F375094

General Info

Members Datasets Scaffolds Average Seq Length
267 124 267 132

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0338472|Ga0501071_0338472_283_768
Length 161
Sequence VGVRRWERRGARGGHRRVPLRARGQALIFVDTSFWVALRLRRDGRHDDAVRLLDDHSRSPFVTSNHVRGETWTFLRARGGHRDGVAFLEMLEHTPRLQIVFAGESLERDALDWLRRHDERPYSFVDATSFAVMRSLGIREALAFDGDFAAAGFVELGSPGA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 2.25
Rhizosphere 96.25
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10046870 3300003373 Bacteria 1099
2 Ga0070658_11516302 3300005327 Unclassified 581
3 Ga0070683_100336176 3300005329 Bacteria 1438
4 Ga0070660_100741197 3300005339 Bacteria 825
5 Ga0070692_10225458 3300005345 Bacteria 1110
6 Ga0070674_100714832 3300005356 Bacteria 858
7 Ga0070659_100056923 3300005366 Bacteria 3082
8 Ga0070713_100005562 3300005436 Bacteria 8635
9 Ga0070705_100007298 3300005440 Bacteria 5438
10 Ga0070662_100327138 3300005457 Bacteria 1251
11 Ga0068867_100658718 3300005459 Bacteria 919
12 Ga0070706_100979716 3300005467 Bacteria 780
13 Ga0070707_100083551 3300005468 Unclassified 3085
14 Ga0070707_100992606 3300005468 Bacteria 805
15 Ga0070699_100000041 3300005518 Bacteria 128767
16 Ga0070684_100041462 3300005535 Bacteria 3969
17 Ga0070697_100123679 3300005536 Unclassified 2165
18 Ga0070704_100053842 3300005549 Bacteria 2845
19 Ga0068855_100492742 3300005563 Bacteria 1333
20 Ga0070664_100162785 3300005564 Bacteria 1975
21 Ga0068861_100063525 3300005719 Bacteria 2838
22 Ga0068851_10562278 3300005834 Bacteria 690
23 Ga0081455_10034524 3300005937 Bacteria 4530
24 Ga0081538_10007037 3300005981 Bacteria 9782
25 Ga0081538_10036562 3300005981 Bacteria 3202
26 Ga0081538_10042233 3300005981 Bacteria 2880
27 Ga0081539_10052027 3300005985 Bacteria 2304
28 Ga0075365_11072437 3300006038 Bacteria 567
29 Ga0075364_10760893 3300006051 Bacteria 661
30 Ga0075432_10093933 3300006058 Bacteria 1101
31 Ga0070712_100000041 3300006175 Bacteria 66654
32 Ga0070712_101177143 3300006175 Bacteria 667
33 Ga0075428_100029492 3300006844 Bacteria 6070
34 Ga0075431_100125251 3300006847 Bacteria 2651
35 Ga0075433_10606564 3300006852 Bacteria 961
36 Ga0075429_100087188 3300006880 Bacteria 2720
37 Ga0099794_10574736 3300007265 Bacteria 596
38 Ga0099794_10674282 3300007265 Unclassified 550
39 Ga0111539_10010212 3300009094 Bacteria 11832
40 Ga0111539_10325708 3300009094 Bacteria 1788
41 Ga0111539_10621224 3300009094 Bacteria 1258
42 Ga0111539_11351185 3300009094 Bacteria 827
43 Ga0111539_12223410 3300009094 Unclassified 636
44 Ga0105245_10044180 3300009098 Bacteria 3976
45 Ga0105245_10216008 3300009098 Bacteria 1848
46 Ga0114129_10139007 3300009147 Bacteria 3331
47 Ga0114129_11240678 3300009147 Bacteria 927
48 Ga0114129_11378203 3300009147 Bacteria 871
49 Ga0105243_10060923 3300009148 Bacteria 3016
50 Ga0105237_12546214 3300009545 Unclassified 522
51 Ga0105239_10002621 3300010375 Bacteria 22741
52 Ga0105239_10437708 3300010375 Bacteria 1482
53 Ga0157371_10455675 3300013102 Bacteria 941
54 Ga0157372_10023861 3300013307 Bacteria 6637
55 Ga0207647_10302770 3300025904 Bacteria 910
56 Ga0207705_11453677 3300025909 Unclassified 520
57 Ga0207684_10227384 3300025910 Bacteria 1610
58 Ga0207693_10000136 3300025915 Bacteria 66740
59 Ga0207693_10048778 3300025915 Unclassified 3325
60 Ga0207687_11025181 3300025927 Bacteria 708
61 Ga0207700_10000002 3300025928 Bacteria 775978
62 Ga0207690_10219434 3300025932 Bacteria 1454
63 Ga0207709_10127874 3300025935 Bacteria 1726
64 Ga0207669_10444749 3300025937 Bacteria 1026
65 Ga0207661_10023709 3300025944 Bacteria 4640
66 Ga0207661_10451158 3300025944 Bacteria 1171
67 Ga0207679_10229183 3300025945 Bacteria 1567
68 Ga0207667_11229349 3300025949 Bacteria 728
69 Ga0207667_11512353 3300025949 Bacteria 642
70 Ga0207648_10939984 3300026089 Bacteria 808
71 Ga0207698_10887845 3300026142 Bacteria 898
72 Ga0207428_10058406 3300027907 Bacteria 3061
73 Ga0207428_10284057 3300027907 Bacteria 1228
