F374823

General Info

Members Datasets Scaffolds Average Seq Length
267 206 534 137

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10649458|Ga0207664_106494582
Length 157
Sequence MAEEPSISNGLFTHRYPKECTMQVNPYLTFNGQCEAAFKFYEQCLDGQIEAMMTHGDSPMANQVSSEWQKKILHARLMIGDKALMGSDAPPERYEKPQGFSIALGIDDPAKAERIFHALADNGTVTMPIQQTFWAARFGMLVDRFGIPWMVNCEQAA

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
99 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
100 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
101 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 1.87
Rhizoplane 3
Rhizosphere 91.39
Stem 0
Stem Tuber 0
Unclassified 18.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10649458 3300025929 Bacteria 948
2 JGI25405J52794_10005688 3300003911 Bacteria 2259
3 JGI25405J52794_10010602 3300003911 Bacteria 1754
4 Ga0065704_10385732 3300005289 Unclassified 755
5 Ga0065707_10824832 3300005295 Unclassified 591
6 Ga0070658_10006292 3300005327 Bacteria 9616
7 Ga0070676_10532383 3300005328 Bacteria 838
8 Ga0070666_10667775 3300005335 Bacteria 761
9 Ga0070680_100569584 3300005336 Bacteria 971
10 Ga0068868_100411540 3300005338 Bacteria 1169
11 Ga0070689_101245696 3300005340 Unclassified 669
12 Ga0070689_101272021 3300005340 Bacteria 662
13 Ga0070669_100817358 3300005353 Bacteria 793
14 Ga0070675_100849920 3300005354 Bacteria 835
15 Ga0070671_100194776 3300005355 Bacteria 1718
16 Ga0070674_100379416 3300005356 Bacteria 1150
17 Ga0070673_101522436 3300005364 Bacteria 631
18 Ga0070659_100852682 3300005366 Bacteria 794
19 Ga0070714_100342337 3300005435 Bacteria 1403
20 Ga0070714_102090697 3300005435 Unclassified 552
21 Ga0070701_10051726 3300005438 Bacteria 2132
22 Ga0070711_100319716 3300005439 Bacteria 1240
23 Ga0070705_100723194 3300005440 Unclassified 784
24 Ga0070694_100299505 3300005444 Bacteria 1232
25 Ga0070663_100991093 3300005455 Viruses 730
26 Ga0070678_100462891 3300005456 Unclassified 1113
27 Ga0070678_100516479 3300005456 Bacteria 1056
28 Ga0070678_100571138 3300005456 Bacteria 1006
29 Ga0070662_100488729 3300005457 Bacteria 1026
30 Ga0070681_10019418 3300005458 Bacteria 6802
31 Ga0070681_10564811 3300005458 Bacteria 1052
32 Ga0070681_11496169 3300005458 Bacteria 600
33 Ga0070706_100000846 3300005467 Bacteria 33705
34 Ga0070706_100598058 3300005467 Bacteria 1025
35 Ga0070698_101780008 3300005471 Unclassified 569
36 Ga0070679_100320535 3300005530 Bacteria 1499
37 Ga0070679_101349073 3300005530 Bacteria 659
38 Ga0070697_100001769 3300005536 Bacteria 16484
39 Ga0070686_100302257 3300005544 Bacteria 1187
40 Ga0070686_101157018 3300005544 Bacteria 641
41 Ga0070696_100293315 3300005546 Bacteria 1243
42 Ga0070696_100462252 3300005546 Bacteria 1003
43 Ga0070665_100000082 3300005548 Bacteria 184202
44 Ga0070665_100152091 3300005548 Bacteria 2317
45 Ga0070704_100152142 3300005549 Bacteria 1820
46 Ga0070704_100959627 3300005549 Unclassified 772
47 Ga0068855_101396885 3300005563 Bacteria 722
48 Ga0068854_100242993 3300005578 Bacteria 1434
