F374992

General Info

Members Datasets Scaffolds Average Seq Length
267 133 534 216

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0070649|Ga0495592_0070649_1595_2284
Length 229
Sequence VTPAIPDNPSRAERFAPAFLAIALVMLAVAPFYVDQAPAEATMGIVSKIFYFHVPVASLTLISSIVCGVASALFLARRRPGADHVALAAAELVVVFGLAVLVTGPLWARKAWGVWWVWEARLVMTLVLWMIFVAYLLLRRFGGPGAEILAAAVGLFGMAVSPFIYWSVNLWRTMHPLTTVVPNLPAPMAGPLWFCMAAFACLYVGLLLMRVRLERGHAAIERLYLALED

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
64 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
65 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
66 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
67 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
68 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
69 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
70 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
74 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
86 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
87 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
114 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 1.12
Rhizosphere 97.38
Stem 0
Stem Tuber 0
Unclassified 9.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0070649 3300046454 Bacteria 2543
2 Ga0070690_100237427 3300005330 Bacteria 1284
3 Ga0070670_100711939 3300005331 Unclassified 903
4 Ga0070680_100789109 3300005336 Unclassified 818
5 Ga0070689_100154434 3300005340 Unclassified 1853
6 Ga0070689_100172701 3300005340 Bacteria 1752
7 Ga0070687_100249434 3300005343 Bacteria 1102
8 Ga0070661_100270824 3300005344 Bacteria 1315
9 Ga0070669_100144682 3300005353 Bacteria 1836
10 Ga0070669_100305506 3300005353 Bacteria 1281
11 Ga0070674_100249277 3300005356 Bacteria 1394
12 Ga0070673_100773443 3300005364 Bacteria 885
13 Ga0070688_100076012 3300005365 Bacteria 2160
14 Ga0070688_100078561 3300005365 Bacteria 2129
15 Ga0070700_100457817 3300005441 Bacteria 972
16 Ga0070694_100857184 3300005444 Unclassified 748
17 Ga0070708_100166373 3300005445 Bacteria 2057
18 Ga0070681_10021133 3300005458 Bacteria 6522
19 Ga0070681_10515339 3300005458 Bacteria 1109
20 Ga0070679_100214626 3300005530 Bacteria 1887
21 Ga0070695_100260081 3300005545 Bacteria 1267
22 Ga0070695_100333617 3300005545 Bacteria 1131
23 Ga0070665_100824832 3300005548 Bacteria 940
24 Ga0070704_100100683 3300005549 Bacteria 2176
25 Ga0068854_100194439 3300005578 Bacteria 1591
26 Ga0068859_100404130 3300005617 Bacteria 1462
27 Ga0068870_10155211 3300005840 Bacteria 1352
28 Ga0068863_100487678 3300005841 Bacteria 1213
29 Ga0068860_100263048 3300005843 Bacteria 1682
30 Ga0068862_100215837 3300005844 Bacteria 1735
31 Ga0075362_10000692 3300006177 Bacteria 9968
32 Ga0097621_100408154 3300006237 Bacteria 1217
33 Ga0075428_100001180 3300006844 Bacteria 27949
34 Ga0075428_100006473 3300006844 Bacteria 13029
35 Ga0075428_100007209 3300006844 Bacteria 12312
36 Ga0075428_100047289 3300006844 Bacteria 4726
37 Ga0075428_100081625 3300006844 Bacteria 3528
38 Ga0075428_100659386 3300006844 Bacteria 1116
39 Ga0075430_100001994 3300006846 Bacteria 16823
40 Ga0075430_100037657 3300006846 Bacteria 4100