74 Ga0207428_10704040 3300027907 Unclassified 722
75 Ga0265338_10071003 3300028800 Bacteria 2982
76 Ga0265330_10119438 3300031235 Bacteria 1123
77 Ga0265325_10103443 3300031241 Bacteria 1391
78 Ga0265339_10121913 3300031249 Bacteria 1339
79 Ga0265313_10109298 3300031595 Bacteria 1217
80 Ga0265314_10171241 3300031711 Bacteria 1310
81 Ga0307407_10824945 3300031903 Bacteria 707
82 Ga0307416_100572017 3300032002 Bacteria 1206
83 Ga0307416_101210298 3300032002 Bacteria 861
84 Ga0307415_100872855 3300032126 Bacteria 827
85 Ga0395899_0794841 3300037312 Bacteria 585
86 Ga0395900_0004348 3300037418 Bacteria 15032
87 Ga0395900_0064059 3300037418 Bacteria 3779
88 Ga0395900_0200411 3300037418 Unclassified 2020
89 Ga0395900_0314977 3300037418 Bacteria 1547
90 Ga0395900_0715368 3300037418 Bacteria 934
91 Ga0395900_1249407 3300037418 Bacteria 657
92 Ga0395898_0010247 3300037466 Bacteria 9813
93 Ga0395898_0167923 3300037466 Bacteria 2098
94 Ga0395898_0227725 3300037466 Bacteria 1778
95 Ga0395898_0282693 3300037466 Unclassified 1583
96 Ga0395898_1148264 3300037466 Unclassified 709
97 Ga0395898_1310534 3300037466 Unclassified 653
98 Ga0395905_0023473 3300037471 Bacteria 5827
99 Ga0395905_0656068 3300037471 Bacteria 951
100 Ga0395905_0838875 3300037471 Bacteria 822
101 Ga0395905_1161860 3300037471 Bacteria 675
102 Ga0395901_0083992 3300038443 Bacteria 3328
103 Ga0395901_0124051 3300038443 Bacteria 2714
104 Ga0395901_0187819 3300038443 Bacteria 2167
105 Ga0395901_0489544 3300038443 Bacteria 1253
106 Ga0436365_1396151 3300039437 Unclassified 2550
107 Ga0439460_0023639 3300042461 Bacteria 1697
108 Ga0466961_0466157 3300044693 Unclassified 764
109 Ga0466961_0985719 3300044693 Unclassified 501
110 Ga0466957_0022354 3300044842 Bacteria 3732
111 Ga0466959_0218681 3300045049 Bacteria 1322
112 Ga0466958_0005970 3300045836 Bacteria 6591
113 Ga0496101_0909464 3300048904 Unclassified 693
114 Ga0496102_0348345 3300048905 Bacteria 1395
115 Ga0496106_0384725 3300048909 Bacteria 1127
116 Ga0496110_0032052 3300048913 Bacteria 4536
117 Ga0496111_0048220 3300048914 Bacteria 3068
118 Ga0496112_0000994 3300048915 Bacteria 20745
119 Ga0501031_0031756 3300049568 Bacteria 3444
120 Ga0501031_0104507 3300049568 Bacteria 1848
121 Ga0501031_0226667 3300049568 Bacteria 1216
122 Ga0501032_0014559 3300049569 Bacteria 5570
123 Ga0501033_0088609 3300049570 Bacteria 2264
124 Ga0501033_0262233 3300049570 Unclassified 1223
125 Ga0501034_0022431 3300049571 Bacteria 6434
126 Ga0501036_0058385 3300049572 Bacteria 3268
127 Ga0501036_0091105 3300049572 Bacteria 2576
128 Ga0501036_0163936 3300049572 Bacteria 1874
129 Ga0501036_0327329 3300049572 Bacteria 1280
130 Ga0501036_0372245 3300049572 Bacteria 1192
131 Ga0501036_0706014 3300049572 Bacteria 833
132 Ga0501037_0009177 3300049573 Bacteria 7249
133 Ga0501037_0630096 3300049573 Bacteria 718
134 Ga0501038_0019193 3300049574 Bacteria 6166
135 Ga0501038_0347588 3300049574 Unclassified 1155
136 Ga0501039_0025489 3300049575 Bacteria 4544
137 Ga0501039_0118085 3300049575 Bacteria 2077
138 Ga0501039_0336286 3300049575 Bacteria 1186
139 Ga0501039_0559374 3300049575 Bacteria 897
140 Ga0501039_0882760 3300049575 Bacteria 696
141 Ga0501040_0032377 3300049576 Unclassified 3538
142 Ga0501040_0033629 3300049576 Bacteria 3474
143 Ga0501040_0086577 3300049576 Bacteria 2175
144 Ga0501040_0244935 3300049576 Bacteria 1278
145 Ga0501040_0351594 3300049576 Bacteria 1056
146 Ga0501041_0062345 3300049577 Bacteria 2282
147 Ga0501041_0129965 3300049577 Bacteria 1569
148 Ga0501041_0138527 3300049577 Bacteria 1517
149 Ga0501041_0153460 3300049577 Bacteria 1438
150 Ga0501042_0069655 3300049578 Bacteria 2516
151 Ga0501042_0122588 3300049578 Bacteria 1872
152 Ga0501042_0180159 3300049578 Bacteria 1524
153 Ga0501042_0377972 3300049578 Unclassified 1025
154 Ga0501042_0487018 3300049578 Unclassified 895
155 Ga0501043_0035552 3300049579 Bacteria 3918
156 Ga0501043_0209957 3300049579 Unclassified 1509