49 Ga0068852_101553614 3300005616 Bacteria 684
50 Ga0068859_102067357 3300005617 Unclassified 629
51 Ga0068864_100035320 3300005618 Bacteria 4255
52 Ga0068864_101093528 3300005618 Bacteria 793
53 Ga0068861_100009482 3300005719 Bacteria 6722
54 Ga0068861_100736411 3300005719 Bacteria 919
55 Ga0068863_100007691 3300005841 Bacteria 10540
56 Ga0068862_100241494 3300005844 Bacteria 1642
57 Ga0068862_100760701 3300005844 Unclassified 943
58 Ga0068862_101791601 3300005844 Unclassified 623
59 Ga0081455_10021049 3300005937 Bacteria 6125
60 Ga0081455_10032925 3300005937 Bacteria 4664
61 Ga0081538_10078813 3300005981 Bacteria 1765
62 Ga0081540_1041662 3300005983 Bacteria 2378
63 Ga0070717_10858199 3300006028 Bacteria 826
64 Ga0075365_10002442 3300006038 Bacteria 9120
65 Ga0075365_10990003 3300006038 Bacteria 592
66 Ga0070715_10377700 3300006163 Unclassified 781
67 Ga0070716_100260082 3300006173 Bacteria 1187
68 Ga0070712_100024893 3300006175 Bacteria 3972
69 Ga0097621_100570794 3300006237 Bacteria 1031
70 Ga0075428_100166120 3300006844 Unclassified 2394
71 Ga0075428_100396261 3300006844 Bacteria 1480
72 Ga0075428_100625976 3300006844 Bacteria 1149
73 Ga0075431_100265541 3300006847 Bacteria 1741
74 Ga0075434_100069307 3300006871 Unclassified 3516
75 Ga0068865_101224247 3300006881 Unclassified 665
76 Ga0097620_102066830 3300006931 Unclassified 629
77 Ga0099824_1016972 3300006942 Bacteria 6452
78 Ga0099822_1004807 3300006943 Bacteria 17628
79 Ga0075435_101574072 3300007076 Unclassified 576
80 Ga0099794_10232377 3300007265 Bacteria 949
81 Ga0105240_10013786 3300009093 Bacteria 11074
82 Ga0111539_10027012 3300009094 Bacteria 7011
83 Ga0111539_10457764 3300009094 Bacteria 1486
84 Ga0111539_10648964 3300009094 Bacteria 1229
85 Ga0105247_10143796 3300009101 Bacteria 1565
86 Ga0114129_10705763 3300009147 Bacteria 1296
87 Ga0114129_11249790 3300009147 Unclassified 923
88 Ga0114129_11892841 3300009147 Bacteria 723
89 Ga0105243_11301600 3300009148 Bacteria 744
90 Ga0105248_10345531 3300009177 Bacteria 1675
91 Ga0105248_10496219 3300009177 Bacteria 1376
92 Ga0105248_10738259 3300009177 Bacteria 1111
93 Ga0105249_10046274 3300009553 Bacteria 3959
94 Ga0105249_10372657 3300009553 Bacteria 1452
95 Ga0157374_12767114 3300013296 Unclassified 518
96 Ga0163162_10701140 3300013306 Bacteria 1134
97 Ga0163162_10912111 3300013306 Bacteria 991
98 Ga0157375_11067699 3300013308 Unclassified 944
99 Ga0163163_10002698 3300014325 Bacteria 15003
100 Ga0157380_10016945 3300014326 Bacteria 5383
101 Ga0157380_10070520 3300014326 Bacteria 2824
102 Ga0157380_10268308 3300014326 Unclassified 1554
103 Ga0157379_10671471 3300014968 Bacteria 971
104 Ga0157376_10350886 3300014969 Bacteria 1412
105 Ga0206356_11268951 3300020070 Bacteria 716
106 Ga0206352_10171208 3300020078 Unclassified 679
107 Ga0213876_10227212 3300021384 Bacteria 992
108 Ga0213875_10000132 3300021388 Bacteria 82929
109 Ga0207710_10425909 3300025900 Bacteria 683
110 Ga0207680_10580255 3300025903 Bacteria 801