41 Ga0075430_100106297 3300006846 Bacteria 2341
42 Ga0075431_100002509 3300006847 Bacteria 17691
43 Ga0075431_100167358 3300006847 Bacteria 2259
44 Ga0075431_100234079 3300006847 Bacteria 1871
45 Ga0075433_10100693 3300006852 Bacteria 2559
46 Ga0075429_100006027 3300006880 Bacteria 10480
47 Ga0075429_100014501 3300006880 Bacteria 6831
48 Ga0075429_100048418 3300006880 Bacteria 3696
49 Ga0075429_100609039 3300006880 Bacteria 957
50 Ga0097620_100404114 3300006931 Bacteria 1462
51 Ga0105240_10025350 3300009093 Bacteria 7794
52 Ga0111539_10000335 3300009094 Bacteria 57807
53 Ga0111539_10006587 3300009094 Bacteria 14967
54 Ga0111539_10032521 3300009094 Bacteria 6334
55 Ga0111539_10642938 3300009094 Bacteria 1235
56 Ga0111539_11213812 3300009094 Unclassified 876
57 Ga0114129_10000396 3300009147 Bacteria 50857
58 Ga0114129_10005931 3300009147 Bacteria 17290
59 Ga0114129_10008612 3300009147 Bacteria 14547
60 Ga0114129_10065001 3300009147 Bacteria 5092
61 Ga0114129_10642961 3300009147 Bacteria 1370
62 Ga0114129_10743559 3300009147 Bacteria 1256
63 Ga0105241_10518642 3300009174 Bacteria 1065
64 Ga0105248_10193160 3300009177 Bacteria 2294
65 Ga0105248_10297789 3300009177 Bacteria 1816
66 Ga0157374_10092277 3300013296 Bacteria 2889
67 Ga0163162_10009491 3300013306 Bacteria 9461
68 Ga0163163_10000019 3300014325 Bacteria 199037
69 Ga0157380_10001870 3300014326 Bacteria 13935
70 Ga0157380_10003415 3300014326 Bacteria 10904
71 Ga0157380_10144043 3300014326 Bacteria 2051
72 Ga0157380_10280814 3300014326 Unclassified 1523
73 Ga0207681_10261107 3300025923 Bacteria 1356
74 Ga0207690_10022346 3300025932 Bacteria 3934
75 Ga0207669_10408367 3300025937 Bacteria 1066
76 Ga0207711_10084881 3300025941 Bacteria 2773
77 Ga0207711_10350885 3300025941 Bacteria 1366
78 Ga0207711_10709085 3300025941 Bacteria 938
79 Ga0207640_10623034 3300025981 Bacteria 916
80 Ga0207708_10304545 3300026075 Bacteria 1297
81 Ga0207708_10454784 3300026075 Bacteria 1067
82 Ga0207708_10467754 3300026075 Bacteria 1052
83 Ga0207675_100537157 3300026118 Bacteria 1167
84 Ga0207683_10305222 3300026121 Unclassified 1456
85 Ga0207683_10432224 3300026121 Bacteria 1213
86 Ga0207683_10783032 3300026121 Bacteria 885
87 Ga0207428_10003739 3300027907 Bacteria 14606
88 Ga0207428_10030736 3300027907 Bacteria 4438
89 Ga0207428_10043189 3300027907 Bacteria 3642
90 Ga0207428_10211761 3300027907 Bacteria 1456
91 Ga0268264_10204783 3300028381 Bacteria 1807
92 Ga0307408_100015760 3300031548 Bacteria 5036
93 Ga0307408_100052274 3300031548 Unclassified 2946
94 Ga0307408_100057296 3300031548 Unclassified 2828
95 Ga0307408_100167359 3300031548 Bacteria 1752
96 Ga0307408_100272143 3300031548 Bacteria 1407
97 Ga0307405_10383750 3300031731 Unclassified 1094
98 Ga0307413_10185299 3300031824 Bacteria 1489
99 Ga0307413_10347036 3300031824 Unclassified 1144
100 Ga0307410_10639917 3300031852 Bacteria 891
101 Ga0307406_10072359 3300031901 Bacteria 2263
102 Ga0307412_10160336 3300031911 Bacteria 1670
103 Ga0307412_10491281 3300031911 Bacteria 1020
104 Ga0307409_100052563 3300031995 Bacteria 3125
105 Ga0307409_100559397 3300031995 Unclassified 1124
