F375060

General Info

Members Datasets Scaffolds Average Seq Length
267 219 534 252

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000561|Ga0496125_0000561_16225_17067
Length 280
Sequence MTLSRKARPASPNNIPYSKKEIPMIKMITAALLSAAALSMTDSANAAEKPAIVLVHGAFAEASSWNGVIKKLEADGYSVTAVANPLRGVKSDGDYVRHLVASFKTPVVLVGHSYGGSVISEAADPSKVKSMVFVSAFAPDTGESAIDLSGKFPGSTLGGTLAAPVALNDGGEDLYIQQDKFPSQFAADVPEASAKLMAATQRPVTSAALGEKSENAAWKNIPSWFIYGDADKNIPPKAIAWMAERAKSKDTVVVKGASHVVMVTHPDKVAKIIEEAATAN

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
66 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
67 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
76 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
77 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
78 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
79 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
80 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
81 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
82 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
83 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
84 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
148 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
149 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
150 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
151 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
152 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
153 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
154 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
155 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
156 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
157 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
158 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
159 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
160 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
161 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
162 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
163 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
164 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
165 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
166 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
167 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
168 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
169 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
170 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
171 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
172 2643221719 Rhizobium sp. Root274 Isolate Unclassified
173 2718217927 Rhizobium sp. N324 Isolate Nodule
174 2718218423 Rhizobium sp. N941 Isolate Nodule
175 2721755809 Rhizobium sp. N541 Isolate Nodule
176 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
177 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
178 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
179 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
180 2808606394 Promicromonospora sp. C35 Isolate Unclassified
181 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
182 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
183 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
184 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
185 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
186 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
187 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
188 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
189 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
190 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
191 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
192 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
193 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
194 2858882152 Micromonospora noduli MED15 Isolate Nodule
