F374869

General Info

Members Datasets Scaffolds Average Seq Length
267 177 534 112

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000419|Ga0265327_1000041939
Length 119
Sequence VWVPAFSSLTCKQLLAYYSSQRTQTHPPILDIDKVFKALADPTRRQLLDLLHSDNGQTLSALCEQLVAVIWQGREKLHYLNPVPLHEVYERWICKFERSRLSALHALKQKLEGDQDDET

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
168 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
169 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
170 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
171 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
172 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
173 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
174 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
175 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
176 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
177 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0
Isolates 3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.99
Nodule 2.25
Rhizoplane 2.25
Rhizosphere 83.52
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10000419 3300031251 Bacteria 77672
2 Ga0065714_10087394 3300005288 Bacteria 2060
3 Ga0065712_10742950 3300005290 Bacteria 531
4 Ga0065715_10019875 3300005293 Bacteria 2020
5 Ga0070690_101321716 3300005330 Bacteria 578
6 Ga0070670_100192877 3300005331 Bacteria 1770
7 Ga0070677_10125813 3300005333 Bacteria 1163
8 Ga0070677_10672046 3300005333 Bacteria 581
9 Ga0068869_100072425 3300005334 Bacteria 2553
10 Ga0068868_100015816 3300005338 Bacteria 5589
11 Ga0070687_101263733 3300005343 Bacteria 547
12 Ga0070669_100305016 3300005353 Bacteria 1282
13 Ga0070669_101294861 3300005353 Bacteria 631
14 Ga0070675_100303542 3300005354 Bacteria 1407
15 Ga0070675_102125219 3300005354 Bacteria 517
16 Ga0070688_100605596 3300005365 Bacteria 839
17 Ga0070667_100000705 3300005367 Bacteria 32287
18 Ga0070667_100272078 3300005367 Bacteria 1519
19 Ga0070703_10000095 3300005406 Bacteria 45165
20 Ga0070703_10000930 3300005406 Bacteria 9326
21 Ga0070714_100170278 3300005435 Bacteria 1976
22 Ga0070713_100063926 3300005436 Bacteria 3087
23 Ga0070705_100000080 3300005440 Bacteria 52670
24 Ga0070700_101191542 3300005441 Bacteria 635
25 Ga0070700_101317605 3300005441 Bacteria 607
26 Ga0070694_100322329 3300005444 Bacteria 1189
27 Ga0070694_100401135 3300005444 Bacteria 1073
28 Ga0070694_100515708 3300005444 Unclassified 953
29 Ga0070708_100050007 3300005445 Bacteria 3700
30 Ga0070708_101761805 3300005445 Bacteria 575
31 Ga0070678_102075925 3300005456 Bacteria 538
32 Ga0068867_100383634 3300005459 Bacteria 1181
33 Ga0070706_100000108 3300005467 Bacteria 101389
34 Ga0070706_100015226 3300005467 Bacteria 7100
35 Ga0070707_100000314 3300005468 Bacteria 47490
36 Ga0070707_100520103 3300005468 Bacteria 1152
37 Ga0070698_100145582 3300005471 Bacteria 2319
38 Ga0070698_100302550 3300005471 Bacteria 1530
39 Ga0070698_100867151 3300005471 Bacteria 848
40 Ga0070699_100221227 3300005518 Bacteria 1687
41 Ga0070697_100026602 3300005536 Bacteria 4624