111 Ga0207699_10000137 3300025906 Bacteria 49548
112 Ga0207699_10177094 3300025906 Bacteria 1431
113 Ga0207705_10188071 3300025909 Bacteria 1560
114 Ga0207684_10000363 3300025910 Bacteria 61249
115 Ga0207707_10014698 3300025912 Bacteria 6822
116 Ga0207707_10164652 3300025912 Bacteria 1938
117 Ga0207707_11042817 3300025912 Bacteria 669
118 Ga0207695_10010895 3300025913 Bacteria 11065
119 Ga0207681_10281871 3300025923 Bacteria 1309
120 Ga0207681_11028168 3300025923 Bacteria 691
121 Ga0207706_10049442 3300025933 Unclassified 3715
122 Ga0207665_11463057 3300025939 Unclassified 543
123 Ga0207691_10827997 3300025940 Bacteria 777
124 Ga0207711_11058819 3300025941 Bacteria 751
125 Ga0207651_10831235 3300025960 Bacteria 820
126 Ga0207712_10386314 3300025961 Bacteria 1173
127 Ga0207712_10974369 3300025961 Bacteria 752
128 Ga0207640_10268775 3300025981 Bacteria 1333
129 Ga0207677_10326275 3300026023 Bacteria 1278
130 Ga0207641_10000459 3300026088 Bacteria 46432
131 Ga0207641_10087386 3300026088 Bacteria 2720
132 Ga0207676_10022649 3300026095 Unclassified 4621
133 Ga0207675_100066497 3300026118 Bacteria 3370
134 Ga0207675_100254470 3300026118 Bacteria 1700
135 Ga0207675_100470868 3300026118 Unclassified 1247
136 Ga0207683_10688970 3300026121 Bacteria 947
137 Ga0209589_1000005 3300027357 Bacteria 530958
138 Ga0209489_100005 3300027361 Bacteria 530958
139 Ga0209700_100006 3300027363 Bacteria 530958
140 Ga0209971_1023734 3300027682 Unclassified 1463
141 Ga0207428_10002586 3300027907 Bacteria 18072
142 Ga0207428_10735793 3300027907 Bacteria 704
143 Ga0268266_10000027 3300028379 Bacteria 426852
144 Ga0268265_10409443 3300028380 Bacteria 1256
145 Ga0268265_10896003 3300028380 Bacteria 871
146 Ga0265319_1083135 3300028563 Bacteria 1015
147 Ga0265338_10308855 3300028800 Bacteria 1147
148 Ga0307511_10004510 3300030521 Bacteria 14218
149 Ga0265320_10216711 3300031240 Bacteria 853
150 Ga0307408_100449884 3300031548 Bacteria 1117
151 Ga0265313_10310134 3300031595 Unclassified 632
152 Ga0265314_10316951 3300031711 Bacteria 869
153 Ga0307405_10340653 3300031731 Bacteria 1153
154 Ga0307405_10424146 3300031731 Bacteria 1048
155 Ga0307410_11162510 3300031852 Bacteria 671
156 Ga0307407_10604226 3300031903 Bacteria 817
157 Ga0307412_10287245 3300031911 Bacteria 1294
158 Ga0307409_100019351 3300031995 Bacteria 4607
159 Ga0307409_101028849 3300031995 Bacteria 843
160 Ga0307416_100185071 3300032002 Bacteria 1957
161 Ga0307414_12050970 3300032004 Unclassified 534
162 Ga0307414_12253200 3300032004 Unclassified 509
163 Ga0307411_10873609 3300032005 Bacteria 797
164 Ga0307411_10924774 3300032005 Bacteria 776
165 Ga0307415_100082284 3300032126 Unclassified 2303
166 Ga0307415_101701667 3300032126 Bacteria 608
167 Ga0373934_0008269 3300035086 Bacteria 3875
168 Ga0373923_0106697 3300035111 Unclassified 1240
169 Ga0373945_0233793 3300035116 Unclassified 772
170 Ga0373954_0019102 3300035118 Bacteria 3089
171 Ga0373956_0111221 3300035119 Unclassified 1275
