacteria 30864
219 Ga0587066_000913 3300059490 Bacteria 2739
220 Ga0587066_019222 3300059490 Bacteria 1109
221 Ga0587073_0002582 3300059492 Bacteria 2349
222 Ga0587073_0035159 3300059492 Bacteria 1061
223 Ga0587077_010404 3300059493 Bacteria 1438
224 Ga0587080_017846 3300059503 Bacteria 1135
225 Ga0587083_0007265 3300059505 Bacteria 1689
226 Ga0587083_0009558 3300059505 Bacteria 1549
227 Ga0587091_004355 3300059511 Bacteria 1855
228 Ga0587106_002231 3300059605 Bacteria 1870
229 Ga0587067_003338 3300059640 Bacteria 2000
230 Ga0587067_003605 3300059640 Bacteria 1950
231 Ga0587068_004859 3300059641 Bacteria 1802
232 Ga0587069_001684 3300059642 Bacteria 2093
233 Ga0587069_011096 3300059642 Bacteria 1198
234 Ga0587072_000252 3300059643 Bacteria 4927
235 Ga0587076_002181 3300059645 Bacteria 2159
236 Ga0587079_008038 3300059647 Bacteria 1599
237 Ga0587079_025750 3300059647 Bacteria 1095
238 Ga0587111_0024277 3300060346 Bacteria 1192
239 Ga0501082_0005770 3300060353 Bacteria 10743
240 Ga0501082_0078993 3300060353 Bacteria 2838
241 Ga0466962_0003018 3300061719 Bacteria 8025
242 2515853933 2515154155 Bacteria 7985436
243 2644084061 2643221613 Bacteria 4622396
244 2644091070 2643221615 Bacteria 5487866
245 2644320873 2643221657 Bacteria 5490246
246 2644504572 2643221690 Bacteria 4654705
247 2644523941 2643221694 Bacteria 4392972
248 2644666675 2643221721 Bacteria 4486924
249 2644668038 2643221722 Bacteria 4247614
250 2731906741 2731639228 Bacteria 4187555
251 2738694561 2738541272 Bacteria 6848551
252 2739324036 2738543027 Bacteria 6409078
253 2739606917 2739367654 Bacteria 6049412
254 2740166357 2739367898 Bacteria 4367674
255 2760305201 2758568522 Bacteria 5953541
256 2760620986 2758568621 Bacteria 5967089
257 2809025779 2808606394 Bacteria 6248540
258 2812362874 2811994880 Bacteria 4147780
259 2855389945 2855386786 Bacteria 4752232
260 2857483812 2857481737 Bacteria 4761446
261 2868092766 2868088558 Bacteria 7609351
262 2884997239 2884994152 Bacteria 4492978
263 2920880899 2920879853 Bacteria 4216831
264 2932431453 2932431166 Bacteria 4215299
265 2935892818 2935890801 Bacteria 4593001
266 8054610266 8054609563 Bacteria 5170090
267 8056580131 8056579771 Bacteria 5840325
268 Ga0501035_0038852
269 JGI25406J46586_10032307
270 Ga0007423J48922_100147
271 Ga0070658_10003158
272 Ga0070658_10092558
273 Ga0068868_100041947
274 Ga0070661_100033363
275 Ga0070668_100308117
276 Ga0070659_100001888
277 Ga0070667_100033842
278 Ga0070667_100119846
279 Ga0070662_100087386
280 Ga0068853_100192744
281 Ga0068855_100000369
282 Ga0070664_100096634
283 Ga0068854_100138407
284 Ga0068864_100191270
285 Ga0068863_100662639
286 Ga0068858_100000080
287 Ga0068860_100000408
288 Ga0081539_10001898
289 Ga0081539_10045559
290 Ga0081539_10058151
291 Ga0075365_10009441
292 Ga0075365_10030404
293 Ga0075365_10032310
294 Ga0075365_10049648
295 Ga0075365_10094531
296 Ga0075363_100055383
297 Ga0075363_100174928
298 Ga0075363_100219398
299 Ga0075364_10079082
300 Ga0075370_10132686
301 Ga0105240_10027547
302 Ga0105245_10033600
303 Ga0105243_10119385
304 Ga0105243_10283919
305 Ga0105242_10152152
306 Ga0105239_10013378
307 Ga0163162_10280662