195 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
196 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
197 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
198 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
199 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
200 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
201 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
202 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
203 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
204 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
205 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
206 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
207 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
208 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
209 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
210 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
211 8005275841 Rhizobium sp. N4311 Isolate Nodule
212 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
213 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
214 8018176218 Rhizobium sp. N122 Isolate Nodule
215 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
216 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
217 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
218 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
219 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.66
Metatranscriptomes 0
Isolates 27.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.47
Nodule 15.36
Rhizoplane 2.62
Rhizosphere 35.58
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0000561 3300048928 Bacteria 64016
2 JGI25162J39368_1001452 3300002737 Bacteria 12573
3 JGI25158J39367_1000016 3300002739 Bacteria 45462
4 JGI25152J39213_1002675 3300002773 Bacteria 6566
5 JGI25151J46595_10038147 3300003187 Bacteria 1792
6 JGI25153J46596_10001696 3300003215 Bacteria 13070
7 rootH1_10077392 3300003316 Bacteria 9316
8 rootH2_10258226 3300003320 Bacteria 1662
9 rootH1_10080598 3300003323 Bacteria 2853
10 rootH1_10382163 3300003323 Bacteria 2075
11 JGI25160J50197_1016478 3300003354 Bacteria 2381
12 JGI25161J50226_1000096 3300003374 Bacteria 72203
13 Ga0055533_1001064 3300003756 Bacteria 7893
14 Ga0055535_1001186 3300003761 Bacteria 15039
15 Ga0055542_1000122 3300003762 Bacteria 101751
16 Ga0055526_1000231 3300003771 Bacteria 46760
17 Ga0055526_1006942 3300003771 Bacteria 6017
18 Ga0055526_1007540 3300003771 Bacteria 5628
19 Ga0055526_1008722 3300003771 Bacteria 5002
20 Ga0055526_1016182 3300003771 Bacteria 2938
21 Ga0055524_1001719 3300003775 Bacteria 12161
22 Ga0055524_1002133 3300003775 Bacteria 10409
23 Ga0055536_1052346 3300003781 Bacteria 890
24 Ga0055528_1001910 3300003790 Bacteria 11824
25 Ga0055528_1006171 3300003790 Bacteria 5468
26 Ga0055540_1009346 3300003792 Bacteria 3398
27 Ga0055543_1000183 3300004625 Bacteria 51527
28 Ga0065165_1007774 3300005262 Bacteria 5177
29 Ga0068869_100542137 3300005334 Bacteria 976
30 Ga0070682_100049885 3300005337 Bacteria 2611
31 Ga0070668_100003833 3300005347 Bacteria 11108
32 Ga0070669_100202337 3300005353 Bacteria 1563
33 Ga0070659_100583948 3300005366 Bacteria 959
34 Ga0070714_100455224 3300005435 Bacteria 1216
35 Ga0070663_100094753 3300005455 Unclassified 2217
36 Ga0070685_10002640 3300005466 Bacteria 9181
37 Ga0070665_100446317 3300005548 Bacteria 1303
38 Ga0068862_100011415 3300005844 Bacteria 7333
39 Ga0081455_10031747 3300005937 Bacteria 4771
40 Ga0075363_100059111 3300006048 Bacteria 2061
41 Ga0079104_1000787 3300006946 Bacteria 26944
42 Ga0105240_10005157 3300009093 Bacteria 19537
43 Ga0105247_10433157 3300009101 Bacteria 944
44 Ga0105237_10000038 3300009545 Bacteria 190707
45 Ga0105237_10021627 3300009545 Bacteria 6612
46 Ga0105238_10105592 3300009551 Bacteria 2798
47 Ga0105239_10000108 3300010375 Bacteria 116364
48 Ga0157370_10099595 3300013104 Bacteria 2724