172 Ga0373957_0016995 3300035120 Bacteria 2527
173 Ga0373943_0043958 3300035170 Unclassified 2172
174 Ga0373946_0413728 3300035171 Unclassified 682
175 Ga0373955_0125438 3300035172 Unclassified 1495
176 Ga0373924_0043520 3300035410 Bacteria 1844
177 Ga0373935_0220141 3300035692 Unclassified 1318
178 Ga0373927_0400459 3300035695 Unclassified 905
179 Ga0373933_0024599 3300035724 Bacteria 3447
180 Ga0373933_0656166 3300035724 Bacteria 690
181 Ga0373947_0044340 3300035725 Bacteria 2658
182 Ga0373947_0106357 3300035725 Unclassified 1768
183 Ga0373937_0060061 3300036401 Bacteria 3493
184 Ga0373937_0219156 3300036401 Unclassified 1791
185 Ga0373925_0822551 3300037068 Bacteria 766
186 Ga0436364_0580258 3300037853 Bacteria 1727
187 Ga0436364_0717863 3300037853 Bacteria 145182
188 Ga0436365_0656227 3300039437 Bacteria 1374
189 Ga0436362_0141158 3300039453 Bacteria 1196
190 Ga0439435_0007308 3300042436 Bacteria 2522
191 Ga0451577_0337722 3300042876 Bacteria 1366
192 Ga0495603_0000481 3300046455 Bacteria 22054
193 Ga0495629_0013201 3300046459 Bacteria 5964
194 Ga0495653_0615927 3300046463 Unclassified 666
195 Ga0495653_0916484 3300046463 Unclassified 521
196 Ga0495580_0017067 3300046472 Bacteria 5438
197 Ga0495582_0055542 3300046473 Bacteria 2183
198 Ga0495639_0037399 3300046475 Bacteria 2175
199 Ga0495594_0000380 3300046499 Bacteria 22228
200 Ga0495608_0093280 3300046511 Bacteria 1945
201 Ga0495665_0037003 3300046531 Bacteria 2605
202 Ga0495640_0094682 3300046533 Bacteria 1967
203 Ga0495598_0152178 3300046537 Bacteria 808
204 Ga0495622_0023658 3300046557 Bacteria 2865
205 Ga0495634_0058500 3300046642 Bacteria 2569
206 Ga0495659_0059250 3300046664 Bacteria 1411
207 Ga0495588_0004943 3300046674 Bacteria 5914
208 Ga0495647_0002545 3300046681 Bacteria 5776
209 Ga0495658_0011442 3300046683 Bacteria 4464
210 Ga0495613_0014226 3300046689 Bacteria 5905
211 Ga0495624_0083511 3300046690 Bacteria 1975
212 Ga0495581_0012883 3300047315 Bacteria 4845
213 Ga0495676_0023767 3300047321 Bacteria 5314
214 Ga0495680_0062165 3300047322 Bacteria 2872
215 Ga0495684_0329169 3300047471 Unclassified 1090
216 Ga0495684_0371498 3300047471 Bacteria 1011
217 Ga0495593_0012936 3300047673 Bacteria 4765
218 Ga0495614_0074291 3300048089 Unclassified 1468
219 Ga0496103_0638461 3300048906 Bacteria 677
220 Ga0496104_0094494 3300048907 Bacteria 2860
221 Ga0496107_0138216 3300048910 Bacteria 1800
222 Ga0496109_0465795 3300048912 Bacteria 1193
223 Ga0496112_0239749 3300048915 Bacteria 1766
224 Ga0496114_0140954 3300048917 Bacteria 2087
225 Ga0496114_0198505 3300048917 Bacteria 1757
226 Ga0496115_1203260 3300048918 Unclassified 569
227 Ga0496121_0238754 3300048924 Bacteria 1268
228 Ga0501033_0407758 3300049570 Bacteria 947
229 Ga0501034_0002455 3300049571 Bacteria 22342
230 Ga0501036_0244883 3300049572 Bacteria 1503
231 Ga0501036_0602349 3300049572 Bacteria 911
232 Ga0501037_0016149 3300049573 Bacteria 5495
233 Ga0501041_0017692 3300049577 Bacteria 4242
234 Ga0501042_0010230 3300049578 Bacteria 6279