157 Ga0501046_0039331 3300049580 Bacteria 3788
158 Ga0501046_0090899 3300049580 Bacteria 2348
159 Ga0501046_0112018 3300049580 Bacteria 2084
160 Ga0501046_1012325 3300049580 Bacteria 576
161 Ga0501046_1055548 3300049580 Bacteria 562
162 Ga0501048_0069910 3300049582 Bacteria 2480
163 Ga0501048_0108636 3300049582 Bacteria 1958
164 Ga0501048_0131140 3300049582 Bacteria 1772
165 Ga0501048_0138366 3300049582 Bacteria 1721
166 Ga0501048_0209588 3300049582 Bacteria 1382
167 Ga0501048_1070302 3300049582 Unclassified 580
168 Ga0501068_0036532 3300049584 Bacteria 2938
169 Ga0501068_0128503 3300049584 Bacteria 1583
170 Ga0501069_0017165 3300049585 Bacteria 3892
171 Ga0501070_0056367 3300049586 Bacteria 3257
172 Ga0501070_1163600 3300049586 Unclassified 593
173 Ga0501071_0014724 3300049587 Bacteria 5352
174 Ga0501071_0026318 3300049587 Bacteria 4083
175 Ga0501071_0040466 3300049587 Bacteria 3335
176 Ga0501071_0066442 3300049587 Bacteria 2620
177 Ga0501071_0127605 3300049587 Bacteria 1888
178 Ga0501071_0338472 3300049587 Bacteria 1144
179 Ga0501071_0361023 3300049587 Unclassified 1106
180 Ga0501072_0027956 3300049588 Bacteria 4402
181 Ga0501072_0030994 3300049588 Bacteria 4183
182 Ga0501072_0033549 3300049588 Bacteria 4022
183 Ga0501072_0113021 3300049588 Bacteria 2162
184 Ga0501072_0156287 3300049588 Bacteria 1818
185 Ga0501072_0678477 3300049588 Unclassified 810
186 Ga0501072_0918958 3300049588 Bacteria 683
187 Ga0501073_0038559 3300049589 Bacteria 3388
188 Ga0501074_0036409 3300049590 Bacteria 3564
189 Ga0501074_0067864 3300049590 Bacteria 2564
190 Ga0501074_0388236 3300049590 Bacteria 990
191 Ga0501074_0412954 3300049590 Bacteria 957
192 Ga0501074_0516417 3300049590 Bacteria 846
193 Ga0501074_1073758 3300049590 Bacteria 565
194 Ga0501075_0034030 3300049591 Bacteria 3793
195 Ga0501075_0048006 3300049591 Bacteria 3209
196 Ga0501075_0061072 3300049591 Bacteria 2839
197 Ga0501075_0343509 3300049591 Bacteria 1137
198 Ga0501075_0424426 3300049591 Bacteria 1014
199 Ga0501075_0659684 3300049591 Bacteria 797
200 Ga0501075_0734884 3300049591 Unclassified 751
201 Ga0501076_0029803 3300049592 Unclassified 4245
202 Ga0501076_0038435 3300049592 Bacteria 3757
203 Ga0501076_0120357 3300049592 Bacteria 2126
204 Ga0501076_0359716 3300049592 Bacteria 1196
205 Ga0501076_0450059 3300049592 Bacteria 1060
206 Ga0501076_0482846 3300049592 Bacteria 1021
207 Ga0501076_0547138 3300049592 Unclassified 954
208 Ga0501076_0923863 3300049592 Unclassified 719
209 Ga0501076_1795537 3300049592 Unclassified 503
210 Ga0501077_0058520 3300049593 Bacteria 2446
211 Ga0501077_0059677 3300049593 Bacteria 2421
212 Ga0501077_0136038 3300049593 Bacteria 1558
213 Ga0501079_0040087 3300049741 Bacteria 3613
214 Ga0501079_0043672 3300049741 Bacteria 3460
215 Ga0501079_0071535 3300049741 Bacteria 2680
216 Ga0501079_0158438 3300049741 Bacteria 1764
217 Ga0501079_0343720 3300049741 Bacteria 1169
218 Ga0501079_0726778 3300049741 Bacteria 781
219 Ga0501080_0106611 3300049742 Bacteria 2597
220 Ga0501080_0185914 3300049742 Bacteria 1910
221 Ga0501080_1616467 3300049742 Bacteria 548
222 Ga0501081_0035313 3300049743 Bacteria 3403
223 Ga0501081_0041475 3300049743 Bacteria 3152
224 Ga0501081_0044071 3300049743 Unclassified 3062
225 Ga0501081_0154064 3300049743 Bacteria 1652
226 Ga0501081_0186319 3300049743 Bacteria 1502
227 Ga0501081_0336355 3300049743 Unclassified 1111
228 Ga0501081_0386996 3300049743 Unclassified 1034
229 Ga0501081_0425567 3300049743 Unclassified 985
230 Ga0501083_0010387 3300049744 Bacteria 6555
231 Ga0501035_0057608 3300049822 Bacteria 3463
232 Ga0501035_0548386 3300049822 Bacteria 947
233 Ga0501044_0065406 3300049823 Bacteria 3708
234 Ga0501045_0029927 3300049824 Bacteria 3938
235 Ga0501045_0089223 3300049824 Bacteria 2277
236 Ga0501045_0280852 3300049824 Bacteria 1240
237 nmdc:mga0yw44_997426_c1 3300050492 Bacteria 567
238 nmdc:mga05p37_114523_c1 3300050507 Bacteria 3315
239 nmdc:mga05p37_417195_c1 3300050507 Bacteria 1563