42 Ga0070672_100290600 3300005543 Bacteria 1384
43 Ga0070695_100994160 3300005545 Unclassified 682
44 Ga0070696_100432493 3300005546 Bacteria 1035
45 Ga0070696_101361509 3300005546 Bacteria 604
46 Ga0070693_100035691 3300005547 Bacteria 2759
47 Ga0070665_100087623 3300005548 Bacteria 3119
48 Ga0070665_100130235 3300005548 Bacteria 2518
49 Ga0070704_100529231 3300005549 Bacteria 1027
50 Ga0070704_101546394 3300005549 Bacteria 611
51 Ga0068855_100029505 3300005563 Bacteria 6556
52 Ga0068857_101855214 3300005577 Bacteria 590
53 Ga0070702_100453430 3300005615 Bacteria 931
54 Ga0070702_100968286 3300005615 Bacteria 671
55 Ga0070702_101018373 3300005615 Archaea 657
56 Ga0068852_100088607 3300005616 Bacteria 2764
57 Ga0068859_100029793 3300005617 Bacteria 5476
58 Ga0068859_100311823 3300005617 Bacteria 1667
59 Ga0068859_100477055 3300005617 Bacteria 1343
60 Ga0068859_102011305 3300005617 Bacteria 638
61 Ga0068859_102984906 3300005617 Bacteria 517
62 Ga0068864_100030734 3300005618 Bacteria 4554
63 Ga0068864_100683572 3300005618 Bacteria 1001
64 Ga0068861_100386516 3300005719 Bacteria 1238
65 Ga0068861_100586770 3300005719 Bacteria 1021
66 Ga0068861_101459496 3300005719 Bacteria 670
67 Ga0068851_10255359 3300005834 Bacteria 995
68 Ga0068863_100093773 3300005841 Bacteria 2849
69 Ga0068863_101106461 3300005841 Bacteria 797
70 Ga0068863_101560210 3300005841 Bacteria 669
71 Ga0068863_101744846 3300005841 Bacteria 632
72 Ga0068863_102472951 3300005841 Bacteria 529
73 Ga0068858_100013802 3300005842 Bacteria 7626
74 Ga0068860_100097921 3300005843 Bacteria 2797
75 Ga0068860_101742866 3300005843 Bacteria 645
76 Ga0075368_10120070 3300006042 Bacteria 1088
77 Ga0075363_100189498 3300006048 Bacteria 1173
78 Ga0075364_10991848 3300006051 Bacteria 571
79 Ga0075362_10198018 3300006177 Bacteria 977
80 Ga0075367_10058436 3300006178 Bacteria 2295
81 Ga0075367_10319594 3300006178 Bacteria 978
82 Ga0075366_10238710 3300006195 Bacteria 1108
83 Ga0075366_10781217 3300006195 Bacteria 594
84 Ga0075370_10522479 3300006353 Bacteria 717
85 Ga0075370_10771076 3300006353 Bacteria 586
86 Ga0068871_101165400 3300006358 Bacteria 722
87 Ga0075428_100449169 3300006844 Bacteria 1381
88 Ga0075430_100686561 3300006846 Bacteria 844
89 Ga0075431_100118814 3300006847 Bacteria 2728
90 Ga0075431_100378975 3300006847 Bacteria 1419
91 Ga0075429_100474667 3300006880 Bacteria 1096
92 Ga0097620_100029793 3300006931 Bacteria 5476
93 Ga0097620_100311853 3300006931 Bacteria 1667
94 Ga0097620_100477112 3300006931 Bacteria 1343
95 Ga0097620_100721195 3300006931 Bacteria 1087
96 Ga0097620_102011436 3300006931 Bacteria 638
97 Ga0097620_102985035 3300006931 Bacteria 517
98 Ga0099794_10132115 3300007265 Bacteria 1261
99 Ga0105240_10000076 3300009093 Bacteria 198848
100 Ga0105240_10821913 3300009093 Bacteria 1005
101 Ga0111539_10254121 3300009094 Bacteria 2046
102 Ga0111539_10523794 3300009094 Bacteria 1381
103 Ga0111539_11498441 3300009094 Bacteria 782
104 Ga0105245_10021700 3300009098 Bacteria 5637
105 Ga0105245_12311531 3300009098 Bacteria 591