49 Ga0157372_10210429 3300013307 Bacteria 2254
50 Ga0157375_10472608 3300013308 Bacteria 1419
51 Ga0163163_10493240 3300014325 Bacteria 1286
52 Ga0163161_10501617 3300017792 Bacteria 988
53 Ga0209436_100004 3300025208 Bacteria 196698
54 Ga0209672_100608 3300025228 Bacteria 18671
55 Ga0209258_100187 3300025242 Bacteria 130826
56 Ga0209148_1000172 3300025254 Bacteria 131021
57 Ga0209129_1004134 3300025258 Bacteria 5882
58 Ga0209129_1012449 3300025258 Bacteria 1950
59 Ga0209455_1001130 3300025272 Bacteria 12967
60 Ga0209673_1000416 3300025273 Bacteria 74754
61 Ga0209673_1005781 3300025273 Bacteria 6152
62 Ga0209130_1000001 3300025284 Bacteria 831557
63 Ga0209025_1002295 3300025294 Bacteria 20770
64 Ga0209564_1000023 3300025295 Bacteria 555102
65 Ga0209564_1002866 3300025295 Bacteria 12657
66 Ga0209564_1007027 3300025295 Bacteria 5903
67 Ga0209564_1008079 3300025295 Bacteria 5269
68 Ga0209758_1003136 3300025297 Bacteria 15573
69 Ga0209758_1019564 3300025297 Bacteria 3258
70 Ga0209256_1002356 3300025299 Bacteria 15702
71 Ga0209256_1007353 3300025299 Bacteria 5470
72 Ga0209256_1008456 3300025299 Bacteria 4769
73 Ga0209256_1015379 3300025299 Bacteria 2682
74 Ga0207426_1000005 3300025302 Bacteria 1037188
75 Ga0209051_1045902 3300025303 Bacteria 1507
76 Ga0209257_1039426 3300025304 Bacteria 1420
77 Ga0207695_10000007 3300025913 Bacteria 1092551
78 Ga0207671_10000045 3300025914 Bacteria 201245
79 Ga0207671_10027525 3300025914 Bacteria 4250
80 Ga0207691_10232764 3300025940 Bacteria 1595
81 Ga0207668_10004702 3300025972 Bacteria 8033
82 Ga0207678_10180099 3300026067 Bacteria 1805
83 Ga0209281_1001398 3300027111 Bacteria 14624
84 Ga0314311_1015226 3300030733 Bacteria 1883
85 Ga0316179_1019039 3300030734 Bacteria 1872
86 Ga0307408_100000789 3300031548 Bacteria 25414
87 Ga0307406_10000626 3300031901 Bacteria 20172
88 Ga0307412_10086654 3300031911 Bacteria 2180
89 Ga0395899_0133792 3300037312 Bacteria 1768
90 Ga0395898_0000298 3300037466 Bacteria 119141
91 Ga0395901_0001766 3300038443 Bacteria 22309
92 Ga0439465_0009727 3300041413 Bacteria 3029
93 Ga0451833_0179819 3300041491 Bacteria 3617
94 Ga0451835_0183075 3300041492 Bacteria 5427
95 Ga0451837_1812141 3300041494 Bacteria 1854
96 Ga0451839_0021533 3300041496 Bacteria 1165
97 Ga0451839_0246518 3300041496 Bacteria 1210
98 Ga0451841_0374909 3300041498 Bacteria 2369
99 Ga0451841_0489574 3300041498 Bacteria 5223
100 Ga0451847_0803056 3300041503 Bacteria 5320
101 Ga0451849_0223906 3300041505 Bacteria 4156
102 Ga0451851_0054054 3300041507 Bacteria 3284
103 Ga0451843_0112200 3300041509 Bacteria 7535
104 Ga0451843_0713499 3300041509 Bacteria 1345
105 Ga0451855_1133051 3300041511 Bacteria 2050
106 Ga0451853_0232983 3300041512 Bacteria 1955
107 Ga0451853_0752666 3300041512 Bacteria 2209
108 Ga0451853_2370101 3300041512 Bacteria 27402
109 Ga0439431_0042998 3300041997 Bacteria 1155
110 Ga0466965_0147218 3300044683 Bacteria 1229
111 Ga0466966_0002494 3300044684 Bacteria 12059
112 Ga0466966_0295570 3300044684 Bacteria 973
113 Ga0466961_0114358 3300044693 Bacteria 1696
114 Ga0466961_0157307 3300044693 Bacteria 1417
115 Ga0466963_0243559 3300044694 Bacteria 1261
116 Ga0466963_0518774 3300044694 Bacteria 841
117 Ga0466958_0022578 3300045836 Bacteria 3688
118 Ga0466967_0207385 3300045976 Bacteria 1858
119 Ga0466967_0362662 3300045976 Bacteria 1404
120 Ga0495627_031967 3300046453 Bacteria 1659
121 Ga0495638_0000048 3300046460 Bacteria 209787
122 Ga0495651_0005061 3300046462 Bacteria 10062
123 Ga0495605_0145513 3300046474 Bacteria 1060
124 Ga0495585_0024749 3300046492 Bacteria 3441
125 Ga0495607_0018085 3300046501 Bacteria 4503
126 Ga0495583_0051833 3300046506 Bacteria 1869
127 Ga0495583_0133580 3300046506 Bacteria 1037
128 Ga0495606_0227847 3300046507 Bacteria 1046
129 Ga0495610_0035425 3300046512 Bacteria 2562
130 Ga0495628_0148258 3300046516 Bacteria 1788
131 Ga0495631_0136335 3300046518 Bacteria 1054