240 nmdc:mga05p37_607367_c1 3300050507 Bacteria 1234
241 nmdc:mga09592_828_c1 3300050508 Bacteria 23962
242 nmdc:mga09592_93177_c1 3300050508 Bacteria 2576
243 nmdc:mga0qj67_1136_c1 3300050509 Bacteria 18432
244 nmdc:mga0qj67_139049_c1 3300050509 Bacteria 1969
245 nmdc:mga06r32_1035_c1 3300050510 Bacteria 25088
246 nmdc:mga06r32_160440_c1 3300050510 Bacteria 2231
247 nmdc:mga08y16_1310137_c1 3300050511 Unclassified 691
248 nmdc:mga08y16_1331964_c1 3300050511 Bacteria 684
249 nmdc:mga08y16_1787280_c1 3300050511 Bacteria 568
250 nmdc:mga08y16_24312_c1 3300050511 Bacteria 6395
251 nmdc:mga0n895_1826429_c1 3300050512 Bacteria 568
252 nmdc:mga0a205_465418_c1 3300050515 Bacteria 1123
253 nmdc:mga0a205_514699_c1 3300050515 Bacteria 1053
254 Ga0501084_0013993 3300054114 Bacteria 6641
255 Ga0501084_0042530 3300054114 Bacteria 3801
256 Ga0501084_0074441 3300054114 Bacteria 2843
257 Ga0501084_0162375 3300054114 Bacteria 1885
258 Ga0501082_0104004 3300060353 Bacteria 2456
259 Ga0501082_0128954 3300060353 Bacteria 2194
260 Ga0501082_0189607 3300060353 Bacteria 1789
261 Ga0530510_0022102 3300061734 Unclassified 4529
262 Ga0530510_0040031 3300061734 Bacteria 3382
263 Ga0530510_0051695 3300061734 Bacteria 2969
264 Ga0530510_0066400 3300061734 Bacteria 2615
265 Ga0530510_0248108 3300061734 Bacteria 1326
266 Ga0530510_0389248 3300061734 Unclassified 1050
267 Ga0530510_0404762 3300061734 Bacteria 1029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100741197 Ga0070660_1007411972 131
2 3300005440 Ga0070705_100007298 Ga0070705_1000072985 131
3 3300005457 Ga0070662_100327138 Ga0070662_1003271382 131
4 3300005459 Ga0068867_100658718 Ga0068867_1006587182 131
5 3300005468 Ga0070707_100083551 Ga0070707_1000835514 131
6 3300005468 Ga0070707_100992606 Ga0070707_1009926061 131
7 3300005518 Ga0070699_100000041 Ga0070699_1000000416 131
8 3300005536 Ga0070697_100123679 Ga0070697_1001236792 131
9 3300005549 Ga0070704_100053842 Ga0070704_1000538423 131
10 3300005719 Ga0068861_100063525 Ga0068861_1000635252 131
11 3300006175 Ga0070712_100000041 Ga0070712_10000004164 131
12 3300006175 Ga0070712_101177143 Ga0070712_1011771431 131
13 3300007265 Ga0099794_10574736 Ga0099794_105747361 131
14 3300007265 Ga0099794_10674282 Ga0099794_106742822 131
15 3300009098 Ga0105245_10216008 Ga0105245_102160083 131
16 3300009148 Ga0105243_10060923 Ga0105243_100609236 131
17 3300010375 Ga0105239_10437708 Ga0105239_104377083 131
18 3300025904 Ga0207647_10302770 Ga0207647_103027702 131
19 3300025910 Ga0207684_10227384 Ga0207684_102273842 131
20 3300025915 Ga0207693_10000136 Ga0207693_1000013620 131
21 3300025915 Ga0207693_10048778 Ga0207693_100487781 131
22 3300025927 Ga0207687_11025181 Ga0207687_110251812 131
23 3300025935 Ga0207709_10127874 Ga0207709_101278743 131
24 3300025944 Ga0207661_10023709 Ga0207661_100237093 131
25 3300025949 Ga0207667_11229349 Ga0207667_112293491 131
26 3300026089 Ga0207648_10939984 Ga0207648_109399841 131
27 3300032002 Ga0307416_101210298 Ga0307416_1012102982 131
28 3300032126 Ga0307415_100872855 Ga0307415_1008728552 131
29 3300037418 Ga0395900_0004348 Ga0395900_0004348_4004_4399 131
30 3300037418 Ga0395900_0715368 Ga0395900_0715368_32_427 131
31 3300037466 Ga0395898_0010247 Ga0395898_0010247_24_419 131
32 3300037471 Ga0395905_0023473 Ga0395905_0023473_5054_5449 131
33 3300042461 Ga0439460_0023639 Ga0439460_0023639_708_1103 131
34 3300048904 Ga0496101_0909464 Ga0496101_0909464_247_642 131
35 3300048909 Ga0496106_0384725 Ga0496106_0384725_710_1105 131
36 3300050507 nmdc:mga05p37_114523_c1 nmdc:mga05p37_114523_c1_1617_2012 131
37 3300050508 nmdc:mga09592_828_c1 nmdc:mga09592_828_c1_11631_12026 131
38 3300050509 nmdc:mga0qj67_1136_c1 nmdc:mga0qj67_1136_c1_3781_4176 131
39 3300050510 nmdc:mga06r32_1035_c1 nmdc:mga06r32_1035_c1_11938_12333 131
40 3300005327 Ga0070658_11516302 Ga0070658_115163021 132
41 3300005329 Ga0070683_100336176 Ga0070683_1003361762 132
42 3300005345 Ga0070692_10225458 Ga0070692_102254583 132