106 Ga0105247_10118569 3300009101 Unclassified 1712
107 Ga0105247_10160954 3300009101 Bacteria 1486
108 Ga0114129_10944051 3300009147 Bacteria 1090
109 Ga0105242_10145455 3300009176 Bacteria 2062
110 Ga0105248_10014247 3300009177 Bacteria 8753
111 Ga0105248_10056595 3300009177 Bacteria 4399
112 Ga0105248_10175010 3300009177 Bacteria 2419
113 Ga0105248_12083621 3300009177 Bacteria 645
114 Ga0105237_10000226 3300009545 Bacteria 79798
115 Ga0105237_11497876 3300009545 Bacteria 681
116 Ga0105238_10586128 3300009551 Bacteria 1122
117 Ga0105249_11273710 3300009553 Bacteria 807
118 Ga0105239_10000641 3300010375 Bacteria 49765
119 Ga0105246_10063131 3300011119 Bacteria 2582
120 Ga0157370_10000455 3300013104 Bacteria 51231
121 Ga0157369_11469239 3300013105 Bacteria 694
122 Ga0157374_10331995 3300013296 Bacteria 1508
123 Ga0157378_10344261 3300013297 Bacteria 1455
124 Ga0157378_10466819 3300013297 Bacteria 1255
125 Ga0157378_12373271 3300013297 Bacteria 582
126 Ga0163162_13233280 3300013306 Bacteria 523
127 Ga0157375_10163655 3300013308 Bacteria 2368
128 Ga0157375_10485389 3300013308 Bacteria 1400
129 Ga0157375_10695730 3300013308 Archaea 1170
130 Ga0163163_10131646 3300014325 Bacteria 2541
131 Ga0157380_10062300 3300014326 Bacteria 2987
132 Ga0157380_10672232 3300014326 Bacteria 1036
133 Ga0157380_10783692 3300014326 Bacteria 968
134 Ga0157380_10918992 3300014326 Bacteria 902
135 Ga0182008_10025955 3300014497 Bacteria 2973
136 Ga0157379_10023857 3300014968 Bacteria 5430
137 Ga0157379_10095627 3300014968 Bacteria 2665
138 Ga0157376_10327055 3300014969 Bacteria 1459
139 Ga0157376_12338333 3300014969 Bacteria 574
140 Ga0157376_12379701 3300014969 Bacteria 569
141 Ga0207653_10000119 3300025885 Bacteria 55599
142 Ga0207682_10040929 3300025893 Bacteria 1890
143 Ga0207682_10430523 3300025893 Unclassified 624
144 Ga0207684_10000444 3300025910 Bacteria 54493
145 Ga0207684_10040803 3300025910 Bacteria 3935
146 Ga0207654_10175597 3300025911 Bacteria 1394
147 Ga0207671_10465400 3300025914 Bacteria 1007
148 Ga0207662_10574422 3300025918 Bacteria 782
149 Ga0207646_10000022 3300025922 Bacteria 259328
150 Ga0207646_11039478 3300025922 Bacteria 723
151 Ga0207681_10235813 3300025923 Bacteria 1422
152 Ga0207650_10432373 3300025925 Bacteria 1093
153 Ga0207659_10261954 3300025926 Bacteria 1407
154 Ga0207687_10025347 3300025927 Bacteria 3968
155 Ga0207700_10124749 3300025928 Bacteria 2093
156 Ga0207664_10422296 3300025929 Bacteria 1188
157 Ga0207670_10394950 3300025936 Bacteria 1105
158 Ga0207691_10256385 3300025940 Bacteria 1508
159 Ga0207691_10548999 3300025940 Archaea 980
160 Ga0207711_10229612 3300025941 Bacteria 1699
161 Ga0207711_10373454 3300025941 Bacteria 1322
162 Ga0207711_10687654 3300025941 Bacteria 954
163 Ga0207711_11431176 3300025941 Bacteria 634
164 Ga0207689_10138580 3300025942 Bacteria 2004
165 Ga0207651_11137911 3300025960 Bacteria 700
166 Ga0207668_10073171 3300025972 Bacteria 2455
167 Ga0207668_10267265 3300025972 Bacteria 1397
168 Ga0207658_10118596 3300025986 Bacteria 2105