132 Ga0495632_0001116 3300046519 Bacteria 23033
133 Ga0495637_0108173 3300046520 Bacteria 1080
134 Ga0495643_0024607 3300046522 Bacteria 3413
135 Ga0495648_0008900 3300046524 Bacteria 7845
136 Ga0495652_0004009 3300046529 Bacteria 14249
137 Ga0495654_0092144 3300046530 Bacteria 1405
138 Ga0495609_0103245 3300046538 Bacteria 1234
139 Ga0495597_0006075 3300046542 Bacteria 6287
140 Ga0495597_0047216 3300046542 Bacteria 1906
141 Ga0495645_0103282 3300046543 Bacteria 2025
142 Ga0495633_0070706 3300046558 Bacteria 1628
143 Ga0495656_0065224 3300046615 Bacteria 1601
144 Ga0495611_0028650 3300046648 Bacteria 2440
145 Ga0495625_0342660 3300046660 Bacteria 947
146 Ga0495670_0041838 3300046691 Bacteria 2287
147 Ga0495649_0013811 3300046694 Bacteria 4648
148 Ga0495660_0163136 3300046810 Bacteria 1091
149 Ga0495681_0119921 3300047470 Bacteria 1130
150 Ga0495686_0009558 3300047472 Bacteria 6972
151 Ga0495615_0010678 3300048090 Bacteria 1844
152 Ga0496100_0013057 3300048903 Bacteria 4780
153 Ga0496101_0074867 3300048904 Bacteria 2491
154 Ga0496102_0056365 3300048905 Bacteria 3584
155 Ga0496103_0030766 3300048906 Bacteria 3268
156 Ga0496106_0000075 3300048909 Bacteria 79842
157 Ga0496106_0432610 3300048909 Bacteria 1057
158 Ga0496113_0135179 3300048916 Bacteria 1937
159 Ga0496116_0001693 3300048919 Bacteria 24141
160 Ga0496116_0004036 3300048919 Bacteria 14208
161 Ga0496116_0005490 3300048919 Bacteria 11739
162 Ga0496116_0054944 3300048919 Bacteria 2619
163 Ga0496117_0011298 3300048920 Bacteria 8007
164 Ga0496118_0012800 3300048921 Bacteria 8007
165 Ga0496118_0018447 3300048921 Bacteria 6296
166 Ga0496119_0005043 3300048922 Bacteria 12833
167 Ga0496120_0003406 3300048923 Bacteria 14541
168 Ga0496121_0001176 3300048924 Bacteria 45820
169 Ga0496121_0013698 3300048924 Bacteria 8693
170 Ga0496121_0015757 3300048924 Bacteria 7875
171 Ga0496122_0010004 3300048925 Bacteria 9871
172 Ga0496122_0029923 3300048925 Bacteria 4576
173 Ga0496122_0163192 3300048925 Bacteria 1355
174 Ga0496123_0006306 3300048926 Bacteria 11533
175 Ga0496123_0030572 3300048926 Bacteria 3940
176 Ga0496124_0009231 3300048927 Bacteria 10172
177 Ga0496124_0013784 3300048927 Bacteria 7866
178 Ga0496124_0060940 3300048927 Unclassified 3164
179 Ga0496125_0011350 3300048928 Bacteria 8919
180 Ga0496126_0005432 3300048929 Bacteria 14531
181 nmdc:mga03n38_174408_c1 3300050490 Bacteria 1097
182 Ga0500562_003666 3300053108 Bacteria 3859
183 Ga0500594_0011397 3300053118 Bacteria 2075
184 Ga0500658_0000894 3300053134 Bacteria 12218
185 Ga0500658_0006012 3300053134 Bacteria 4510
186 Ga0500658_0006199 3300053134 Bacteria 4448
187 Ga0500658_0057125 3300053134 Bacteria 1612
188 Ga0500568_0000265 3300053139 Bacteria 44344
189 Ga0500604_0030661 3300053151 Bacteria 1574
190 Ga0500616_0000011 3300053153 Bacteria 732880
191 Ga0500616_0197112 3300053153 Bacteria 895
192 Ga0500622_0000099 3300053156 Bacteria 86951
193 Ga0466962_0037986 3300061719 Bacteria 2306
194 Ga0466962_0325014 3300061719 Bacteria 763
195 2510892691 2510461076 Bacteria 8618824
196 2511199785 2510917030 Bacteria 7460662
197 2513579788 2513237085 Bacteria 7695351
198 2513869829 2513237138 Bacteria 7368160
199 2514018439 2513237162 Bacteria 7468464
200 2515632631 2515154113 Bacteria 7807172
201 2515640424 2515154114 Bacteria 7848616
202 2515656518 2515154116 Bacteria 7552979
203 2515738268 2515154134 Bacteria 7220242
204 2517080312 2516653085 Bacteria 7346596
205 2517098911 2517093000 Bacteria 7412387
206 2517407873 2517287029 Bacteria 6905599
207 2517409819 2517287029 Bacteria 6905599
208 2530648959 2529292951 Bacteria 6916614
209 2585200842 2582581294 Bacteria 6626667
210 2585221517 2582581298 Bacteria 7315509
211 2585283199 2582581308 Bacteria 7413247
212 2585404399 2582581867 Bacteria 7184437
213 2585526639 2585427526 Bacteria 7258840
214 2585544313 2585427529 Bacteria 7395659