106 Ga0307409_101194532 3300031995 Bacteria 784
107 Ga0307416_100265676 3300032002 Bacteria 1680
108 Ga0307414_10188341 3300032004 Bacteria 1667
109 Ga0307415_100112799 3300032126 Unclassified 2021
110 Ga0307415_100375743 3300032126 Bacteria 1205
111 Ga0307415_100504012 3300032126 Unclassified 1059
112 Ga0373953_0324527 3300035117 Bacteria 673
113 Ga0373962_0180481 3300035242 Unclassified 705
114 Ga0439433_0044040 3300041999 Bacteria 1043
115 Ga0439443_035364 3300042003 Bacteria 838
116 Ga0439450_003070 3300042008 Unclassified 2717
117 Ga0439462_0117194 3300042015 Bacteria 739
118 Ga0439444_0046761 3300042437 Bacteria 867
119 Ga0439464_0001159 3300042439 Bacteria 6101
120 Ga0439464_0026565 3300042439 Unclassified 1607
121 Ga0451576_0014963 3300045051 Bacteria 8617
122 Ga0495653_0022933 3300046463 Bacteria 5048
123 Ga0495582_0488421 3300046473 Bacteria 712
124 Ga0495639_0167082 3300046475 Bacteria 1067
125 Ga0495628_0779772 3300046516 Bacteria 670
126 Ga0495633_0127666 3300046558 Bacteria 1177
127 Ga0495647_0084803 3300046681 Bacteria 1290
128 Ga0495658_0135208 3300046683 Bacteria 1504
129 Ga0495613_0068899 3300046689 Bacteria 2580
130 Ga0495674_0152547 3300047319 Unclassified 1937
131 Ga0495674_0326154 3300047319 Bacteria 1250
132 Ga0495676_0289095 3300047321 Bacteria 1108
133 Ga0496102_0319915 3300048905 Bacteria 1462
134 Ga0496108_0760054 3300048911 Bacteria 838
135 Ga0496112_0431271 3300048915 Bacteria 1256
136 Ga0501295_099693 3300049518 Unclassified 680
137 Ga0501299_017622 3300049522 Bacteria 1277
138 Ga0501300_017539 3300049523 Unclassified 1045
139 Ga0501031_0001224 3300049568 Bacteria 15715
140 Ga0501031_0064792 3300049568 Bacteria 2380
141 Ga0501032_0002137 3300049569 Bacteria 15582
142 Ga0501032_0011924 3300049569 Bacteria 6225
143 Ga0501032_0014367 3300049569 Bacteria 5608
144 Ga0501033_0000733 3300049570 Bacteria 30120
145 Ga0501033_0001388 3300049570 Bacteria 21508
146 Ga0501033_0071194 3300049570 Bacteria 2554
147 Ga0501034_0064413 3300049571 Bacteria 3679
148 Ga0501034_0075963 3300049571 Bacteria 3366
149 Ga0501034_0223317 3300049571 Bacteria 1835
150 Ga0501036_0001730 3300049572 Bacteria 16963
151 Ga0501036_0004183 3300049572 Bacteria 11624
152 Ga0501036_0009309 3300049572 Bacteria 8077
153 Ga0501037_0000564 3300049573 Bacteria 29390
154 Ga0501037_0003091 3300049573 Bacteria 12062
155 Ga0501037_0079906 3300049573 Bacteria 2373
156 Ga0501037_0214861 3300049573 Bacteria 1355
157 Ga0501038_0007522 3300049574 Bacteria 10042
158 Ga0501038_0024188 3300049574 Bacteria 5420
159 Ga0501038_0071039 3300049574 Bacteria 2954
160 Ga0501039_0021631 3300049575 Bacteria 4934
161 Ga0501039_0244713 3300049575 Bacteria 1410
162 Ga0501040_0439305 3300049576 Bacteria 939
163 Ga0501040_0517738 3300049576 Bacteria 860
164 Ga0501042_0165711 3300049578 Bacteria 1594
165 Ga0501042_0263799 3300049578 Bacteria 1243
166 Ga0501043_0010945 3300049579 Bacteria 7106
167 Ga0501043_0047717 3300049579 Bacteria 3366
168 Ga0501043_0078871 3300049579 Bacteria 2588
169 Ga0501046_0006894 3300049580 Bacteria 10013
170 Ga0501046_0049093 3300049580 Bacteria 3339