169 Ga0207658_10410891 3300025986 Bacteria 1191
170 Ga0207658_11743043 3300025986 Bacteria 569
171 Ga0207677_10140638 3300026023 Bacteria 1847
172 Ga0207703_10196941 3300026035 Bacteria 1788
173 Ga0207641_10548127 3300026088 Bacteria 1127
174 Ga0207641_12061552 3300026088 Bacteria 571
175 Ga0207641_12444870 3300026088 Bacteria 521
176 Ga0207648_10207504 3300026089 Bacteria 1739
177 Ga0207676_10167965 3300026095 Bacteria 1908
178 Ga0207675_100126579 3300026118 Bacteria 2420
179 Ga0207675_100888526 3300026118 Bacteria 907
180 Ga0210002_1014537 3300027617 Bacteria 1235
181 Ga0209983_1036766 3300027665 Bacteria 1053
182 Ga0209974_10016553 3300027876 Bacteria 2448
183 Ga0268266_10054887 3300028379 Bacteria 3424
184 Ga0268265_11712173 3300028380 Bacteria 635
185 Ga0268265_11812083 3300028380 Bacteria 617
186 Ga0268264_12057338 3300028381 Bacteria 580
187 Ga0268264_12383126 3300028381 Bacteria 535
188 Ga0307515_10720105 3300028794 Bacteria 615
189 Ga0307513_10001365 3300031456 Bacteria 35245
190 Ga0307513_10012227 3300031456 Bacteria 10613
191 Ga0307513_10293538 3300031456 Bacteria 1396
192 Ga0307513_10315639 3300031456 Bacteria 1323
193 Ga0307513_10519299 3300031456 Bacteria 906
194 Ga0307408_100014278 3300031548 Bacteria 5277
195 Ga0307516_10002426 3300031730 Bacteria 24923
196 Ga0307414_10148881 3300032004 Bacteria 1843
197 Ga0395905_0000374 3300037471 Bacteria 63889
198 Ga0395905_0002016 3300037471 Bacteria 23213
199 Ga0451791_0153198 3300041451 Bacteria 635
200 Ga0451791_1852924 3300041451 Bacteria 948
201 Ga0451795_0648233 3300041456 Bacteria 1185
202 Ga0451843_0071562 3300041509 Bacteria 578
203 Ga0453683_0709442 3300044673 Bacteria 659
204 Ga0495592_0189150 3300046454 Bacteria 1396
205 Ga0495638_0305098 3300046460 Bacteria 856
206 Ga0495605_0446793 3300046474 Bacteria 533
207 Ga0495639_0062030 3300046475 Bacteria 1715
208 Ga0495585_0025650 3300046492 Bacteria 3373
209 Ga0495620_0266461 3300046515 Bacteria 652
210 Ga0495631_0066794 3300046518 Bacteria 1556
211 Ga0495663_0065947 3300046525 Bacteria 1145
212 Ga0495640_0492000 3300046533 Bacteria 747
213 Ga0495586_0500942 3300046535 Unclassified 701
214 Ga0495667_0108475 3300046559 Bacteria 1794
215 Ga0495668_0053018 3300046616 Bacteria 2244
216 Ga0495611_0152218 3300046648 Bacteria 1080
217 Ga0495625_0678859 3300046660 Bacteria 610
218 Ga0495588_0440127 3300046674 Bacteria 684
219 Ga0495599_0473336 3300046678 Bacteria 740
220 Ga0495623_0444009 3300046679 Bacteria 692
221 Ga0495613_0005565 3300046689 Bacteria 9458
222 Ga0495670_0112990 3300046691 Bacteria 1407
223 Ga0495600_0017986 3300046809 Bacteria 4499
224 Ga0495675_0307002 3300047444 Bacteria 941
225 Ga0495686_0220835 3300047472 Bacteria 1078
226 Ga0495615_0110818 3300048090 Bacteria 785
227 Ga0496102_0000406 3300048905 Bacteria 50075
228 Ga0496103_0011137 3300048906 Bacteria 5327
229 Ga0496115_0255146 3300048918 Bacteria 1443
230 Ga0501033_0092301 3300049570 Bacteria 2214
231 Ga0501034_0009567 3300049571 Bacteria 10143
232 Ga0501034_0011139 3300049571 Bacteria 9331