43 3300005356 Ga0070674_100714832 Ga0070674_1007148322 132
44 3300005366 Ga0070659_100056923 Ga0070659_1000569235 132
45 3300005467 Ga0070706_100979716 Ga0070706_1009797162 132
46 3300005535 Ga0070684_100041462 Ga0070684_1000414623 132
47 3300005563 Ga0068855_100492742 Ga0068855_1004927423 132
48 3300005564 Ga0070664_100162785 Ga0070664_1001627853 132
49 3300005834 Ga0068851_10562278 Ga0068851_105622782 132
50 3300005937 Ga0081455_10034524 Ga0081455_100345243 132
51 3300005985 Ga0081539_10052027 Ga0081539_100520273 132
52 3300006038 Ga0075365_11072437 Ga0075365_110724372 132
53 3300006051 Ga0075364_10760893 Ga0075364_107608932 132
54 3300006844 Ga0075428_100029492 Ga0075428_1000294923 132
55 3300006847 Ga0075431_100125251 Ga0075431_1001252512 132
56 3300006880 Ga0075429_100087188 Ga0075429_1000871883 132
57 3300009094 Ga0111539_10010212 Ga0111539_1001021215 132
58 3300009094 Ga0111539_10325708 Ga0111539_103257082 132
59 3300009094 Ga0111539_11351185 Ga0111539_113511852 132
60 3300009094 Ga0111539_12223410 Ga0111539_122234102 132
61 3300009098 Ga0105245_10044180 Ga0105245_100441803 132
62 3300009147 Ga0114129_10139007 Ga0114129_101390071 132
63 3300009147 Ga0114129_11240678 Ga0114129_112406782 132
64 3300009545 Ga0105237_12546214 Ga0105237_125462141 132
65 3300010375 Ga0105239_10002621 Ga0105239_1000262125 132
66 3300013102 Ga0157371_10455675 Ga0157371_104556752 132
67 3300013307 Ga0157372_10023861 Ga0157372_100238615 132
68 3300025909 Ga0207705_11453677 Ga0207705_114536772 132
69 3300025932 Ga0207690_10219434 Ga0207690_102194342 132
70 3300025937 Ga0207669_10444749 Ga0207669_104447491 132
71 3300025944 Ga0207661_10451158 Ga0207661_104511582 132
72 3300025945 Ga0207679_10229183 Ga0207679_102291833 132
73 3300025949 Ga0207667_11512353 Ga0207667_115123532 132
74 3300026142 Ga0207698_10887845 Ga0207698_108878451 132
75 3300027907 Ga0207428_10058406 Ga0207428_100584063 132
76 3300027907 Ga0207428_10284057 Ga0207428_102840573 132
77 3300028800 Ga0265338_10071003 Ga0265338_100710036 132
78 3300031235 Ga0265330_10119438 Ga0265330_101194383 132
79 3300031241 Ga0265325_10103443 Ga0265325_101034433 132
80 3300031249 Ga0265339_10121913 Ga0265339_101219132 132
81 3300031595 Ga0265313_10109298 Ga0265313_101092982 132
82 3300031711 Ga0265314_10171241 Ga0265314_101712413 132
83 3300037312 Ga0395899_0794841 Ga0395899_0794841_137_535 132
84 3300037418 Ga0395900_0064059 Ga0395900_0064059_1215_1613 132
85 3300037418 Ga0395900_0200411 Ga0395900_0200411_520_918 132
86 3300037418 Ga0395900_0314977 Ga0395900_0314977_1097_1495 132
87 3300037418 Ga0395900_1249407 Ga0395900_1249407_185_583 132
88 3300037466 Ga0395898_0167923 Ga0395898_0167923_1466_1864 132
89 3300037466 Ga0395898_0227725 Ga0395898_0227725_67_465 132
90 3300037466 Ga0395898_0282693 Ga0395898_0282693_774_1172 132
91 3300037466 Ga0395898_1148264 Ga0395898_1148264_243_641 132
92 3300037466 Ga0395898_1310534 Ga0395898_1310534_62_460 132
93 3300037471 Ga0395905_0656068 Ga0395905_0656068_192_590 132
94 3300037471 Ga0395905_1161860 Ga0395905_1161860_250_648 132
95 3300038443 Ga0395901_0083992 Ga0395901_0083992_759_1157 132
96 3300038443 Ga0395901_0124051 Ga0395901_0124051_1649_2047 132
97 3300038443 Ga0395901_0187819 Ga0395901_0187819_1742_2140 132
98 3300038443 Ga0395901_0489544 Ga0395901_0489544_443_841 132
99 3300044693 Ga0466961_0466157 Ga0466961_0466157_166_564 132
100 3300044693 Ga0466961_0985719 Ga0466961_0985719_59_457 132
101 3300044842 Ga0466957_0022354 Ga0466957_0022354_2773_3171 132
102 3300045049 Ga0466959_0218681 Ga0466959_0218681_855_1253 132
103 3300045836 Ga0466958_0005970 Ga0466958_0005970_2313_2711 132
104 3300048905 Ga0496102_0348345 Ga0496102_0348345_822_1220 132
105 3300048913 Ga0496110_0032052 Ga0496110_0032052_757_1155 132
106 3300048914 Ga0496111_0048220 Ga0496111_0048220_2400_2798 132
107 3300048915 Ga0496112_0000994 Ga0496112_0000994_6768_7166 132
108 3300049568 Ga0501031_0031756 Ga0501031_0031756_1718_2116 132