171 Ga0501046_0172921 3300049580 Bacteria 1619
172 Ga0501047_0075670 3300049581 Bacteria 3239
173 Ga0501047_0163311 3300049581 Bacteria 2098
174 Ga0501047_0303436 3300049581 Bacteria 1438
175 Ga0501047_0805159 3300049581 Bacteria 754
176 Ga0501048_0001707 3300049582 Bacteria 16749
177 Ga0501048_0005256 3300049582 Bacteria 9859
178 Ga0501048_0027225 3300049582 Bacteria 4156
179 Ga0501048_0124705 3300049582 Bacteria 1821
180 Ga0501067_0000815 3300049583 Bacteria 16796
181 Ga0501067_0041256 3300049583 Bacteria 2562
182 Ga0501068_0001407 3300049584 Bacteria 12808
183 Ga0501069_0000807 3300049585 Bacteria 14788
184 Ga0501069_0007725 3300049585 Bacteria 5644
185 Ga0501070_0047063 3300049586 Bacteria 3586
186 Ga0501070_0068011 3300049586 Bacteria 2949
187 Ga0501070_0074878 3300049586 Bacteria 2802
188 Ga0501071_0038887 3300049587 Bacteria 3401
189 Ga0501072_0024553 3300049588 Bacteria 4690
190 Ga0501072_0120488 3300049588 Unclassified 2090
191 Ga0501073_0012327 3300049589 Bacteria 6237
192 Ga0501073_0112803 3300049589 Bacteria 1885
193 Ga0501073_0159024 3300049589 Unclassified 1565
194 Ga0501073_0177989 3300049589 Bacteria 1472
195 Ga0501074_0006261 3300049590 Bacteria 8591
196 Ga0501074_0047830 3300049590 Bacteria 3090
197 Ga0501075_0008610 3300049591 Bacteria 7113
198 Ga0501075_0220792 3300049591 Bacteria 1446
199 Ga0501076_0091561 3300049592 Bacteria 2446
200 Ga0501076_0193012 3300049592 Bacteria 1662
201 Ga0501076_0354386 3300049592 Bacteria 1205
202 Ga0501077_0084600 3300049593 Bacteria 2011
203 Ga0501217_094367 3300049661 Bacteria 843
204 Ga0501235_044228 3300049669 Unclassified 1023
205 Ga0501079_0001485 3300049741 Bacteria 16607
206 Ga0501079_0010722 3300049741 Bacteria 6979
207 Ga0501079_0032761 3300049741 Bacteria 3996
208 Ga0501079_0049532 3300049741 Bacteria 3242
209 Ga0501079_0157402 3300049741 Bacteria 1771
210 Ga0501079_0458377 3300049741 Bacteria 1001
211 Ga0501080_0027692 3300049742 Bacteria 5269
212 Ga0501080_0034310 3300049742 Bacteria 4735
213 Ga0501080_0039039 3300049742 Bacteria 4430
214 Ga0501080_0749682 3300049742 Bacteria 859
215 Ga0501083_0034534 3300049744 Bacteria 3457
216 Ga0501083_0039355 3300049744 Bacteria 3211
217 Ga0501083_0057917 3300049744 Bacteria 2593
218 Ga0501083_0228052 3300049744 Bacteria 1213
219 Ga0501035_0007577 3300049822 Bacteria 10142
220 Ga0501035_0157771 3300049822 Bacteria 1965
221 Ga0501035_0351235 3300049822 Bacteria 1233
222 Ga0501044_0075822 3300049823 Bacteria 3414
223 Ga0501044_0430547 3300049823 Bacteria 1228
224 Ga0501045_0015716 3300049824 Bacteria 5370
225 Ga0501045_0230330 3300049824 Bacteria 1379
226 nmdc:mga03683_611_c2 3300050489 Bacteria 9968
227 nmdc:mga00v17_190706_c1 3300050491 Bacteria 1324
228 nmdc:mga05p37_1604_c1 3300050507 Bacteria 26227
229 nmdc:mga05p37_187477_c1 3300050507 Bacteria 2514
230 nmdc:mga05p37_204571_c1 3300050507 Bacteria 2389
231 nmdc:mga05p37_7540_c1 3300050507 Bacteria 12828
232 nmdc:mga09592_125725_c1 3300050508 Unclassified 2204
233 nmdc:mga09592_18718_c1 3300050508 Bacteria 5680
234 nmdc:mga09592_208_c1 3300050508 Bacteria 42018
235 nmdc:mga09592_255131_c1 3300050508 Bacteria 1520