233 Ga0501036_0113352 3300049572 Bacteria 2291
234 Ga0501038_0809865 3300049574 Bacteria 696
235 Ga0501043_0203315 3300049579 Bacteria 1537
236 Ga0501046_0189340 3300049580 Bacteria 1535
237 Ga0501047_0043434 3300049581 Bacteria 4342
238 Ga0501044_0049325 3300049823 Bacteria 4346
239 nmdc:mga00v17_721543_c1 3300050491 Bacteria 638
240 nmdc:mga0k408_113632_c1 3300050493 Bacteria 1601
241 nmdc:mga0k408_128087_c1 3300050493 Bacteria 1506
242 nmdc:mga0k408_168753_c1 3300050493 Bacteria 1304
243 nmdc:mga0k408_347538_c1 3300050493 Bacteria 884
244 nmdc:mga0k408_363529_c1 3300050493 Bacteria 862
245 nmdc:mga0k408_622552_c1 3300050493 Bacteria 636
246 nmdc:mga0k408_96317_c1 3300050493 Bacteria 1742
247 nmdc:mga06z11_170192_c1 3300050494 Bacteria 1250
248 nmdc:mga07m45_112978_c1 3300050496 Bacteria 1565
249 nmdc:mga07m45_442603_c1 3300050496 Bacteria 754
250 nmdc:mga0qj67_667797_c1 3300050509 Bacteria 828
251 nmdc:mga0qj67_77182_c1 3300050509 Bacteria 2665
252 nmdc:mga06r32_105137_c1 3300050510 Bacteria 2773
253 nmdc:mga06r32_205073_c1 3300050510 Bacteria 1959
254 nmdc:mga08y16_256422_c1 3300050511 Bacteria 1806
255 nmdc:mga08y16_274869_c1 3300050511 Bacteria 1738
256 nmdc:mga0a205_35204_c1 3300050515 Bacteria 4807
257 Ga0500646_0390503 3300053090 Bacteria 513
258 Ga0500650_0342820 3300053098 Bacteria 655
259 Ga0500588_0087217 3300053146 Bacteria 1055
260 2510895997 2510461076 Bacteria 8618824
261 2514023466 2513237162 Bacteria 7468464
262 2515634601 2515154113 Bacteria 7807172
263 2515645355 2515154114 Bacteria 7848616
264 2515660839 2515154116 Bacteria 7552979
265 2517410538 2517287029 Bacteria 6905599
266 2525556017 2524614729 Bacteria 3091755
267 2630651031 2627854209 Bacteria 3093011
268 Ga0265327_10000419
269 Ga0065714_10087394
270 Ga0065712_10742950
271 Ga0065715_10019875
272 Ga0070690_101321716
273 Ga0070670_100192877
274 Ga0070677_10125813
275 Ga0070677_10672046
276 Ga0068869_100072425
277 Ga0068868_100015816
278 Ga0070687_101263733
279 Ga0070669_100305016
280 Ga0070669_101294861
281 Ga0070675_100303542
282 Ga0070675_102125219
283 Ga0070688_100605596
284 Ga0070667_100000705
285 Ga0070667_100272078
286 Ga0070703_10000095
287 Ga0070703_10000930
288 Ga0070714_100170278
289 Ga0070713_100063926
290 Ga0070705_100000080
291 Ga0070700_101191542
292 Ga0070700_101317605
293 Ga0070694_100322329
294 Ga0070694_100401135
295 Ga0070694_100515708
296 Ga0070708_100050007
297 Ga0070708_101761805
298 Ga0070678_102075925
299 Ga0068867_100383634
300 Ga0070706_100000108
301 Ga0070706_100015226
302 Ga0070707_100000314
303 Ga0070707_100520103
304 Ga0070698_100145582
305 Ga0070698_100302550
306 Ga0070698_100867151
307 Ga0070699_100221227
308 Ga0070697_100026602
309 Ga0070672_100290600
310 Ga0070695_100994160
311 Ga0070696_100432493
312 Ga0070696_101361509
313 Ga0070693_100035691
314 Ga0070665_100087623
315 Ga0070665_100130235
316 Ga0070704_100529231
317 Ga0070704_101546394
318 Ga0068855_100029505
319 Ga0068857_101855214
320 Ga0070702_100453430
321 Ga0070702_100968286
322 Ga0070702_101018373
323 Ga0068852_100088607