215 2585824717 2585427590 Bacteria 6824633
216 2587916467 2585428106 Bacteria 5179711
217 2616313078 2615840626 Bacteria 7921970
218 2644202932 2643221636 Bacteria 6583769
219 2644300836 2643221653 Bacteria 4569637
220 2644659058 2643221719 Bacteria 4568197
221 2719389368 2718217927 Bacteria 6972593
222 2721402134 2718218423 Bacteria 6438183
223 2724035967 2721755809 Bacteria 6438790
224 2739325650 2738543027 Bacteria 6409078
225 2739605285 2739367654 Bacteria 6049412
226 2760623621 2758568621 Bacteria 5967089
227 2772642030 2772190715 Bacteria 6959372
228 2809028514 2808606394 Bacteria 6248540
229 2819687870 2818991461 Bacteria 7026071
230 2838690673 2838686498 Bacteria 7807632
231 2841855594 2841851746 Bacteria 7532261
232 2842160700 2842156927 Bacteria 6894975
233 2842164217 2842163707 Bacteria 6916235
234 2842184316 2842180545 Bacteria 6888678
235 2842231899 2842229732 Bacteria 7475766
236 2842275013 2842271015 Bacteria 7807131
237 2842307551 2842304105 Bacteria 7023636
238 2855676102 2855670206 Bacteria 7120389
239 2855682583 2855676851 Bacteria 7063653
240 2857294168 2857288857 Bacteria 7189066
241 2858851678 2858848962 Bacteria 6963058
242 2858882830 2858882152 Bacteria 7230291
243 2858895001 2858888857 Bacteria 7060307
244 2858900010 2858895516 Bacteria 7378898
245 2869052757 2869048445 Bacteria 6875584
246 2869068737 2869068681 Bacteria 7205615
247 2880490510 2880489317 Bacteria 7096270
248 2880502003 2880495981 Bacteria 7340502
249 2885306688 2885305155 Bacteria 7348390
250 2885328393 2885326080 Bacteria 7134805
251 2885334800 2885334103 Bacteria 7216818
252 2919103569 2919100787 Bacteria 7710546
253 2923559889 2923556063 Bacteria 6793593
254 2929230533 2929226422 Bacteria 7248583
255 2933573793 2933570622 Bacteria 7023390
256 2935903319 2935901341 Bacteria 7341747
257 8003832697 8003830390 Bacteria 6541657
258 8003875031 8003870546 Bacteria 7396674
259 8005277711 8005275841 Bacteria 6929066
260 8005308088 8005307578 Bacteria 7395396
261 8018129298 8018127388 Bacteria 7351159
262 8018176262 8018176218 Bacteria 6896178
263 8023681755 8023680758 Bacteria 7729763
264 8054708551 8054704163 Bacteria 7247792
265 8054734045 8054727385 Bacteria 7558670
266 8054735589 8054734606 Bacteria 6947278
267 8056584515 8056579771 Bacteria 5840325
268 Ga0496125_0000561
269 JGI25162J39368_1001452
270 JGI25158J39367_1000016
271 JGI25152J39213_1002675
272 JGI25151J46595_10038147
273 JGI25153J46596_10001696
274 rootH1_10077392
275 rootH2_10258226
276 rootH1_10080598
277 rootH1_10382163
278 JGI25160J50197_1016478
279 JGI25161J50226_1000096
280 Ga0055533_1001064
281 Ga0055535_1001186
282 Ga0055542_1000122
283 Ga0055526_1000231
284 Ga0055526_1006942
285 Ga0055526_1007540
286 Ga0055526_1008722
287 Ga0055526_1016182
288 Ga0055524_1001719
289 Ga0055524_1002133
290 Ga0055536_1052346
291 Ga0055528_1001910
292 Ga0055528_1006171
293 Ga0055540_1009346
294 Ga0055543_1000183
295 Ga0065165_1007774
296 Ga0068869_100542137
297 Ga0070682_100049885
298 Ga0070668_100003833
299 Ga0070669_100202337
300 Ga0070659_100583948
301 Ga0070714_100455224
302 Ga0070663_100094753
303 Ga0070685_10002640
304 Ga0070665_100446317
305 Ga0068862_100011415
306 Ga0081455_10031747
307 Ga0075363_100059111
308 Ga0079104_1000787
309 Ga0105240_10005157
310 Ga0105247_10433157
311 Ga0105237_10000038
312 Ga0105237_10021627
313 Ga0105238_10105592
314 Ga0105239_10000108
315 Ga0157370_10099595
316 Ga0157372_10210429
317 Ga0157375_10472608
318 Ga0163163_10493240
319 Ga0163161_10501617
320 Ga0209436_100004
321 Ga0209672_100608
322 Ga0209258_100187
323 Ga0209148_1000172
324 Ga0209129_1004134
325 Ga0209129_1012449
326 Ga0209455_1001130
327 Ga0209673_1000416
328 Ga0209673_1005781
329 Ga0209130_1000001
330 Ga0209025_1002295
331 Ga0209564_1000023
332 Ga0209564_1002866
333 Ga0209564_1007027
334 Ga0209564_1008079
335 Ga0209758_1003136
336 Ga0209758_1019564
337 Ga0209256_1002356
338 Ga0209256_1007353