308 Ga0157372_10055109
309 Ga0157375_10082190
310 Ga0157375_10151148
311 Ga0157375_10512133
312 Ga0163163_10066598
313 Ga0157379_10015140
314 Ga0163161_10272091
315 Ga0207654_10256133
316 Ga0207695_10025692
317 Ga0207657_10090623
318 Ga0207687_10033471
319 Ga0207687_10142436
320 Ga0207706_10020937
321 Ga0207686_10127770
322 Ga0207689_10204334
323 Ga0207679_10045404
324 Ga0207667_10000462
325 Ga0207667_10001083
326 Ga0207677_10071356
327 Ga0207703_10000033
328 Ga0207639_10022895
329 Ga0207678_10043126
330 Ga0268264_10000462
331 Ga0307515_10258200
332 Ga0316176_1152930
333 Ga0314311_1132142
334 Ga0307408_100028333
335 Ga0316578_10109833
336 Ga0307405_10083886
337 Ga0307405_10116799
338 Ga0307413_10052710
339 Ga0307413_10218453
340 Ga0307410_10036347
341 Ga0307410_10115981
342 Ga0307410_10394967
343 Ga0307406_10292992
344 Ga0307407_10244228
345 Ga0307412_10218438
346 Ga0307409_100028578
347 Ga0307409_100073904
348 Ga0307409_100157890
349 Ga0307409_100193205
350 Ga0307409_100394025
351 Ga0307416_100006374
352 Ga0307416_100010297
353 Ga0307416_100218470
354 Ga0307414_10083915
355 Ga0307411_10087120
356 Ga0307411_10363394
357 Ga0307415_100055317
358 Ga0307415_100229827
359 Ga0307415_100347599
360 Ga0307415_100379817
361 Ga0316584_0001720
362 Ga0395905_0067274
363 Ga0395901_0009127
364 Ga0395901_0212202
365 Ga0451791_1290433
366 Ga0451793_0689201
367 Ga0451795_0030003
368 Ga0451795_0848713
369 Ga0451837_1672359
370 Ga0451853_1692918
371 Ga0439464_0023642
372 Ga0466972_0051757
373 Ga0466965_0005646
374 Ga0466965_0009216
375 Ga0466961_0030691
376 Ga0466961_0111863
377 Ga0466971_0048667
378 Ga0466968_0114798
379 Ga0466970_0008803
380 Ga0466970_0009101
381 Ga0466970_0009655
382 Ga0466957_0013282
383 Ga0466957_0302076
384 Ga0466960_0000747
385 Ga0466959_0200183
386 Ga0466958_0010303
387 Ga0466967_0016508
388 Ga0466967_0190039
389 Ga0495627_038285
390 Ga0495667_0207065
391 Ga0495656_0056106
392 Ga0495668_0205601
393 Ga0495686_0219487
394 Ga0496100_0279202
395 Ga0496101_0307320
396 Ga0496102_0008247
397 Ga0496102_0633164
398 Ga0496104_0170555
399 Ga0496104_0178771
400 Ga0496104_0593437
401 Ga0496105_0001848
402 Ga0496105_0302431
403 Ga0496105_0308279
404 Ga0496108_0023119
405 Ga0496109_0003071
406 Ga0496109_0019092
407 Ga0496110_0011193
408 Ga0496110_0515527
409 Ga0496111_0001988
410 Ga0496111_0002229
411 Ga0496111_0041580
412 Ga0496113_0010046
413 Ga0496114_0008784
414 Ga0496114_0012377
415 Ga0496114_0028433
416 Ga0496114_0039606
417 Ga0496114_0297740
418 Ga0496115_0073610
419 Ga0496118_0035666
420 Ga0496122_0000593
421 Ga0496124_0170618
422 Ga0496125_0000074
423 Ga0496126_0022596
424 Ga0501031_0070216
425 Ga0501032_0018200
426 Ga0501033_0018876
427 Ga0501034_0000182
428 Ga0501034_0074064
429 Ga0501036_0012153
430 Ga0501036_0042481
431 Ga0501036_0186902
432 Ga0501036_0285721
433 Ga0501037_0016382
434 Ga0501038_0001463
435 Ga0501038_0241921
436 Ga0501039_0019617
437 Ga0501040_0053680
438 Ga0501042_0006531
439 Ga0501042_0055955
440 Ga0501043_0028638
441 Ga0501043_0243344
442 Ga0501046_0002795
443 Ga0501046_0004732
444 Ga0501046_0046322
445 Ga0501047_0025235
446 Ga0501047_0037813
447 Ga0501067_0015851