324 Ga0068859_100029793
325 Ga0068859_100311823
326 Ga0068859_100477055
327 Ga0068859_102011305
328 Ga0068859_102984906
329 Ga0068864_100030734
330 Ga0068864_100683572
331 Ga0068861_100386516
332 Ga0068861_100586770
333 Ga0068861_101459496
334 Ga0068851_10255359
335 Ga0068863_100093773
336 Ga0068863_101106461
337 Ga0068863_101560210
338 Ga0068863_101744846
339 Ga0068863_102472951
340 Ga0068858_100013802
341 Ga0068860_100097921
342 Ga0068860_101742866
343 Ga0075368_10120070
344 Ga0075363_100189498
345 Ga0075364_10991848
346 Ga0075362_10198018
347 Ga0075367_10058436
348 Ga0075367_10319594
349 Ga0075366_10238710
350 Ga0075366_10781217
351 Ga0075370_10522479
352 Ga0075370_10771076
353 Ga0068871_101165400
354 Ga0075428_100449169
355 Ga0075430_100686561
356 Ga0075431_100118814
357 Ga0075431_100378975
358 Ga0075429_100474667
359 Ga0097620_100029793
360 Ga0097620_100311853
361 Ga0097620_100477112
362 Ga0097620_100721195
363 Ga0097620_102011436
364 Ga0097620_102985035
365 Ga0099794_10132115
366 Ga0105240_10000076
367 Ga0105240_10821913
368 Ga0111539_10254121
369 Ga0111539_10523794
370 Ga0111539_11498441
371 Ga0105245_10021700
372 Ga0105245_12311531
373 Ga0105247_10118569
374 Ga0105247_10160954
375 Ga0114129_10944051
376 Ga0105242_10145455
377 Ga0105248_10014247
378 Ga0105248_10056595
379 Ga0105248_10175010
380 Ga0105248_12083621
381 Ga0105237_10000226
382 Ga0105237_11497876
383 Ga0105238_10586128
384 Ga0105249_11273710
385 Ga0105239_10000641
386 Ga0105246_10063131
387 Ga0157370_10000455
388 Ga0157369_11469239
389 Ga0157374_10331995
390 Ga0157378_10344261
391 Ga0157378_10466819
392 Ga0157378_12373271
393 Ga0163162_13233280
394 Ga0157375_10163655
395 Ga0157375_10485389
396 Ga0157375_10695730
397 Ga0163163_10131646
398 Ga0157380_10062300
399 Ga0157380_10672232
400 Ga0157380_10783692
401 Ga0157380_10918992
402 Ga0182008_10025955
403 Ga0157379_10023857
404 Ga0157379_10095627
405 Ga0157376_10327055
406 Ga0157376_12338333
407 Ga0157376_12379701
408 Ga0207653_10000119
409 Ga0207682_10040929
410 Ga0207682_10430523
411 Ga0207684_10000444
412 Ga0207684_10040803
413 Ga0207654_10175597
414 Ga0207671_10465400
415 Ga0207662_10574422
416 Ga0207646_10000022
417 Ga0207646_11039478
418 Ga0207681_10235813
419 Ga0207650_10432373
420 Ga0207659_10261954
421 Ga0207687_10025347
422 Ga0207700_10124749
423 Ga0207664_10422296
424 Ga0207670_10394950
425 Ga0207691_10256385
426 Ga0207691_10548999
427 Ga0207711_10229612
428 Ga0207711_10373454
429 Ga0207711_10687654
430 Ga0207711_11431176
431 Ga0207689_10138580
432 Ga0207651_11137911
433 Ga0207668_10073171
434 Ga0207668_10267265
435 Ga0207658_10118596
436 Ga0207658_10410891
437 Ga0207658_11743043
438 Ga0207677_10140638
439 Ga0207703_10196941
440 Ga0207641_10548127
441 Ga0207641_12061552
442 Ga0207641_12444870
443 Ga0207648_10207504
444 Ga0207676_10167965
445 Ga0207675_100126579
446 Ga0207675_100888526
447 Ga0210002_1014537
448 Ga0209983_1036766
449 Ga0209974_10016553
450 Ga0268266_10054887
451 Ga0268265_11712173
452 Ga0268265_11812083
453 Ga0268264_12057338