235 Ga0501043_1275089 3300049579 Unclassified 513
236 Ga0501046_0000473 3300049580 Bacteria 40255
237 Ga0501048_0006631 3300049582 Bacteria 8798
238 Ga0501048_0410289 3300049582 Bacteria 969
239 Ga0501071_0175746 3300049587 Bacteria 1604
240 Ga0501072_0249047 3300049588 Bacteria 1415
241 Ga0501074_0012067 3300049590 Bacteria 6278
242 Ga0501077_0482836 3300049593 Bacteria 794
243 Ga0501079_0009589 3300049741 Bacteria 7342
244 Ga0501081_0010394 3300049743 Bacteria 6069
245 Ga0501083_0189489 3300049744 Bacteria 1342
246 Ga0501045_0006078 3300049824 Bacteria 8362
247 nmdc:mga0yw44_1070_c1 3300050492 Bacteria 10520
248 nmdc:mga05p37_515143_c1 3300050507 Bacteria 1369
249 nmdc:mga05p37_813783_c1 3300050507 Bacteria 1020
250 nmdc:mga09592_97157_c1 3300050508 Bacteria 2520
251 nmdc:mga06r32_223992_c1 3300050510 Bacteria 1869
252 nmdc:mga06r32_571354_c1 3300050510 Bacteria 1103
253 nmdc:mga08y16_1677627_c1 3300050511 Unclassified 591
254 nmdc:mga08y16_393686_c1 3300050511 Bacteria 1419
255 nmdc:mga08y16_779074_c1 3300050511 Bacteria 951
256 nmdc:mga0n895_6859_c1 3300050512 Bacteria 9724
257 nmdc:mga0rr50_1159127_c1 3300050513 Unclassified 657
258 nmdc:mga0a205_210704_c1 3300050515 Bacteria 1832
259 Ga0495601_0031848 3300053077 Bacteria 3279
260 Ga0495595_0053412 3300053084 Bacteria 1877
261 Ga0495595_0108879 3300053084 Unclassified 1342
262 Ga0495619_0013621 3300053085 Bacteria 5125
263 Ga0495619_0048284 3300053085 Bacteria 2805
264 Ga0501084_0004703 3300054114 Bacteria 11151
265 Ga0587128_126970 3300059630 Bacteria 561
266 Ga0501082_0000407 3300060353 Bacteria 38099
267 Ga0530510_0019693 3300061734 Bacteria 4792
268 Ga0207664_10649458
269 JGI25405J52794_10005688
270 JGI25405J52794_10010602
271 Ga0065704_10385732
272 Ga0065707_10824832
273 Ga0070658_10006292
274 Ga0070676_10532383
275 Ga0070666_10667775
276 Ga0070680_100569584
277 Ga0068868_100411540
278 Ga0070689_101245696
279 Ga0070689_101272021
280 Ga0070669_100817358
281 Ga0070675_100849920
282 Ga0070671_100194776
283 Ga0070674_100379416
284 Ga0070673_101522436
285 Ga0070659_100852682
286 Ga0070714_100342337
287 Ga0070714_102090697
288 Ga0070701_10051726
289 Ga0070711_100319716
290 Ga0070705_100723194
291 Ga0070694_100299505
292 Ga0070663_100991093
293 Ga0070678_100462891
294 Ga0070678_100516479
295 Ga0070678_100571138
296 Ga0070662_100488729
297 Ga0070681_10019418
298 Ga0070681_10564811
299 Ga0070681_11496169
300 Ga0070706_100000846
301 Ga0070706_100598058
302 Ga0070698_101780008
303 Ga0070679_100320535
304 Ga0070679_101349073
305 Ga0070697_100001769
306 Ga0070686_100302257
307 Ga0070686_101157018
308 Ga0070696_100293315
309 Ga0070696_100462252
310 Ga0070665_100000082
311 Ga0070665_100152091
312 Ga0070704_100152142
313 Ga0070704_100959627
314 Ga0068855_101396885
315 Ga0068854_100242993
316 Ga0068852_101553614
317 Ga0068859_102067357
318 Ga0068864_100035320
319 Ga0068864_101093528
320 Ga0068861_100009482
321 Ga0068861_100736411
322 Ga0068863_100007691
323 Ga0068862_100241494