109 3300049568 Ga0501031_0104507 Ga0501031_0104507_140_538 132
110 3300049569 Ga0501032_0014559 Ga0501032_0014559_3651_4049 132
111 3300049570 Ga0501033_0088609 Ga0501033_0088609_699_1097 132
112 3300049571 Ga0501034_0022431 Ga0501034_0022431_4883_5281 132
113 3300049572 Ga0501036_0058385 Ga0501036_0058385_809_1207 132
114 3300049572 Ga0501036_0327329 Ga0501036_0327329_164_562 132
115 3300049572 Ga0501036_0372245 Ga0501036_0372245_763_1161 132
116 3300049573 Ga0501037_0009177 Ga0501037_0009177_4683_5081 132
117 3300049574 Ga0501038_0019193 Ga0501038_0019193_885_1283 132
118 3300049575 Ga0501039_0025489 Ga0501039_0025489_2989_3387 132
119 3300049575 Ga0501039_0336286 Ga0501039_0336286_526_924 132
120 3300049575 Ga0501039_0882760 Ga0501039_0882760_132_530 132
121 3300049576 Ga0501040_0086577 Ga0501040_0086577_1519_1917 132
122 3300049576 Ga0501040_0244935 Ga0501040_0244935_332_730 132
123 3300049576 Ga0501040_0351594 Ga0501040_0351594_241_639 132
124 3300049577 Ga0501041_0138527 Ga0501041_0138527_180_578 132
125 3300049577 Ga0501041_0153460 Ga0501041_0153460_728_1126 132
126 3300049578 Ga0501042_0069655 Ga0501042_0069655_1740_2138 132
127 3300049578 Ga0501042_0122588 Ga0501042_0122588_148_546 132
128 3300049578 Ga0501042_0180159 Ga0501042_0180159_601_999 132
129 3300049579 Ga0501043_0035552 Ga0501043_0035552_1563_1961 132
130 3300049580 Ga0501046_0039331 Ga0501046_0039331_1433_1831 132
131 3300049580 Ga0501046_0112018 Ga0501046_0112018_544_942 132
132 3300049582 Ga0501048_0069910 Ga0501048_0069910_354_752 132
133 3300049582 Ga0501048_0138366 Ga0501048_0138366_1068_1466 132
134 3300049582 Ga0501048_0209588 Ga0501048_0209588_80_478 132
135 3300049582 Ga0501048_1070302 Ga0501048_1070302_89_487 132
136 3300049584 Ga0501068_0128503 Ga0501068_0128503_655_1053 132
137 3300049585 Ga0501069_0017165 Ga0501069_0017165_1024_1422 132
138 3300049586 Ga0501070_0056367 Ga0501070_0056367_311_709 132
139 3300049587 Ga0501071_0014724 Ga0501071_0014724_2613_3011 132
140 3300049587 Ga0501071_0066442 Ga0501071_0066442_1511_1909 132
141 3300049587 Ga0501071_0127605 Ga0501071_0127605_381_779 132
142 3300049588 Ga0501072_0030994 Ga0501072_0030994_1322_1720 132
143 3300049588 Ga0501072_0113021 Ga0501072_0113021_66_464 132
144 3300049588 Ga0501072_0156287 Ga0501072_0156287_751_1149 132
145 3300049588 Ga0501072_0678477 Ga0501072_0678477_144_542 132
146 3300049589 Ga0501073_0038559 Ga0501073_0038559_2057_2455 132
147 3300049590 Ga0501074_0036409 Ga0501074_0036409_1807_2205 132
148 3300049590 Ga0501074_0412954 Ga0501074_0412954_539_937 132
149 3300049590 Ga0501074_0516417 Ga0501074_0516417_367_765 132
150 3300049590 Ga0501074_1073758 Ga0501074_1073758_105_503 132
151 3300049591 Ga0501075_0061072 Ga0501075_0061072_1508_1906 132
152 3300049591 Ga0501075_0343509 Ga0501075_0343509_664_1062 132
153 3300049591 Ga0501075_0424426 Ga0501075_0424426_156_554 132
154 3300049591 Ga0501075_0659684 Ga0501075_0659684_329_727 132
155 3300049592 Ga0501076_0029803 Ga0501076_0029803_1523_1921 132
156 3300049592 Ga0501076_0120357 Ga0501076_0120357_1319_1717 132
157 3300049592 Ga0501076_0359716 Ga0501076_0359716_592_990 132
158 3300049592 Ga0501076_0450059 Ga0501076_0450059_343_741 132
159 3300049592 Ga0501076_1795537 Ga0501076_1795537_66_464 132
160 3300049593 Ga0501077_0059677 Ga0501077_0059677_939_1337 132
161 3300049593 Ga0501077_0136038 Ga0501077_0136038_654_1052 132
162 3300049741 Ga0501079_0071535 Ga0501079_0071535_2130_2528 132
163 3300049741 Ga0501079_0158438 Ga0501079_0158438_713_1111 132
164 3300049741 Ga0501079_0726778 Ga0501079_0726778_154_552 132
165 3300049742 Ga0501080_0106611 Ga0501080_0106611_1089_1487 132
166 3300049742 Ga0501080_0185914 Ga0501080_0185914_987_1385 132
167 3300049742 Ga0501080_1616467 Ga0501080_1616467_93_491 132
168 3300049743 Ga0501081_0154064 Ga0501081_0154064_654_1052 132
169 3300049743 Ga0501081_0386996 Ga0501081_0386996_387_785 132