448 Ga0501067_0068772
449 Ga0501067_0197097
450 Ga0501070_0061998
451 Ga0501070_0156183
452 Ga0501070_0485508
453 Ga0501071_0246793
454 Ga0501072_0071355
455 Ga0501072_0328445
456 Ga0501073_0092169
457 Ga0501073_0168094
458 Ga0501074_0093869
459 Ga0501074_0242354
460 Ga0501075_0100202
461 Ga0501075_0168139
462 Ga0501076_0067244
463 Ga0501079_0209026
464 Ga0501080_0084570
465 Ga0501080_0129944
466 Ga0501044_0006089
467 Ga0501044_0074612
468 Ga0501045_0039167
469 nmdc:mga00v17_105013_c1
470 nmdc:mga00v17_21493_c1
471 nmdc:mga00v17_52186_c1
472 nmdc:mga0yw44_146635_c1
473 nmdc:mga0yw44_324305_c1
474 nmdc:mga0yw44_56122_c1
475 nmdc:mga0yw44_67129_c1
476 nmdc:mga0yw44_72019_c1
477 nmdc:mga0yw44_80594_c1
478 nmdc:mga07m45_118297_c1
479 nmdc:mga07m45_54271_c1
480 Ga0495619_0214677
481 Ga0500556_0000599
482 Ga0500593_003592
483 Ga0500604_0035974
484 Ga0500616_0000752
485 Ga0500616_0000978
486 Ga0587066_000913
487 Ga0587066_019222
488 Ga0587073_0002582
489 Ga0587073_0035159
490 Ga0587077_010404
491 Ga0587080_017846
492 Ga0587083_0007265
493 Ga0587083_0009558
494 Ga0587091_004355
495 Ga0587106_002231
496 Ga0587067_003338
497 Ga0587067_003605
498 Ga0587068_004859
499 Ga0587069_001684
500 Ga0587069_011096
501 Ga0587072_000252
502 Ga0587076_002181
503 Ga0587079_008038
504 Ga0587079_025750
505 Ga0587111_0024277
506 Ga0501082_0005770
507 Ga0501082_0078993
508 Ga0466962_0003018
509 2515853933
510 2644084061
511 2644091070
512 2644320873
513 2644504572
514 2644523941
515 2644666675
516 2644668038
517 2731906741
518 2738694561
519 2739324036
520 2739606917
521 2740166357
522 2760305201
523 2760620986
524 2809025779
525 2812362874
526 2855389945
527 2857483812
528 2868092766
529 2884997239
530 2920880899
531 2932431453
532 2935892818
533 8054610266
534 8056580131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

31

311

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.798 27 294
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.7933 32 304
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.7927 32 295
3fh6-assembly2.cif.gz_I crystal structure of the resting state maltose transporter from e. coli 0.7871 29 294
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.7755 32 304
ID Description Score Start End Superfamily
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8565 22 291 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8506 22 291 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.846 21 294 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8436 22 291 1.10.3720.10
af_P0AFR9_7_261_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8431 32 296 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A662D8Y3-F1-model_v4 Carbohydrate ABC transporter permease 0.9506 94 304 GO:0005886
GO:0055085
AF-A0A662D8Y3-F1-model_v4 Carbohydrate ABC transporter permease 0.942 94 304 GO:0005886
GO:0055085
AF-A0A3M2E0U9-F1-model_v4 Carbohydrate ABC transporter permease 0.9327 74 303 GO:0005886
GO:0055085
AF-A0A7W1AA16-F1-model_v4 Carbohydrate ABC transporter permease 0.9266 36 303 GO:0005886
GO:0055085
AF-A0A4Q3VUK2-F1-model_v4 Carbohydrate ABC transporter permease 0.9235 78 304 GO:0005886
GO:0055085

Map