324 Ga0068862_100760701
325 Ga0068862_101791601
326 Ga0081455_10021049
327 Ga0081455_10032925
328 Ga0081538_10078813
329 Ga0081540_1041662
330 Ga0070717_10858199
331 Ga0075365_10002442
332 Ga0075365_10990003
333 Ga0070715_10377700
334 Ga0070716_100260082
335 Ga0070712_100024893
336 Ga0097621_100570794
337 Ga0075428_100166120
338 Ga0075428_100396261
339 Ga0075428_100625976
340 Ga0075431_100265541
341 Ga0075434_100069307
342 Ga0068865_101224247
343 Ga0097620_102066830
344 Ga0099824_1016972
345 Ga0099822_1004807
346 Ga0075435_101574072
347 Ga0099794_10232377
348 Ga0105240_10013786
349 Ga0111539_10027012
350 Ga0111539_10457764
351 Ga0111539_10648964
352 Ga0105247_10143796
353 Ga0114129_10705763
354 Ga0114129_11249790
355 Ga0114129_11892841
356 Ga0105243_11301600
357 Ga0105248_10345531
358 Ga0105248_10496219
359 Ga0105248_10738259
360 Ga0105249_10046274
361 Ga0105249_10372657
362 Ga0157374_12767114
363 Ga0163162_10701140
364 Ga0163162_10912111
365 Ga0157375_11067699
366 Ga0163163_10002698
367 Ga0157380_10016945
368 Ga0157380_10070520
369 Ga0157380_10268308
370 Ga0157379_10671471
371 Ga0157376_10350886
372 Ga0206356_11268951
373 Ga0206352_10171208
374 Ga0213876_10227212
375 Ga0213875_10000132
376 Ga0207710_10425909
377 Ga0207680_10580255
378 Ga0207699_10000137
379 Ga0207699_10177094
380 Ga0207705_10188071
381 Ga0207684_10000363
382 Ga0207707_10014698
383 Ga0207707_10164652
384 Ga0207707_11042817
385 Ga0207695_10010895
386 Ga0207681_10281871
387 Ga0207681_11028168
388 Ga0207706_10049442
389 Ga0207665_11463057
390 Ga0207691_10827997
391 Ga0207711_11058819
392 Ga0207651_10831235
393 Ga0207712_10386314
394 Ga0207712_10974369
395 Ga0207640_10268775
396 Ga0207677_10326275
397 Ga0207641_10000459
398 Ga0207641_10087386
399 Ga0207676_10022649
400 Ga0207675_100066497
401 Ga0207675_100254470
402 Ga0207675_100470868
403 Ga0207683_10688970
404 Ga0209589_1000005
405 Ga0209489_100005
406 Ga0209700_100006
407 Ga0209971_1023734
408 Ga0207428_10002586
409 Ga0207428_10735793
410 Ga0268266_10000027
411 Ga0268265_10409443
412 Ga0268265_10896003
413 Ga0265319_1083135
414 Ga0265338_10308855
415 Ga0307511_10004510
416 Ga0265320_10216711
417 Ga0307408_100449884
418 Ga0265313_10310134
419 Ga0265314_10316951
420 Ga0307405_10340653
421 Ga0307405_10424146
422 Ga0307410_11162510
423 Ga0307407_10604226
424 Ga0307412_10287245
425 Ga0307409_100019351
426 Ga0307409_101028849
427 Ga0307416_100185071
428 Ga0307414_12050970
429 Ga0307414_12253200
430 Ga0307411_10873609
431 Ga0307411_10924774
432 Ga0307415_100082284
433 Ga0307415_101701667
434 Ga0373934_0008269
435 Ga0373923_0106697
436 Ga0373945_0233793
437 Ga0373954_0019102
438 Ga0373956_0111221
439 Ga0373957_0016995
440 Ga0373943_0043958
441 Ga0373946_0413728
442 Ga0373955_0125438
443 Ga0373924_0043520
444 Ga0373935_0220141
445 Ga0373927_0400459
446 Ga0373933_0024599
447 Ga0373933_0656166
448 Ga0373947_0044340
449 Ga0373947_0106357
450 Ga0373937_0060061
451 Ga0373937_0219156
452 Ga0373925_0822551
453 Ga0436364_0580258
454 Ga0436364_0717863