236 nmdc:mga09592_70983_c1 3300050508 Bacteria 2956
237 nmdc:mga0qj67_21429_c1 3300050509 Bacteria 4958
238 nmdc:mga0qj67_36154_c1 3300050509 Bacteria 3864
239 nmdc:mga06r32_135769_c1 3300050510 Bacteria 2435
240 nmdc:mga06r32_239883_c1 3300050510 Bacteria 1801
241 nmdc:mga06r32_353000_c1 3300050510 Viruses 1455
242 nmdc:mga06r32_35399_c1 3300050510 Bacteria 4711
243 nmdc:mga06r32_6097_c1 3300050510 Bacteria 10833
244 nmdc:mga06r32_6631_c1 3300050510 Bacteria 10405
245 nmdc:mga06r32_772365_c1 3300050510 Bacteria 923
246 nmdc:mga08y16_10025_c1 3300050511 Bacteria 9945
247 nmdc:mga08y16_1081405_c1 3300050511 Bacteria 778
248 nmdc:mga08y16_158403_c1 3300050511 Bacteria 2352
249 nmdc:mga08y16_35379_c1 3300050511 Bacteria 5244
250 nmdc:mga08y16_4359_c1 3300050511 Bacteria 14785
251 nmdc:mga08y16_52044_c1 3300050511 Bacteria 4285
252 nmdc:mga08y16_67771_c1 3300050511 Bacteria 3722
253 nmdc:mga08y16_892119_c1 3300050511 Unclassified 876
254 nmdc:mga08y16_9793_c1 3300050511 Bacteria 10058
255 Ga0500641_0008784 3300053096 Bacteria 3616
256 Ga0501084_0003888 3300054114 Bacteria 12155
257 Ga0501084_0025437 3300054114 Bacteria 4939
258 Ga0501084_0061674 3300054114 Bacteria 3140
259 Ga0501084_0071052 3300054114 Bacteria 2914
260 Ga0501084_0352808 3300054114 Bacteria 1243
261 Ga0590071_027715 3300059421 Bacteria 1345
262 Ga0590075_035205 3300059424 Bacteria 1275
263 Ga0501082_0001684 3300060353 Bacteria 19500
264 Ga0501082_0049964 3300060353 Bacteria 3606
265 Ga0501082_0074117 3300060353 Bacteria 2931
266 Ga0501082_0192728 3300060353 Unclassified 1773
267 Ga0530510_0424479 3300061734 Bacteria 1004
268 Ga0495592_0070649
269 Ga0070690_100237427
270 Ga0070670_100711939
271 Ga0070680_100789109
272 Ga0070689_100154434
273 Ga0070689_100172701
274 Ga0070687_100249434
275 Ga0070661_100270824
276 Ga0070669_100144682
277 Ga0070669_100305506
278 Ga0070674_100249277
279 Ga0070673_100773443
280 Ga0070688_100076012
281 Ga0070688_100078561
282 Ga0070700_100457817
283 Ga0070694_100857184
284 Ga0070708_100166373
285 Ga0070681_10021133
286 Ga0070681_10515339
287 Ga0070679_100214626
288 Ga0070695_100260081
289 Ga0070695_100333617
290 Ga0070665_100824832
291 Ga0070704_100100683
292 Ga0068854_100194439
293 Ga0068859_100404130
294 Ga0068870_10155211
295 Ga0068863_100487678
296 Ga0068860_100263048
297 Ga0068862_100215837
298 Ga0075362_10000692
299 Ga0097621_100408154
300 Ga0075428_100001180
301 Ga0075428_100006473
302 Ga0075428_100007209
303 Ga0075428_100047289
304 Ga0075428_100081625
305 Ga0075428_100659386
306 Ga0075430_100001994
307 Ga0075430_100037657
308 Ga0075430_100106297
309 Ga0075431_100002509
310 Ga0075431_100167358
311 Ga0075431_100234079
312 Ga0075433_10100693
313 Ga0075429_100006027
314 Ga0075429_100014501
315 Ga0075429_100048418
316 Ga0075429_100609039
317 Ga0097620_100404114
318 Ga0105240_10025350
319 Ga0111539_10000335
320 Ga0111539_10006587
321 Ga0111539_10032521
322 Ga0111539_10642938
323 Ga0111539_11213812
324 Ga0114129_10000396
325 Ga0114129_10005931
326 Ga0114129_10008612
327 Ga0114129_10065001
328 Ga0114129_10642961
329 Ga0114129_10743559
330 Ga0105241_10518642
331 Ga0105248_10193160