339 Ga0209256_1008456
340 Ga0209256_1015379
341 Ga0207426_1000005
342 Ga0209051_1045902
343 Ga0209257_1039426
344 Ga0207695_10000007
345 Ga0207671_10000045
346 Ga0207671_10027525
347 Ga0207691_10232764
348 Ga0207668_10004702
349 Ga0207678_10180099
350 Ga0209281_1001398
351 Ga0314311_1015226
352 Ga0316179_1019039
353 Ga0307408_100000789
354 Ga0307406_10000626
355 Ga0307412_10086654
356 Ga0395899_0133792
357 Ga0395898_0000298
358 Ga0395901_0001766
359 Ga0439465_0009727
360 Ga0451833_0179819
361 Ga0451835_0183075
362 Ga0451837_1812141
363 Ga0451839_0021533
364 Ga0451839_0246518
365 Ga0451841_0374909
366 Ga0451841_0489574
367 Ga0451847_0803056
368 Ga0451849_0223906
369 Ga0451851_0054054
370 Ga0451843_0112200
371 Ga0451843_0713499
372 Ga0451855_1133051
373 Ga0451853_0232983
374 Ga0451853_0752666
375 Ga0451853_2370101
376 Ga0439431_0042998
377 Ga0466965_0147218
378 Ga0466966_0002494
379 Ga0466966_0295570
380 Ga0466961_0114358
381 Ga0466961_0157307
382 Ga0466963_0243559
383 Ga0466963_0518774
384 Ga0466958_0022578
385 Ga0466967_0207385
386 Ga0466967_0362662
387 Ga0495627_031967
388 Ga0495638_0000048
389 Ga0495651_0005061
390 Ga0495605_0145513
391 Ga0495585_0024749
392 Ga0495607_0018085
393 Ga0495583_0051833
394 Ga0495583_0133580
395 Ga0495606_0227847
396 Ga0495610_0035425
397 Ga0495628_0148258
398 Ga0495631_0136335
399 Ga0495632_0001116
400 Ga0495637_0108173
401 Ga0495643_0024607
402 Ga0495648_0008900
403 Ga0495652_0004009
404 Ga0495654_0092144
405 Ga0495609_0103245
406 Ga0495597_0006075
407 Ga0495597_0047216
408 Ga0495645_0103282
409 Ga0495633_0070706
410 Ga0495656_0065224
411 Ga0495611_0028650
412 Ga0495625_0342660
413 Ga0495670_0041838
414 Ga0495649_0013811
415 Ga0495660_0163136
416 Ga0495681_0119921
417 Ga0495686_0009558
418 Ga0495615_0010678
419 Ga0496100_0013057
420 Ga0496101_0074867
421 Ga0496102_0056365
422 Ga0496103_0030766
423 Ga0496106_0000075
424 Ga0496106_0432610
425 Ga0496113_0135179
426 Ga0496116_0001693
427 Ga0496116_0004036
428 Ga0496116_0005490
429 Ga0496116_0054944
430 Ga0496117_0011298
431 Ga0496118_0012800
432 Ga0496118_0018447
433 Ga0496119_0005043
434 Ga0496120_0003406
435 Ga0496121_0001176
436 Ga0496121_0013698
437 Ga0496121_0015757
438 Ga0496122_0010004
439 Ga0496122_0029923
440 Ga0496122_0163192
441 Ga0496123_0006306
442 Ga0496123_0030572
443 Ga0496124_0009231
444 Ga0496124_0013784
445 Ga0496124_0060940
446 Ga0496125_0011350
447 Ga0496126_0005432
448 nmdc:mga03n38_174408_c1
449 Ga0500562_003666
450 Ga0500594_0011397
451 Ga0500658_0000894
452 Ga0500658_0006012
453 Ga0500658_0006199
454 Ga0500658_0057125
455 Ga0500568_0000265
456 Ga0500604_0030661
457 Ga0500616_0000011
458 Ga0500616_0197112
459 Ga0500622_0000099
460 Ga0466962_0037986
461 Ga0466962_0325014
462 2510892691
463 2511199785
464 2513579788
465 2513869829
466 2514018439
467 2515632631
468 2515640424
469 2515656518
470 2515738268
471 2517080312
472 2517098911
473 2517407873
474 2517409819
475 2530648959
476 2585200842
477 2585221517
478 2585283199
479 2585404399
480 2585526639
481 2585544313
482 2585824717
483 2587916467
484 2616313078
485 2644202932
486 2644300836
487 2644659058
488 2719389368
489 2721402134
490 2724035967
491 2739325650
492 2739605285
493 2760623621
494 2772642030
495 2809028514
496 2819687870
497 2838690673
498 2841855594
499 2842160700
500 2842164217
501 2842184316
502 2842231899
503 2842275013
504 2842307551
505 2855676102
506 2855682583
507 2857294168
508 2858851678
509 2858882830
510 2858895001
511 2858900010
512 2869052757
513 2869068737
514 2880490510
515 2880502003
516 2885306688
517 2885328393
518 2885334800
519 2919103569
520 2923559889
521 2929230533
522 2933573793
523 2935903319
524 8003832697
525 8003875031
526 8005277711
527 8005308088
528 8018129298
529 8018176262
530 8023681755
531 8054708551
532 8054734045
533 8054735589
534 8056584515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12695