455 Ga0436365_0656227
456 Ga0436362_0141158
457 Ga0439435_0007308
458 Ga0451577_0337722
459 Ga0495603_0000481
460 Ga0495629_0013201
461 Ga0495653_0615927
462 Ga0495653_0916484
463 Ga0495580_0017067
464 Ga0495582_0055542
465 Ga0495639_0037399
466 Ga0495594_0000380
467 Ga0495608_0093280
468 Ga0495665_0037003
469 Ga0495640_0094682
470 Ga0495598_0152178
471 Ga0495622_0023658
472 Ga0495634_0058500
473 Ga0495659_0059250
474 Ga0495588_0004943
475 Ga0495647_0002545
476 Ga0495658_0011442
477 Ga0495613_0014226
478 Ga0495624_0083511
479 Ga0495581_0012883
480 Ga0495676_0023767
481 Ga0495680_0062165
482 Ga0495684_0329169
483 Ga0495684_0371498
484 Ga0495593_0012936
485 Ga0495614_0074291
486 Ga0496103_0638461
487 Ga0496104_0094494
488 Ga0496107_0138216
489 Ga0496109_0465795
490 Ga0496112_0239749
491 Ga0496114_0140954
492 Ga0496114_0198505
493 Ga0496115_1203260
494 Ga0496121_0238754
495 Ga0501033_0407758
496 Ga0501034_0002455
497 Ga0501036_0244883
498 Ga0501036_0602349
499 Ga0501037_0016149
500 Ga0501041_0017692
501 Ga0501042_0010230
502 Ga0501043_1275089
503 Ga0501046_0000473
504 Ga0501048_0006631
505 Ga0501048_0410289
506 Ga0501071_0175746
507 Ga0501072_0249047
508 Ga0501074_0012067
509 Ga0501077_0482836
510 Ga0501079_0009589
511 Ga0501081_0010394
512 Ga0501083_0189489
513 Ga0501045_0006078
514 nmdc:mga0yw44_1070_c1
515 nmdc:mga05p37_515143_c1
516 nmdc:mga05p37_813783_c1
517 nmdc:mga09592_97157_c1
518 nmdc:mga06r32_223992_c1
519 nmdc:mga06r32_571354_c1
520 nmdc:mga08y16_1677627_c1
521 nmdc:mga08y16_393686_c1
522 nmdc:mga08y16_779074_c1
523 nmdc:mga0n895_6859_c1
524 nmdc:mga0rr50_1159127_c1
525 nmdc:mga0a205_210704_c1
526 Ga0495601_0031848
527 Ga0495595_0053412
528 Ga0495595_0108879
529 Ga0495619_0013621
530 Ga0495619_0048284
531 Ga0501084_0004703
532 Ga0587128_126970
533 Ga0501082_0000407
534 Ga0530510_0019693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

151

0.92

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

22

152

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.9446 1 133
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.9172 1 133
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8454 1 132
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8335 1 132
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8199 1 134
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9356 80 132 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9341 8 133 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9254 79 132 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9043 8 133 3.10.180.10
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8839 8 136 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A534DLE6-F1-model_v4 deleted 0.9907 1 136
AF-A0A6B9YNC6-F1-model_v4 VOC family protein 0.9901 1 135
AF-A0A7S7NKZ7-F1-model_v4 VOC family protein 0.9876 1 136
AF-A0A534BVA7-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9875 1 105 GO:0051213
AF-A0A5A7W8G8-F1-model_v4 VOC family protein 0.9874 1 135

Map