332 Ga0105248_10297789
333 Ga0157374_10092277
334 Ga0163162_10009491
335 Ga0163163_10000019
336 Ga0157380_10001870
337 Ga0157380_10003415
338 Ga0157380_10144043
339 Ga0157380_10280814
340 Ga0207681_10261107
341 Ga0207690_10022346
342 Ga0207669_10408367
343 Ga0207711_10084881
344 Ga0207711_10350885
345 Ga0207711_10709085
346 Ga0207640_10623034
347 Ga0207708_10304545
348 Ga0207708_10454784
349 Ga0207708_10467754
350 Ga0207675_100537157
351 Ga0207683_10305222
352 Ga0207683_10432224
353 Ga0207683_10783032
354 Ga0207428_10003739
355 Ga0207428_10030736
356 Ga0207428_10043189
357 Ga0207428_10211761
358 Ga0268264_10204783
359 Ga0307408_100015760
360 Ga0307408_100052274
361 Ga0307408_100057296
362 Ga0307408_100167359
363 Ga0307408_100272143
364 Ga0307405_10383750
365 Ga0307413_10185299
366 Ga0307413_10347036
367 Ga0307410_10639917
368 Ga0307406_10072359
369 Ga0307412_10160336
370 Ga0307412_10491281
371 Ga0307409_100052563
372 Ga0307409_100559397
373 Ga0307409_101194532
374 Ga0307416_100265676
375 Ga0307414_10188341
376 Ga0307415_100112799
377 Ga0307415_100375743
378 Ga0307415_100504012
379 Ga0373953_0324527
380 Ga0373962_0180481
381 Ga0439433_0044040
382 Ga0439443_035364
383 Ga0439450_003070
384 Ga0439462_0117194
385 Ga0439444_0046761
386 Ga0439464_0001159
387 Ga0439464_0026565
388 Ga0451576_0014963
389 Ga0495653_0022933
390 Ga0495582_0488421
391 Ga0495639_0167082
392 Ga0495628_0779772
393 Ga0495633_0127666
394 Ga0495647_0084803
395 Ga0495658_0135208
396 Ga0495613_0068899
397 Ga0495674_0152547
398 Ga0495674_0326154
399 Ga0495676_0289095
400 Ga0496102_0319915
401 Ga0496108_0760054
402 Ga0496112_0431271
403 Ga0501295_099693
404 Ga0501299_017622
405 Ga0501300_017539
406 Ga0501031_0001224
407 Ga0501031_0064792
408 Ga0501032_0002137
409 Ga0501032_0011924
410 Ga0501032_0014367
411 Ga0501033_0000733
412 Ga0501033_0001388
413 Ga0501033_0071194
414 Ga0501034_0064413
415 Ga0501034_0075963
416 Ga0501034_0223317
417 Ga0501036_0001730
418 Ga0501036_0004183
419 Ga0501036_0009309
420 Ga0501037_0000564
421 Ga0501037_0003091
422 Ga0501037_0079906
423 Ga0501037_0214861
424 Ga0501038_0007522
425 Ga0501038_0024188
426 Ga0501038_0071039
427 Ga0501039_0021631
428 Ga0501039_0244713
429 Ga0501040_0439305
430 Ga0501040_0517738
431 Ga0501042_0165711
432 Ga0501042_0263799
433 Ga0501043_0010945
434 Ga0501043_0047717
435 Ga0501043_0078871
436 Ga0501046_0006894
437 Ga0501046_0049093
438 Ga0501046_0172921
439 Ga0501047_0075670
440 Ga0501047_0163311
441 Ga0501047_0303436
442 Ga0501047_0805159
443 Ga0501048_0001707
444 Ga0501048_0005256
445 Ga0501048_0027225
446 Ga0501048_0124705
447 Ga0501067_0000815
448 Ga0501067_0041256
449 Ga0501068_0001407
450 Ga0501069_0000807
451 Ga0501069_0007725
452 Ga0501070_0047063
453 Ga0501070_0068011
454 Ga0501070_0074878
455 Ga0501071_0038887
456 Ga0501072_0024553
457 Ga0501072_0120488
458 Ga0501073_0012327
459 Ga0501073_0112803
460 Ga0501073_0159024
461 Ga0501073_0177989
462 Ga0501074_0006261
463 Ga0501074_0047830
464 Ga0501075_0008610
465 Ga0501075_0220792
466 Ga0501076_0091561
467 Ga0501076_0193012
468 Ga0501076_0354386
469 Ga0501077_0084600
470 Ga0501217_094367