170 3300049743 Ga0501081_0425567 Ga0501081_0425567_133_531 132
171 3300049744 Ga0501083_0010387 Ga0501083_0010387_692_1090 132
172 3300049822 Ga0501035_0057608 Ga0501035_0057608_1636_2034 132
173 3300049822 Ga0501035_0548386 Ga0501035_0548386_254_652 132
174 3300049823 Ga0501044_0065406 Ga0501044_0065406_2486_2884 132
175 3300049824 Ga0501045_0029927 Ga0501045_0029927_2783_3181 132
176 3300049824 Ga0501045_0089223 Ga0501045_0089223_676_1074 132
177 3300050492 nmdc:mga0yw44_997426_c1 nmdc:mga0yw44_997426_c1_72_470 132
178 3300050507 nmdc:mga05p37_417195_c1 nmdc:mga05p37_417195_c1_122_520 132
179 3300050507 nmdc:mga05p37_607367_c1 nmdc:mga05p37_607367_c1_209_607 132
180 3300050508 nmdc:mga09592_93177_c1 nmdc:mga09592_93177_c1_1007_1405 132
181 3300050509 nmdc:mga0qj67_139049_c1 nmdc:mga0qj67_139049_c1_681_1079 132
182 3300050510 nmdc:mga06r32_160440_c1 nmdc:mga06r32_160440_c1_287_685 132
183 3300050511 nmdc:mga08y16_1331964_c1 nmdc:mga08y16_1331964_c1_81_479 132
184 3300050511 nmdc:mga08y16_24312_c1 nmdc:mga08y16_24312_c1_5299_5697 132
185 3300050515 nmdc:mga0a205_465418_c1 nmdc:mga0a205_465418_c1_683_1081 132
186 3300054114 Ga0501084_0042530 Ga0501084_0042530_3276_3674 132
187 3300054114 Ga0501084_0074441 Ga0501084_0074441_1920_2318 132
188 3300060353 Ga0501082_0104004 Ga0501082_0104004_1533_1931 132
189 3300060353 Ga0501082_0189607 Ga0501082_0189607_1137_1535 132
190 3300061734 Ga0530510_0040031 Ga0530510_0040031_941_1339 132
191 3300061734 Ga0530510_0051695 Ga0530510_0051695_2145_2543 132
192 3300061734 Ga0530510_0248108 Ga0530510_0248108_553_951 132
193 3300061734 Ga0530510_0404762 Ga0530510_0404762_557_955 132
194 3300006058 Ga0075432_10093933 Ga0075432_100939332 133
195 3300006852 Ga0075433_10606564 Ga0075433_106065641 133
196 3300009094 Ga0111539_10621224 Ga0111539_106212241 133
197 3300009147 Ga0114129_11378203 Ga0114129_113782032 133
198 3300027907 Ga0207428_10704040 Ga0207428_107040401 133
199 3300031903 Ga0307407_10824945 Ga0307407_108249451 133
200 3300032002 Ga0307416_100572017 Ga0307416_1005720173 133
201 3300037471 Ga0395905_0838875 Ga0395905_0838875_18_419 133
202 3300049568 Ga0501031_0226667 Ga0501031_0226667_206_607 133
203 3300049570 Ga0501033_0262233 Ga0501033_0262233_570_971 133
204 3300049572 Ga0501036_0091105 Ga0501036_0091105_1478_1879 133
205 3300049572 Ga0501036_0163936 Ga0501036_0163936_709_1110 133
206 3300049572 Ga0501036_0706014 Ga0501036_0706014_334_735 133
207 3300049573 Ga0501037_0630096 Ga0501037_0630096_200_601 133
208 3300049574 Ga0501038_0347588 Ga0501038_0347588_315_716 133
209 3300049575 Ga0501039_0118085 Ga0501039_0118085_1129_1530 133
210 3300049576 Ga0501040_0033629 Ga0501040_0033629_1686_2087 133
211 3300049577 Ga0501041_0062345 Ga0501041_0062345_1252_1653 133
212 3300049578 Ga0501042_0377972 Ga0501042_0377972_327_728 133
213 3300049578 Ga0501042_0487018 Ga0501042_0487018_420_821 133
214 3300049579 Ga0501043_0209957 Ga0501043_0209957_712_1113 133
215 3300049580 Ga0501046_0090899 Ga0501046_0090899_327_728 133
216 3300049580 Ga0501046_1012325 Ga0501046_1012325_30_431 133
217 3300049582 Ga0501048_0108636 Ga0501048_0108636_1118_1519 133
218 3300049582 Ga0501048_0131140 Ga0501048_0131140_418_819 133
219 3300049584 Ga0501068_0036532 Ga0501068_0036532_1414_1815 133
220 3300049587 Ga0501071_0040466 Ga0501071_0040466_1931_2332 133
221 3300049588 Ga0501072_0033549 Ga0501072_0033549_2793_3194 133
222 3300049588 Ga0501072_0918958 Ga0501072_0918958_44_445 133
223 3300049590 Ga0501074_0067864 Ga0501074_0067864_619_1020 133
224 3300049591 Ga0501075_0048006 Ga0501075_0048006_1131_1532 133
225 3300049591 Ga0501075_0734884 Ga0501075_0734884_313_714 133
226 3300049592 Ga0501076_0038435 Ga0501076_0038435_827_1228 133
227 3300049592 Ga0501076_0547138 Ga0501076_0547138_315_716 133
228 3300049593 Ga0501077_0058520 Ga0501077_0058520_319_720 133
229 3300049741 Ga0501079_0043672 Ga0501079_0043672_1639_2040 133
230 3300049743 Ga0501081_0035313 Ga0501081_0035313_1296_1697 133