454 Ga0268264_12383126
455 Ga0307515_10720105
456 Ga0307513_10001365
457 Ga0307513_10012227
458 Ga0307513_10293538
459 Ga0307513_10315639
460 Ga0307513_10519299
461 Ga0307408_100014278
462 Ga0307516_10002426
463 Ga0307414_10148881
464 Ga0395905_0000374
465 Ga0395905_0002016
466 Ga0451791_0153198
467 Ga0451791_1852924
468 Ga0451795_0648233
469 Ga0451843_0071562
470 Ga0453683_0709442
471 Ga0495592_0189150
472 Ga0495638_0305098
473 Ga0495605_0446793
474 Ga0495639_0062030
475 Ga0495585_0025650
476 Ga0495620_0266461
477 Ga0495631_0066794
478 Ga0495663_0065947
479 Ga0495640_0492000
480 Ga0495586_0500942
481 Ga0495667_0108475
482 Ga0495668_0053018
483 Ga0495611_0152218
484 Ga0495625_0678859
485 Ga0495588_0440127
486 Ga0495599_0473336
487 Ga0495623_0444009
488 Ga0495613_0005565
489 Ga0495670_0112990
490 Ga0495600_0017986
491 Ga0495675_0307002
492 Ga0495686_0220835
493 Ga0495615_0110818
494 Ga0496102_0000406
495 Ga0496103_0011137
496 Ga0496115_0255146
497 Ga0501033_0092301
498 Ga0501034_0009567
499 Ga0501034_0011139
500 Ga0501036_0113352
501 Ga0501038_0809865
502 Ga0501043_0203315
503 Ga0501046_0189340
504 Ga0501047_0043434
505 Ga0501044_0049325
506 nmdc:mga00v17_721543_c1
507 nmdc:mga0k408_113632_c1
508 nmdc:mga0k408_128087_c1
509 nmdc:mga0k408_168753_c1
510 nmdc:mga0k408_347538_c1
511 nmdc:mga0k408_363529_c1
512 nmdc:mga0k408_622552_c1
513 nmdc:mga0k408_96317_c1
514 nmdc:mga06z11_170192_c1
515 nmdc:mga07m45_112978_c1
516 nmdc:mga07m45_442603_c1
517 nmdc:mga0qj67_667797_c1
518 nmdc:mga0qj67_77182_c1
519 nmdc:mga06r32_105137_c1
520 nmdc:mga06r32_205073_c1
521 nmdc:mga08y16_256422_c1
522 nmdc:mga08y16_274869_c1
523 nmdc:mga0a205_35204_c1
524 Ga0500646_0390503
525 Ga0500650_0342820
526 Ga0500588_0087217
527 2510895997
528 2514023466
529 2515634601
530 2515645355
531 2515660839
532 2517410538
533 2525556017
534 2630651031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9647 15 62
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9533 15 70
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9471 14 71
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9469 6 79
2l02-assembly1.cif.gz_A solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 0.944 14 71
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.985 12 69 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9746 8 70 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9616 15 71 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9573 12 70 1.10.10.10
af_P64638_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9559 15 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A526V880-F1-model_v4 Helix-turn-helix transcriptional regulator 1.001 1 72 GO:0003700
AF-A0A662HZQ9-F1-model_v4 HTH arsR-type domain-containing protein 0.9993 9 72 GO:0003700
AF-A0A526V880-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9868 1 72 GO:0003700
AF-A0A837HSP5-F1-model_v4 HTH arsR-type domain-containing protein 0.9751 4 71 GO:0003700
AF-A0A7C5F9W1-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9747 4 71 GO:0003700
GO:0016020

Map