471 Ga0501235_044228
472 Ga0501079_0001485
473 Ga0501079_0010722
474 Ga0501079_0032761
475 Ga0501079_0049532
476 Ga0501079_0157402
477 Ga0501079_0458377
478 Ga0501080_0027692
479 Ga0501080_0034310
480 Ga0501080_0039039
481 Ga0501080_0749682
482 Ga0501083_0034534
483 Ga0501083_0039355
484 Ga0501083_0057917
485 Ga0501083_0228052
486 Ga0501035_0007577
487 Ga0501035_0157771
488 Ga0501035_0351235
489 Ga0501044_0075822
490 Ga0501044_0430547
491 Ga0501045_0015716
492 Ga0501045_0230330
493 nmdc:mga03683_611_c2
494 nmdc:mga00v17_190706_c1
495 nmdc:mga05p37_1604_c1
496 nmdc:mga05p37_187477_c1
497 nmdc:mga05p37_204571_c1
498 nmdc:mga05p37_7540_c1
499 nmdc:mga09592_125725_c1
500 nmdc:mga09592_18718_c1
501 nmdc:mga09592_208_c1
502 nmdc:mga09592_255131_c1
503 nmdc:mga09592_70983_c1
504 nmdc:mga0qj67_21429_c1
505 nmdc:mga0qj67_36154_c1
506 nmdc:mga06r32_135769_c1
507 nmdc:mga06r32_239883_c1
508 nmdc:mga06r32_353000_c1
509 nmdc:mga06r32_35399_c1
510 nmdc:mga06r32_6097_c1
511 nmdc:mga06r32_6631_c1
512 nmdc:mga06r32_772365_c1
513 nmdc:mga08y16_10025_c1
514 nmdc:mga08y16_1081405_c1
515 nmdc:mga08y16_158403_c1
516 nmdc:mga08y16_35379_c1
517 nmdc:mga08y16_4359_c1
518 nmdc:mga08y16_52044_c1
519 nmdc:mga08y16_67771_c1
520 nmdc:mga08y16_892119_c1
521 nmdc:mga08y16_9793_c1
522 Ga0500641_0008784
523 Ga0501084_0003888
524 Ga0501084_0025437
525 Ga0501084_0061674
526 Ga0501084_0071052
527 Ga0501084_0352808
528 Ga0590071_027715
529 Ga0590075_035205
530 Ga0501082_0001684
531 Ga0501082_0049964
532 Ga0501082_0074117
533 Ga0501082_0192728
534 Ga0530510_0424479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

5

175

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.7192 1 204
6v00-assembly1.cif.gz_A structure of human kcnq1-kcne3-cam complex 0.7036 46 152
7jrq-assembly1.cif.gz_A crystallographically characterized de novo designed mn-diphenylporphyrin binding protein 0.6852 45 160
8den-assembly2.cif.gz_D-2 heme-free cytochrome variant apocyt 0.6721 45 157
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.6663 1 204
ID Description Score Start End Superfamily
af_Q4DM91_26_149_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6617 42 162 1.20.120.350
4jeaB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6524 48 154 1.20.120.10
af_Q4CZM6_26_149_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6482 42 162 1.20.120.350
af_Q9XWG9_48_197_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6468 31 153 1.20.120.350
af_Q4DM91_26_149_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6446 42 162 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A843SU14-F1-model_v4 Heme exporter protein C 0.9767 5 221 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A6GHX3-F1-model_v4 Heme exporter protein C 0.968 5 220 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A2E7G6H1-F1-model_v4 Heme exporter protein C 0.9644 5 219 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A2S9YIN5-F1-model_v4 Heme exporter protein C 0.9606 6 220 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A2W1ANU8-F1-model_v4 Heme exporter protein C 0.9579 3 219 GO:0005886
GO:0015232
GO:0017004
GO:0020037

Map