231 3300049743 Ga0501081_0186319 Ga0501081_0186319_33_434 133
232 3300050511 nmdc:mga08y16_1310137_c1 nmdc:mga08y16_1310137_c1_40_441 133
233 3300050511 nmdc:mga08y16_1787280_c1 nmdc:mga08y16_1787280_c1_139_540 133
234 3300050512 nmdc:mga0n895_1826429_c1 nmdc:mga0n895_1826429_c1_11_412 133
235 3300050515 nmdc:mga0a205_514699_c1 nmdc:mga0a205_514699_c1_51_452 133
236 3300054114 Ga0501084_0013993 Ga0501084_0013993_4093_4494 133
237 3300060353 Ga0501082_0128954 Ga0501082_0128954_1083_1484 133
238 3300061734 Ga0530510_0066400 Ga0530510_0066400_936_1337 133
239 3300061734 Ga0530510_0389248 Ga0530510_0389248_432_833 133
240 3300005981 Ga0081538_10036562 Ga0081538_100365622 134
241 3300005981 Ga0081538_10042233 Ga0081538_100422334 134
242 3300039437 Ga0436365_1396151 Ga0436365_1396151_150_554 134
243 3300049592 Ga0501076_0923863 Ga0501076_0923863_91_495 134
244 3300049741 Ga0501079_0040087 Ga0501079_0040087_14_418 134
245 3300049743 Ga0501081_0041475 Ga0501081_0041475_419_823 134
246 3300005436 Ga0070713_100005562 Ga0070713_1000055623 135
247 3300025928 Ga0207700_10000002 Ga0207700_10000002526 135
248 3300049575 Ga0501039_0559374 Ga0501039_0559374_317_724 135
249 3300049576 Ga0501040_0032377 Ga0501040_0032377_1441_1848 135
250 3300049577 Ga0501041_0129965 Ga0501041_0129965_321_728 135
251 3300049580 Ga0501046_1055548 Ga0501046_1055548_70_477 135
252 3300049586 Ga0501070_1163600 Ga0501070_1163600_77_484 135
253 3300049587 Ga0501071_0026318 Ga0501071_0026318_3665_4072 135
254 3300049587 Ga0501071_0338472 Ga0501071_0338472_283_768 135
255 3300049587 Ga0501071_0361023 Ga0501071_0361023_177_593 135
256 3300049588 Ga0501072_0027956 Ga0501072_0027956_1684_2091 135
257 3300049590 Ga0501074_0388236 Ga0501074_0388236_356_763 135
258 3300049591 Ga0501075_0034030 Ga0501075_0034030_2546_2953 135
259 3300049592 Ga0501076_0482846 Ga0501076_0482846_17_433 135
260 3300049741 Ga0501079_0343720 Ga0501079_0343720_27_434 135
261 3300049743 Ga0501081_0044071 Ga0501081_0044071_830_1237 135
262 3300049743 Ga0501081_0336355 Ga0501081_0336355_286_702 135
263 3300049824 Ga0501045_0280852 Ga0501045_0280852_269_676 135
264 3300054114 Ga0501084_0162375 Ga0501084_0162375_942_1349 135
265 3300061734 Ga0530510_0022102 Ga0530510_0022102_2313_2720 135
266 3300003373 JGI25407J50210_10046870 JGI25407J50210_100468701 136
267 3300005981 Ga0081538_10007037 Ga0081538_100070379 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

28

154

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.9641 1 132
5wzf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.9632 1 132
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.9569 1 132
5wzf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.956 1 132
1w8i-assembly1.cif.gz_A-2 the structure of gene product af1683 from archaeoglobus fulgidus. 0.8529 2 123
ID Description Score Start End Superfamily
af_P95004_1_128_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9745 1 130 3.40.50.1010
af_P95004_1_128_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9671 1 130 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8568 2 133 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8506 2 133 3.40.50.1010
1w8iA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8466 1 123 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7V9IF21-F1-model_v4 PIN domain-containing protein 0.9972 1 101 GO:0004521
GO:0016075
AF-A0A6B1IED6-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Putative toxin VapC) 0.9899 2 132 GO:0000287
GO:0004521
GO:0016075
GO:0090729
AF-A0A536JRJ0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9878 2 132 GO:0000287
GO:0004521
GO:0016075
GO:0090729
AF-A0A831NYE7-F1-model_v4 PIN domain-containing protein 0.9839 2 129 GO:0004521
GO:0016075
AF-A0A538JSF0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9822 1 136 GO:0000287
GO:0004521
GO:0016075
GO:0090729

Feature Viewer

pLDDT pTM Quality
95.12 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map