Abhydrolase_5

Alpha/beta hydrolase family

51

152

0.87

PF12146

Hydrolase_4

Serine aminopeptidase, S33

46

265

0.72

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

52

272

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.8716 60 291
2wfl-assembly2.cif.gz_B crystal structure of polyneuridine aldehyde esterase 0.8637 59 286
2wfm-assembly1.cif.gz_A crystal structure of polyneuridine aldehyde esterase mutant (h244a) 0.8607 60 286
1y7i-assembly1.cif.gz_B structural and biochemical studies identify tobacco sabp2 as a methylsalicylate esterase and further implicate it in plant innate immunity, northeast structural genomics target ar2241 0.8498 60 286
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.8495 60 290
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9447 58 288 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9208 58 288 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8534 61 286 3.40.50.1820
af_F4IMK2_5_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8505 59 286 3.40.50.1820
af_O23512_10_262_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8397 60 287 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A428YUV2-F1-model_v4 Alpha/beta hydrolase 0.9899 59 288 GO:0016787
AF-A0A7H8KAK9-F1-model_v4 Alpha/beta hydrolase 0.9897 59 289 GO:0016787
AF-A0A0A6UKN1-F1-model_v4 Alpha/beta hydrolase 0.9896 59 289 GO:0016787
AF-A0A439MR55-F1-model_v4 deleted 0.9882 126 288
AF-A0A4R0JMX9-F1-model_v4 Alpha/beta hydrolase 0.9801 63 288 GO:0016787

Map